1K7GA

Prtc from erwinia chrysanthemi
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
455
structure length
455
Chain Sequence
NSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPGSEEYGRQTFTHEIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSIMSYWGENETGADYNGHYGGAPMIDDIAAIQRLYGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHGVTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLSAFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDIIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Protease C of Erwinia chrysanthemi: The Crystal Structure and Role of Amino Acids Y228 and E189
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords secreted protease C
total genus 151
structure length 455
sequence length 455
ec nomenclature ec 3.4.24.40: Serralysin.
pdb deposition date 2001-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
A PF00413 Peptidase_M10 Matrixin
A PF08548 Peptidase_M10_C Peptidase M10 serralysin C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 1k7gA01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1k7gA02
3USNA 4I03A 2MZHA 1ASTA 966CA 1QUAA 2O36A 1Y93A 4WKEA 1PWVA 1I73A 3LUMA 3F18A 3KECA 5CXAA 5CZMA 1HFCA 1DMTA 3LUNA 1SATA 1BM6A 1HOVA 1IABA 5D2BA 1CGFA 4PKUA 1JKYA 3V96B 1EUBA 1ZTQA 4H2EA 4CTHA 1GO7P 4WKIA 1O0QA 1GXDA 5CUHA 4A3WA 1Q3AA 3EWJA 1JAPA 4ZR5A 3RTTA 2JIHA 2OW2A 1R1IA 4PKSA 4GR3A 5BOTA 2FV9A 5CVWA 3EDZA 1BQOA 1OS9A 2MZEA 3LILA 1CGEA 3DNGA 1UTZA 4DV8A 2E2DA 2OXWA 1JAQA 3GBOA 4XBHA 1JJ9A 1CIZA 1OM6A 3P1VA 1JIZA 3HDAP 2JT5A 3LIRA 2X3CA 1UEAA 2YIGA 1KUFA 3WV1A 3TS4A 2W12A 2SRTA 4IJOA 5I3MA 1K7GA 1C3IA 1KBCA 1SLMA 2Z2DA 3I7IA 3UVCA 2ZVDA 4HX3A 3LMCA 1ZS0A 3LJZA 5L79A 3KRYA 5D1UA 5L7FA 1HY7A 3TT4A 1HTDA 3DPFA 1G49A 1YP1A 1KUIA 1R55A 2USNA 5I43A 2OW1A 3LKAA 1R1JA 2I47A 4H82A 1IADA 1FBLA 1BKCA 3KHIA 1OS2A 3BA0A 1PWQA 2QUAA 1PWPA 4DD8A 3HDBA 2W0DA 2JSDA 3K7NA 2YO0A 1FLSA 1YCMA 1C8TA 4AYKA 2K2GA 5I2ZA 2JNPA 1GKDA 5LABA 4EFSA 3LEAA 3MA2A 2RJQA 3ZXHA 4JIJA 1S4BP 5JMYA 2W15A 3HB2P 1Y0VA 2YO1A 3F17A 3LA9A 3U1RA 1QJJA 2ZJ6A 4FVLA 1BIWA 1XFVA 2OW9A 2J0TA 3AYUA 1SRPA 1BZSA 1XFZA 2FV5A 5D7WA 2AYKA 4L6TA 3LAAA 2MLRA 3S6LA 1CXVA 2L0RA 2D1NA 4JA1A 2TCLA 5CXLA 2DDYA 4L63A 2W13A 1G9KA 3K7LA 3LJTA 1AKLA 4G0DA 2POJA 1IAEA 5D3CA 1SLNA 2OVXA 2WO9A 3LK8A 2WOAA 1A85A 2OXZA 4WK7A 1OMJA 2RJPA 1KUGA 3I7GA 1YOUA 1A86A 3F16A 1SMPA 4AUOA 2EROA 1USNA 2OY2A 3E8RA 5D1SA 1XFXA 5I0LA 4A7BA 3ZVSA 4Q1LA 4GUYA 1I1IP 1QJIA 1GKCA 3LJGA 4J4MA 1CGLA 1UMSA 1JANA 4JP4A 1BUVM 1KUHA 1XFWA 1B3DA 1JH1A 3RTSA 2XS3A 1DTHA 2AIGP 1Z3JA 2DW2A 2X3BA 1CAQA 4G9LA 1PWWA 1ND1A 3G42A 1FM1A 2OZRA 1XFUA 4DF9A 1ZP5A 4FXQA 1Y8JA 4IUWA 5H8XA 3TVCA 3EHXA 2JT6A 1UMTA 2ML2A 1BKCE 2X3AA 3CKIA 3EDGA 1JIWP 2K9CA 1D5JA 4H49A 4GWMA 1QIAA 4FXYP 4XCTA 2DW1A 3AYKA 1XURA 4PKTA 4GF1A 5B5OA 3EDIA 1BQQM 830CA 1P9HA 1QICA 2OW0A 1B8YA 1RMZA 4DPEA 2ZJ7A 1YQYA 2D1OA 3VTGA 3A70A 4ON1A 2WO8A 5B5PA 1K7IA 2MLSA 4H84A 3DL1A 3F1AA 3DPEA 1H71P 2DW0A 3DWBA 2Y6CA 3HY7A 5BOYA 1SU3A 1WNIA 3SHIA 1ZVXA 1R1HA 1ZXCA 3WV3A 2OVZA 2XQHA 3A6ZA 3KEKA 4JPAA 3EHYA 3OHLA 3LQBA 2DDFA 1XUDA 2A8HA 3KMEA 2ERPA 4I35A 2KRJA 4PKWA 3HBUP 2W14A 1EB6A 1PWUA 4H1QA 1BSWA 1CQRA 1JAOA 1HV5A 1L6JA 1XUCA 3OHOA 4H30A 1J7NA 1OM7A 4PKRA 4PKQA 4IN9A 4AIGA 4GQLA 3LQ0A 1GO8P 1IAGA 2X7MA 1OO9A 2OI0A 3NX7A 4H76A 3EDHA 4QKZA 2XS4A 4GWNA 2Y6DA 1R54A 3HY9A 1G05A 4L19A 3LE9A 3N2VA 3WV2A 3B8ZA 1D8MA 4AXQA 2N8RA 1EAKA 5BPAA 1KUKA 3DSLA 3LIKA 4GR0A 4WF6A 1JK3A 3B92A 3L0TA 2E3XA 4H3XA 3NTNA 3Q2GA 5D1TA 2CLTA 3G5CA 1G12A 4FU4A 1G4KA 1IAAA 3AIGA 2V4BA 2OXUA 1I76A 3O64A 1D8FA 4GR8A 3VI1A 2AGMA 3ULTA 1RM8A 1BKCI 1GE7A 1GE6A 1ZXVA 1O0TA 1C7KA 3HBVP 1HFSA 3F19A 1MMRA 1MMQA 2QUBA 2YB9A 3L0VA 1AF0A 1UTTA 1MMPA 4XM8A 5I4OA 456CA 3P24A 3LGPA 1OM8A 2OY4A 2J83A 5I12A 4HMAA 3HYGA 1MNCA 4XM7A 1ATLA 1ROSA 1AYKA 2HU6A 1IACA 2MZIA 3B2ZA 1KAPP 2Z8XA 4ILWD 1GE5A 2Z8ZA 2QPJA 1CK7A 3WP8A 4PKVA 3N2UA 3ELMA 2CKIA 3KMCA 4JQGA 1XFYA 4WZVA 1QIBA 2O3EA 3ZUKA 1MMBA 1D7XA 1BUDA 3O2XA 4XM6A 2PJTA 2ERQA 3Q2HA 3KWVC 3F15A 3KEJA 1K7QA 3TSKA 4R3VA
chains in the Genus database with same CATH superfamily
3USNA 4I03A 2MZHA 1ASTA 966CA 1QUAA 2O36A 1Y93A 4WKEA 1PWVA 1I73A 3LUMA 3F18A 3KECA 5CXAA 5CZMA 1HFCA 1DMTA 3LUNA 1SATA 1BM6A 1HOVA 1IABA 5D2BA 1CGFA 4PKUA 1JKYA 3V96B 1EUBA 1ZTQA 4H2EA 2YUFA 4CTHA 1GO7P 4WKIA 1O0QA 1GXDA 5CUHA 4A3WA 1Q3AA 3EWJA 1JAPA 4ZR5A 3RTTA 2JIHA 2OW2A 1R1IA 4PKSA 4GR3A 5BOTA 2FV9A 5CVWA 3EDZA 1BQOA 1OS9A 2MZEA 3LILA 1CGEA 3DNGA 1UTZA 4DV8A 2E2DA 2OXWA 1JAQA 3GBOA 4XBHA 1JJ9A 1CIZA 1OM6A 3P1VA 1JIZA 3HDAP 2JT5A 3LIRA 2X3CA 1UEAA 2YIGA 1XAXA 1KUFA 3WV1A 3TS4A 2W12A 2SRTA 4IJOA 5I3MA 1K7GA 1C3IA 1KBCA 1SLMA 2Z2DA 3I7IA 3UVCA 2ZVDA 4HX3A 3LMCA 1ZS0A 3LJZA 4DT5A 5L79A 3KRYA 5D1UA 5L7FA 1HY7A 3TT4A 1HTDA 3DPFA 1G49A 1YP1A 1KUIA 1R55A 2USNA 5I43A 2OW1A 3LKAA 1R1JA 2I47A 4H82A 1IADA 1FBLA 1BKCA 3KHIA 1OS2A 3BA0A 1PWQA 2QUAA 1PWPA 4DD8A 3HDBA 2W0DA 2JSDA 3K7NA 2YO0A 1FLSA 1YCMA 1C8TA 4AYKA 2K2GA 5I2ZA 2JNPA 1GKDA 5LABA 4EFSA 3LEAA 3MA2A 2RJQA 3ZXHA 4JIJA 1S4BP 5JMYA 2W15A 3HB2P 1Y0VA 2YO1A 1TVIA 3F17A 3LA9A 3U1RA 1QJJA 2ZJ6A 4FVLA 1BIWA 1XFVA 2OW9A 2J0TA 3AYUA 1SRPA 1BZSA 1XFZA 2FV5A 5D7WA 2AYKA 4L6TA 3LAAA 2MLRA 3S6LA 1CXVA 2L0RA 2D1NA 4JA1A 2TCLA 5CXLA 2DDYA 4L63A 2W13A 1G9KA 3K7LA 3LJTA 1AKLA 4G0DA 2POJA 1IAEA 5D3CA 1SLNA 2OVXA 2WO9A 3LK8A 2WOAA 1A85A 2OXZA 4WK7A 1OMJA 2RJPA 1XM5A 1KUGA 3I7GA 1YOUA 1A86A 3F16A 1SMPA 4AUOA 2EROA 1USNA 2OY2A 3E8RA 5D1SA 1XFXA 5I0LA 4A7BA 3ZVSA 4Q1LA 4GUYA 1I1IP 1QJIA 1GKCA 3LJGA 4J4MA 1CGLA 1UMSA 1JANA 4JP4A 1BUVM 1KUHA 1XFWA 1B3DA 1JH1A 3RTSA 2XS3A 1DTHA 2AIGP 1Z3JA 2DW2A 2X3BA 1CAQA 4G9LA 1PWWA 1ND1A 3G42A 1FM1A 2OZRA 1XFUA 4DF9A 1ZP5A 4FXQA 1Y8JA 4IUWA 5H8XA 3TVCA 3EHXA 2JT6A 1UMTA 2ML2A 1BKCE 2X3AA 3CKIA 3EDGA 1JIWP 2K9CA 1D5JA 4H49A 4GWMA 1QIAA 4FXYP 4XCTA 2DW1A 3AYKA 1XURA 4PKTA 4GF1A 5B5OA 3EDIA 1BQQM 830CA 1P9HA 1QICA 2OW0A 1B8YA 1RMZA 4DPEA 2ZJ7A 1YQYA 2D1OA 3VTGA 3A70A 4ON1A 2WO8A 5B5PA 1K7IA 2MLSA 4H84A 3DL1A 3F1AA 3DPEA 1H71P 2DW0A 3DWBA 2Y6CA 3HY7A 3DTEA 5BOYA 1SU3A 1WNIA 3SHIA 1ZVXA 1R1HA 1ZXCA 3WV3A 2OVZA 2XQHA 3A6ZA 3KEKA 4JPAA 3EHYA 3OHLA 3LQBA 2DDFA 1XUDA 2A8HA 3KMEA 2ERPA 4I35A 2KRJA 4PKWA 3HBUP 2W14A 1EB6A 1PWUA 4H1QA 1BSWA 1CQRA 1JAOA 1HV5A 1L6JA 1XUCA 3OHOA 4H30A 1J7NA 1OM7A 4PKRA 4PKQA 4IN9A 4AIGA 4GQLA 3DTIA 3LQ0A 1GO8P 1IAGA 2X7MA 3DTKA 1OO9A 2OI0A 3NX7A 4H76A 3EDHA 4QKZA 2XS4A 4GWNA 2Y6DA 1R54A 3HY9A 1G05A 4L19A 3LE9A 3N2VA 3WV2A 3B8ZA 1D8MA 4AXQA 2N8RA 1EAKA 5BPAA 1KUKA 3DSLA 3LIKA 4GR0A 4WF6A 1JK3A 3B92A 3L0TA 2E3XA 4H3XA 3NTNA 3Q2GA 5D1TA 2CLTA 3G5CA 1G12A 4FU4A 1G4KA 1IAAA 3AIGA 2V4BA 2OXUA 1I76A 3O64A 1D8FA 4GR8A 3VI1A 2AGMA 3ULTA 1RM8A 1BKCI 1GE7A 1GE6A 1ZXVA 1O0TA 1C7KA 3HBVP 1HFSA 3F19A 1MMRA 1MMQA 2QUBA 2YB9A 3L0VA 1AF0A 1UTTA 1MMPA 4XM8A 5I4OA 456CA 3P24A 3LGPA 1OM8A 2OY4A 2J83A 5I12A 4HMAA 3HYGA 1MNCA 4XM7A 1ATLA 1ROSA 1AYKA 2HU6A 1IACA 2MZIA 3B2ZA 1KAPP 2Z8XA 4ILWD 4L7AA 1GE5A 2Z8ZA 2QPJA 1CK7A 3WP8A 4PKVA 3N2UA 3ELMA 2CKIA 3KMCA 4JQGA 1XFYA 4WZVA 1QIBA 2O3EA 3ZUKA 1MMBA 1D7XA 1BUDA 3O2XA 4XM6A 2PJTA 2ERQA 3Q2HA 3KWVC 1OZ9A 3F15A 3KEJA 1K7QA 3TSKA 4R3VA
chains in the Genus database with same CATH topology
3USNA 4I03A 2MZHA 1ASTA 966CA 1QUAA 2O36A 1Y93A 4WKEA 1PWVA 1I73A 3LUMA 3F18A 3KECA 5CXAA 5CZMA 1HFCA 1DMTA 3LUNA 1SATA 1BM6A 1HOVA 1IABA 5D2BA 1CGFA 4PKUA 1JKYA 3V96B 1EUBA 1ZTQA 4H2EA 2YUFA 4CTHA 1GO7P 4WKIA 1O0QA 1GXDA 5CUHA 4A3WA 1Q3AA 3EWJA 1JAPA 4ZR5A 3RTTA 2JIHA 2OW2A 1R1IA 4PKSA 4GR3A 5BOTA 2FV9A 5CVWA 3EDZA 1BQOA 1OS9A 2MZEA 3LILA 1CGEA 3DNGA 1UTZA 4DV8A 2E2DA 2OXWA 1JAQA 3GBOA 4XBHA 1JJ9A 1CIZA 1OM6A 3P1VA 1JIZA 3HDAP 2JT5A 3LIRA 2X3CA 1UEAA 2YIGA 1KUFA 3WV1A 3TS4A 2W12A 2SRTA 4IJOA 5I3MA 1K7GA 1C3IA 1KBCA 1SLMA 2Z2DA 3I7IA 3UVCA 2ZVDA 4HX3A 3LMCA 1ZS0A 3LJZA 5L79A 3KRYA 5D1UA 5L7FA 1HY7A 3TT4A 1HTDA 3DPFA 1G49A 1YP1A 1KUIA 1R55A 2USNA 5I43A 2OW1A 3LKAA 1R1JA 2I47A 4H82A 1IADA 1FBLA 1BKCA 3KHIA 1OS2A 3BA0A 1PWQA 2QUAA 1PWPA 4DD8A 3HDBA 2W0DA 2JSDA 3K7NA 2YO0A 1FLSA 1YCMA 1C8TA 4AYKA 2K2GA 5I2ZA 2JNPA 1GKDA 5LABA 4EFSA 3LEAA 3MA2A 2RJQA 3ZXHA 4JIJA 1S4BP 5JMYA 2W15A 3HB2P 1Y0VA 2YO1A 3F17A 3LA9A 3U1RA 1QJJA 2ZJ6A 4FVLA 1BIWA 1XFVA 2OW9A 2J0TA 3AYUA 1SRPA 1BZSA 1XFZA 2FV5A 5D7WA 2AYKA 4L6TA 3LAAA 2MLRA 3S6LA 1CXVA 2L0RA 2D1NA 4JA1A 2TCLA 5CXLA 2DDYA 4L63A 2W13A 1G9KA 3K7LA 3LJTA 1AKLA 4G0DA 2POJA 1IAEA 5D3CA 1SLNA 2OVXA 2WO9A 3LK8A 2WOAA 1A85A 2OXZA 4WK7A 1OMJA 2RJPA 1KUGA 3I7GA 1YOUA 1A86A 3F16A 1SMPA 4AUOA 2EROA 1USNA 2OY2A 3E8RA 5D1SA 1XFXA 5I0LA 4A7BA 3ZVSA 4Q1LA 4GUYA 1I1IP 1QJIA 1GKCA 3LJGA 4J4MA 1CGLA 1UMSA 1JANA 4JP4A 1BUVM 1KUHA 1XFWA 1B3DA 1JH1A 3RTSA 2XS3A 1DTHA 2AIGP 1Z3JA 2DW2A 2X3BA 1CAQA 4G9LA 1PWWA 1ND1A 3G42A 1FM1A 2OZRA 1XFUA 4DF9A 1ZP5A 4FXQA 1Y8JA 4IUWA 5H8XA 3TVCA 3EHXA 2JT6A 1UMTA 2ML2A 1BKCE 2X3AA 3CKIA 3EDGA 1JIWP 2K9CA 1D5JA 4H49A 4GWMA 1QIAA 4FXYP 4XCTA 2DW1A 3AYKA 1XURA 4PKTA 4GF1A 5B5OA 3EDIA 1BQQM 830CA 1P9HA 1QICA 2OW0A 1B8YA 1RMZA 4DPEA 2ZJ7A 1YQYA 2D1OA 3VTGA 3A70A 4ON1A 2WO8A 5B5PA 1K7IA 2MLSA 4H84A 3DL1A 3F1AA 3DPEA 1H71P 2DW0A 3DWBA 2Y6CA 3HY7A 3DTEA 5BOYA 1SU3A 1WNIA 3SHIA 1ZVXA 1R1HA 1ZXCA 3WV3A 2OVZA 2XQHA 3A6ZA 3KEKA 4JPAA 3EHYA 3OHLA 3LQBA 2DDFA 1XUDA 2A8HA 3KMEA 2ERPA 4I35A 2KRJA 4PKWA 3HBUP 2W14A 1EB6A 1PWUA 4H1QA 1BSWA 1CQRA 1JAOA 1HV5A 1L6JA 1XUCA 3OHOA 4H30A 1J7NA 1OM7A 4PKRA 4PKQA 4IN9A 4AIGA 4GQLA 3DTIA 3LQ0A 1GO8P 1IAGA 2X7MA 3DTKA 1OO9A 2OI0A 3NX7A 4H76A 3EDHA 4QKZA 2XS4A 4GWNA 2Y6DA 1R54A 3HY9A 1G05A 4L19A 3LE9A 3N2VA 3WV2A 3B8ZA 1D8MA 4AXQA 2N8RA 1EAKA 5BPAA 1KUKA 3DSLA 3LIKA 4GR0A 4WF6A 1JK3A 3B92A 3L0TA 2E3XA 4H3XA 3NTNA 3Q2GA 5D1TA 2CLTA 3G5CA 1G12A 4FU4A 1G4KA 1IAAA 3AIGA 2V4BA 2OXUA 1I76A 3O64A 1D8FA 4GR8A 3VI1A 2AGMA 3ULTA 1RM8A 1BKCI 1GE7A 1GE6A 1ZXVA 1O0TA 1C7KA 3HBVP 1HFSA 3F19A 1MMRA 1MMQA 2QUBA 2YB9A 3L0VA 1AF0A 1UTTA 1MMPA 4XM8A 5I4OA 456CA 3P24A 3LGPA 1OM8A 2OY4A 2J83A 5I12A 4HMAA 3HYGA 1MNCA 4XM7A 1ATLA 1ROSA 1AYKA 2HU6A 1IACA 2MZIA 3B2ZA 1KAPP 2Z8XA 4ILWD 4L7AA 1GE5A 2Z8ZA 2QPJA 1CK7A 3WP8A 4PKVA 3N2UA 3ELMA 2CKIA 3KMCA 4JQGA 1XFYA 4WZVA 1QIBA 2O3EA 3ZUKA 1MMBA 1D7XA 1BUDA 3O2XA 4XM6A 2PJTA 2ERQA 3Q2HA 3KWVC 3F15A 3KEJA 1K7QA 3TSKA 4R3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3USN A;  4I03 A;  2MZH A;  1AST A;  966C A;  1QUA A;  2O36 A;  1Y93 A;  4WKE A;  1PWV A;  1I73 A;  3LUM A;  3F18 A;  3KEC A;  5CXA A;  5CZM A;  1HFC A;  1DMT A;  3LUN A;  1SAT A;  1BM6 A;  1HOV A;  1IAB A;  5D2B A;  1CGF A;  4PKU A;  1JKY A;  3V96 B;  1EUB A;  1ZTQ A;  4H2E A;  4CTH A;  1GO7 P;  4WKI A;  1O0Q A;  1GXD A;  5CUH A;  4A3W A;  1Q3A A;  3EWJ A;  1JAP A;  4ZR5 A;  3RTT A;  2JIH A;  2OW2 A;  1R1I A;  4PKS A;  4GR3 A;  5BOT A;  2FV9 A;  5CVW A;  3EDZ A;  1BQO A;  1OS9 A;  2MZE A;  3LIL A;  1CGE A;  3DNG A;  1UTZ A;  4DV8 A;  2E2D A;  2OXW A;  1JAQ A;  3GBO A;  4XBH A;  1JJ9 A;  1CIZ A;  1OM6 A;  3P1V A;  1JIZ A;  3HDA P;  2JT5 A;  3LIR A;  2X3C A;  1UEA A;  2YIG A;  1KUF A;  3WV1 A;  3TS4 A;  2W12 A;  2SRT A;  4IJO A;  5I3M A;  1K7G A;  1C3I A;  1KBC A;  1SLM A;  2Z2D A;  3I7I A;  3UVC A;  2ZVD A;  4HX3 A;  3LMC A;  1ZS0 A;  3LJZ A;  5L79 A;  3KRY A;  5D1U A;  5L7F A;  1HY7 A;  3TT4 A;  1HTD A;  3DPF A;  1G49 A;  1YP1 A;  1KUI A;  1R55 A;  2USN A;  5I43 A;  2OW1 A;  3LKA A;  1R1J A;  2I47 A;  4H82 A;  1IAD A;  1FBL A;  1BKC A;  3KHI A;  1OS2 A;  3BA0 A;  1PWQ A;  2QUA A;  1PWP A;  4DD8 A;  3HDB A;  2W0D A;  2JSD A;  3K7N A;  2YO0 A;  1FLS A;  1YCM A;  1C8T A;  4AYK A;  2K2G A;  5I2Z A;  2JNP A;  1GKD A;  5LAB A;  4EFS A;  3LEA A;  3MA2 A;  2RJQ A;  3ZXH A;  4JIJ A;  1S4B P;  5JMY A;  2W15 A;  3HB2 P;  1Y0V A;  2YO1 A;  3F17 A;  3LA9 A;  3U1R A;  1QJJ A;  2ZJ6 A;  4FVL A;  1BIW A;  1XFV A;  2OW9 A;  2J0T A;  3AYU A;  1SRP A;  1BZS A;  1XFZ A;  2FV5 A;  5D7W A;  2AYK A;  4L6T A;  3LAA A;  2MLR A;  3S6L A;  1CXV A;  2L0R A;  2D1N A;  4JA1 A;  2TCL A;  5CXL A;  2DDY A;  4L63 A;  2W13 A;  1G9K A;  3K7L A;  3LJT A;  1AKL A;  4G0D A;  2POJ A;  1IAE A;  5D3C A;  1SLN A;  2OVX A;  2WO9 A;  3LK8 A;  2WOA A;  1A85 A;  2OXZ A;  4WK7 A;  1OMJ A;  2RJP A;  1KUG A;  3I7G A;  1YOU A;  1A86 A;  3F16 A;  1SMP A;  4AUO A;  2ERO A;  1USN A;  2OY2 A;  3E8R A;  5D1S A;  1XFX A;  5I0L A;  4A7B A;  3ZVS A;  4Q1L A;  4GUY A;  1I1I P;  1QJI A;  1GKC A;  3LJG A;  4J4M A;  1CGL A;  1UMS A;  1JAN A;  4JP4 A;  1BUV M;  1KUH A;  1XFW A;  1B3D A;  1JH1 A;  3RTS A;  2XS3 A;  1DTH A;  2AIG P;  1Z3J A;  2DW2 A;  2X3B A;  1CAQ A;  4G9L A;  1PWW A;  1ND1 A;  3G42 A;  1FM1 A;  2OZR A;  1XFU A;  4DF9 A;  1ZP5 A;  4FXQ A;  1Y8J A;  4IUW A;  5H8X A;  3TVC A;  3EHX A;  2JT6 A;  1UMT A;  2ML2 A;  1BKC E;  2X3A A;  3CKI A;  3EDG A;  1JIW P;  2K9C A;  1D5J A;  4H49 A;  4GWM A;  1QIA A;  4FXY P;  4XCT A;  2DW1 A;  3AYK A;  1XUR A;  4PKT A;  4GF1 A;  5B5O A;  3EDI A;  1BQQ M;  830C A;  1P9H A;  1QIC A;  2OW0 A;  1B8Y A;  1RMZ A;  4DPE A;  2ZJ7 A;  1YQY A;  2D1O A;  3VTG A;  3A70 A;  4ON1 A;  2WO8 A;  5B5P A;  1K7I A;  2MLS A;  4H84 A;  3DL1 A;  3F1A A;  3DPE A;  1H71 P;  2DW0 A;  3DWB A;  2Y6C A;  3HY7 A;  5BOY A;  1SU3 A;  1WNI A;  3SHI A;  1ZVX A;  1R1H A;  1ZXC A;  3WV3 A;  2OVZ A;  2XQH A;  3A6Z A;  3KEK A;  4JPA A;  3EHY A;  3OHL A;  3LQB A;  2DDF A;  1XUD A;  2A8H A;  3KME A;  2ERP A;  4I35 A;  2KRJ A;  4PKW A;  3HBU P;  2W14 A;  1EB6 A;  1PWU A;  4H1Q A;  1BSW A;  1CQR A;  1JAO A;  1HV5 A;  1L6J A;  1XUC A;  3OHO A;  4H30 A;  1J7N A;  1OM7 A;  4PKR A;  4PKQ A;  4IN9 A;  4AIG A;  4GQL A;  3LQ0 A;  1GO8 P;  1IAG A;  2X7M A;  1OO9 A;  2OI0 A;  3NX7 A;  4H76 A;  3EDH A;  4QKZ A;  2XS4 A;  4GWN A;  2Y6D A;  1R54 A;  3HY9 A;  1G05 A;  4L19 A;  3LE9 A;  3N2V A;  3WV2 A;  3B8Z A;  1D8M A;  4AXQ A;  2N8R A;  1EAK A;  5BPA A;  1KUK A;  3DSL A;  3LIK A;  4GR0 A;  4WF6 A;  1JK3 A;  3B92 A;  3L0T A;  2E3X A;  4H3X A;  3NTN A;  3Q2G A;  5D1T A;  2CLT A;  3G5C A;  1G12 A;  4FU4 A;  1G4K A;  1IAA A;  3AIG A;  2V4B A;  2OXU A;  1I76 A;  3O64 A;  1D8F A;  4GR8 A;  3VI1 A;  2AGM A;  3ULT A;  1RM8 A;  1BKC I;  1GE7 A;  1GE6 A;  1ZXV A;  1O0T A;  1C7K A;  3HBV P;  1HFS A;  3F19 A;  1MMR A;  1MMQ A;  2QUB A;  2YB9 A;  3L0V A;  1AF0 A;  1UTT A;  1MMP A;  4XM8 A;  5I4O A;  456C A;  3P24 A;  3LGP A;  1OM8 A;  2OY4 A;  2J83 A;  5I12 A;  4HMA A;  3HYG A;  1MNC A;  4XM7 A;  1ATL A;  1ROS A;  1AYK A;  2HU6 A;  1IAC A;  2MZI A;  3B2Z A;  1KAP P;  2Z8X A;  4ILW D;  1GE5 A;  2Z8Z A;  2QPJ A;  1CK7 A;  3WP8 A;  4PKV A;  3N2U A;  3ELM A;  2CKI A;  3KMC A;  4JQG A;  1XFY A;  4WZV A;  1QIB A;  2O3E A;  3ZUK A;  1MMB A;  1D7X A;  1BUD A;  3O2X A;  4XM6 A;  2PJT A;  2ERQ A;  3Q2H A;  3KWV C;  3F15 A;  3KEJ A;  1K7Q A;  3TSK A;  4R3V A; 
#chains in the Genus database with same CATH topology
 3USN A;  4I03 A;  2MZH A;  1AST A;  966C A;  1QUA A;  2O36 A;  1Y93 A;  4WKE A;  1PWV A;  1I73 A;  3LUM A;  3F18 A;  3KEC A;  5CXA A;  5CZM A;  1HFC A;  1DMT A;  3LUN A;  1SAT A;  1BM6 A;  1HOV A;  1IAB A;  5D2B A;  1CGF A;  4PKU A;  1JKY A;  3V96 B;  1EUB A;  1ZTQ A;  4H2E A;  2YUF A;  4CTH A;  1GO7 P;  4WKI A;  1O0Q A;  1GXD A;  5CUH A;  4A3W A;  1Q3A A;  3EWJ A;  1JAP A;  4ZR5 A;  3RTT A;  2JIH A;  2OW2 A;  1R1I A;  4PKS A;  4GR3 A;  5BOT A;  2FV9 A;  5CVW A;  3EDZ A;  1BQO A;  1OS9 A;  2MZE A;  3LIL A;  1CGE A;  3DNG A;  1UTZ A;  4DV8 A;  2E2D A;  2OXW A;  1JAQ A;  3GBO A;  4XBH A;  1JJ9 A;  1CIZ A;  1OM6 A;  3P1V A;  1JIZ A;  3HDA P;  2JT5 A;  3LIR A;  2X3C A;  1UEA A;  2YIG A;  1XAX A;  1KUF A;  3WV1 A;  3TS4 A;  2W12 A;  2SRT A;  4IJO A;  5I3M A;  1K7G A;  1C3I A;  1KBC A;  1SLM A;  2Z2D A;  3I7I A;  3UVC A;  2ZVD A;  4HX3 A;  3LMC A;  1ZS0 A;  3LJZ A;  4DT5 A;  5L79 A;  3KRY A;  5D1U A;  5L7F A;  1HY7 A;  3TT4 A;  1HTD A;  3DPF A;  1G49 A;  1YP1 A;  1KUI A;  1R55 A;  2USN A;  5I43 A;  2OW1 A;  3LKA A;  1R1J A;  2I47 A;  4H82 A;  1IAD A;  1FBL A;  1BKC A;  3KHI A;  1OS2 A;  3BA0 A;  1PWQ A;  2QUA A;  1PWP A;  4DD8 A;  3HDB A;  2W0D A;  2JSD A;  3K7N A;  2YO0 A;  1FLS A;  1YCM A;  1C8T A;  4AYK A;  2K2G A;  5I2Z A;  2JNP A;  1GKD A;  5LAB A;  4EFS A;  3LEA A;  3MA2 A;  2RJQ A;  3ZXH A;  4JIJ A;  1S4B P;  5JMY A;  2W15 A;  3HB2 P;  1Y0V A;  2YO1 A;  1TVI A;  3F17 A;  3LA9 A;  3U1R A;  1QJJ A;  2ZJ6 A;  4FVL A;  1BIW A;  1XFV A;  2OW9 A;  2J0T A;  3AYU A;  1SRP A;  1BZS A;  1XFZ A;  2FV5 A;  5D7W A;  2AYK A;  4L6T A;  3LAA A;  2MLR A;  3S6L A;  1CXV A;  2L0R A;  2D1N A;  4JA1 A;  2TCL A;  5CXL A;  2DDY A;  4L63 A;  2W13 A;  1G9K A;  3K7L A;  3LJT A;  1AKL A;  4G0D A;  2POJ A;  1IAE A;  5D3C A;  1SLN A;  2OVX A;  2WO9 A;  3LK8 A;  2WOA A;  1A85 A;  2OXZ A;  4WK7 A;  1OMJ A;  2RJP A;  1XM5 A;  1KUG A;  3I7G A;  1YOU A;  1A86 A;  3F16 A;  1SMP A;  4AUO A;  2ERO A;  1USN A;  2OY2 A;  3E8R A;  5D1S A;  1XFX A;  5I0L A;  4A7B A;  3ZVS A;  4Q1L A;  4GUY A;  1I1I P;  1QJI A;  1GKC A;  3LJG A;  4J4M A;  1CGL A;  1UMS A;  1JAN A;  4JP4 A;  1BUV M;  1KUH A;  1XFW A;  1B3D A;  1JH1 A;  3RTS A;  2XS3 A;  1DTH A;  2AIG P;  1Z3J A;  2DW2 A;  2X3B A;  1CAQ A;  4G9L A;  1PWW A;  1ND1 A;  3G42 A;  1FM1 A;  2OZR A;  1XFU A;  4DF9 A;  1ZP5 A;  4FXQ A;  1Y8J A;  4IUW A;  5H8X A;  3TVC A;  3EHX A;  2JT6 A;  1UMT A;  2ML2 A;  1BKC E;  2X3A A;  3CKI A;  3EDG A;  1JIW P;  2K9C A;  1D5J A;  4H49 A;  4GWM A;  1QIA A;  4FXY P;  4XCT A;  2DW1 A;  3AYK A;  1XUR A;  4PKT A;  4GF1 A;  5B5O A;  3EDI A;  1BQQ M;  830C A;  1P9H A;  1QIC A;  2OW0 A;  1B8Y A;  1RMZ A;  4DPE A;  2ZJ7 A;  1YQY A;  2D1O A;  3VTG A;  3A70 A;  4ON1 A;  2WO8 A;  5B5P A;  1K7I A;  2MLS A;  4H84 A;  3DL1 A;  3F1A A;  3DPE A;  1H71 P;  2DW0 A;  3DWB A;  2Y6C A;  3HY7 A;  3DTE A;  5BOY A;  1SU3 A;  1WNI A;  3SHI A;  1ZVX A;  1R1H A;  1ZXC A;  3WV3 A;  2OVZ A;  2XQH A;  3A6Z A;  3KEK A;  4JPA A;  3EHY A;  3OHL A;  3LQB A;  2DDF A;  1XUD A;  2A8H A;  3KME A;  2ERP A;  4I35 A;  2KRJ A;  4PKW A;  3HBU P;  2W14 A;  1EB6 A;  1PWU A;  4H1Q A;  1BSW A;  1CQR A;  1JAO A;  1HV5 A;  1L6J A;  1XUC A;  3OHO A;  4H30 A;  1J7N A;  1OM7 A;  4PKR A;  4PKQ A;  4IN9 A;  4AIG A;  4GQL A;  3DTI A;  3LQ0 A;  1GO8 P;  1IAG A;  2X7M A;  3DTK A;  1OO9 A;  2OI0 A;  3NX7 A;  4H76 A;  3EDH A;  4QKZ A;  2XS4 A;  4GWN A;  2Y6D A;  1R54 A;  3HY9 A;  1G05 A;  4L19 A;  3LE9 A;  3N2V A;  3WV2 A;  3B8Z A;  1D8M A;  4AXQ A;  2N8R A;  1EAK A;  5BPA A;  1KUK A;  3DSL A;  3LIK A;  4GR0 A;  4WF6 A;  1JK3 A;  3B92 A;  3L0T A;  2E3X A;  4H3X A;  3NTN A;  3Q2G A;  5D1T A;  2CLT A;  3G5C A;  1G12 A;  4FU4 A;  1G4K A;  1IAA A;  3AIG A;  2V4B A;  2OXU A;  1I76 A;  3O64 A;  1D8F A;  4GR8 A;  3VI1 A;  2AGM A;  3ULT A;  1RM8 A;  1BKC I;  1GE7 A;  1GE6 A;  1ZXV A;  1O0T A;  1C7K A;  3HBV P;  1HFS A;  3F19 A;  1MMR A;  1MMQ A;  2QUB A;  2YB9 A;  3L0V A;  1AF0 A;  1UTT A;  1MMP A;  4XM8 A;  5I4O A;  456C A;  3P24 A;  3LGP A;  1OM8 A;  2OY4 A;  2J83 A;  5I12 A;  4HMA A;  3HYG A;  1MNC A;  4XM7 A;  1ATL A;  1ROS A;  1AYK A;  2HU6 A;  1IAC A;  2MZI A;  3B2Z A;  1KAP P;  2Z8X A;  4ILW D;  4L7A A;  1GE5 A;  2Z8Z A;  2QPJ A;  1CK7 A;  3WP8 A;  4PKV A;  3N2U A;  3ELM A;  2CKI A;  3KMC A;  4JQG A;  1XFY A;  4WZV A;  1QIB A;  2O3E A;  3ZUK A;  1MMB A;  1D7X A;  1BUD A;  3O2X A;  4XM6 A;  2PJT A;  2ERQ A;  3Q2H A;  3KWV C;  1OZ9 A;  3F15 A;  3KEJ A;  1K7Q A;  3TSK A;  4R3V A; 
#chains in the Genus database with same CATH homology
 3USN A;  4I03 A;  2MZH A;  1AST A;  966C A;  1QUA A;  2O36 A;  1Y93 A;  4WKE A;  1PWV A;  1I73 A;  3LUM A;  3F18 A;  3KEC A;  5CXA A;  5CZM A;  1HFC A;  1DMT A;  3LUN A;  1SAT A;  1BM6 A;  1HOV A;  1IAB A;  5D2B A;  1CGF A;  4PKU A;  1JKY A;  3V96 B;  1EUB A;  1ZTQ A;  4H2E A;  2YUF A;  4CTH A;  1GO7 P;  4WKI A;  1O0Q A;  1GXD A;  5CUH A;  4A3W A;  1Q3A A;  3EWJ A;  1JAP A;  4ZR5 A;  3RTT A;  2JIH A;  2OW2 A;  1R1I A;  4PKS A;  4GR3 A;  5BOT A;  2FV9 A;  5CVW A;  3EDZ A;  1BQO A;  1OS9 A;  2MZE A;  3LIL A;  1CGE A;  3DNG A;  1UTZ A;  4DV8 A;  2E2D A;  2OXW A;  1JAQ A;  3GBO A;  4XBH A;  1JJ9 A;  1CIZ A;  1OM6 A;  3P1V A;  1JIZ A;  3HDA P;  2JT5 A;  3LIR A;  2X3C A;  1UEA A;  2YIG A;  1KUF A;  3WV1 A;  3TS4 A;  2W12 A;  2SRT A;  4IJO A;  5I3M A;  1K7G A;  1C3I A;  1KBC A;  1SLM A;  2Z2D A;  3I7I A;  3UVC A;  2ZVD A;  4HX3 A;  3LMC A;  1ZS0 A;  3LJZ A;  5L79 A;  3KRY A;  5D1U A;  5L7F A;  1HY7 A;  3TT4 A;  1HTD A;  3DPF A;  1G49 A;  1YP1 A;  1KUI A;  1R55 A;  2USN A;  5I43 A;  2OW1 A;  3LKA A;  1R1J A;  2I47 A;  4H82 A;  1IAD A;  1FBL A;  1BKC A;  3KHI A;  1OS2 A;  3BA0 A;  1PWQ A;  2QUA A;  1PWP A;  4DD8 A;  3HDB A;  2W0D A;  2JSD A;  3K7N A;  2YO0 A;  1FLS A;  1YCM A;  1C8T A;  4AYK A;  2K2G A;  5I2Z A;  2JNP A;  1GKD A;  5LAB A;  4EFS A;  3LEA A;  3MA2 A;  2RJQ A;  3ZXH A;  4JIJ A;  1S4B P;  5JMY A;  2W15 A;  3HB2 P;  1Y0V A;  2YO1 A;  3F17 A;  3LA9 A;  3U1R A;  1QJJ A;  2ZJ6 A;  4FVL A;  1BIW A;  1XFV A;  2OW9 A;  2J0T A;  3AYU A;  1SRP A;  1BZS A;  1XFZ A;  2FV5 A;  5D7W A;  2AYK A;  4L6T A;  3LAA A;  2MLR A;  3S6L A;  1CXV A;  2L0R A;  2D1N A;  4JA1 A;  2TCL A;  5CXL A;  2DDY A;  4L63 A;  2W13 A;  1G9K A;  3K7L A;  3LJT A;  1AKL A;  4G0D A;  2POJ A;  1IAE A;  5D3C A;  1SLN A;  2OVX A;  2WO9 A;  3LK8 A;  2WOA A;  1A85 A;  2OXZ A;  4WK7 A;  1OMJ A;  2RJP A;  1KUG A;  3I7G A;  1YOU A;  1A86 A;  3F16 A;  1SMP A;  4AUO A;  2ERO A;  1USN A;  2OY2 A;  3E8R A;  5D1S A;  1XFX A;  5I0L A;  4A7B A;  3ZVS A;  4Q1L A;  4GUY A;  1I1I P;  1QJI A;  1GKC A;  3LJG A;  4J4M A;  1CGL A;  1UMS A;  1JAN A;  4JP4 A;  1BUV M;  1KUH A;  1XFW A;  1B3D A;  1JH1 A;  3RTS A;  2XS3 A;  1DTH A;  2AIG P;  1Z3J A;  2DW2 A;  2X3B A;  1CAQ A;  4G9L A;  1PWW A;  1ND1 A;  3G42 A;  1FM1 A;  2OZR A;  1XFU A;  4DF9 A;  1ZP5 A;  4FXQ A;  1Y8J A;  4IUW A;  5H8X A;  3TVC A;  3EHX A;  2JT6 A;  1UMT A;  2ML2 A;  1BKC E;  2X3A A;  3CKI A;  3EDG A;  1JIW P;  2K9C A;  1D5J A;  4H49 A;  4GWM A;  1QIA A;  4FXY P;  4XCT A;  2DW1 A;  3AYK A;  1XUR A;  4PKT A;  4GF1 A;  5B5O A;  3EDI A;  1BQQ M;  830C A;  1P9H A;  1QIC A;  2OW0 A;  1B8Y A;  1RMZ A;  4DPE A;  2ZJ7 A;  1YQY A;  2D1O A;  3VTG A;  3A70 A;  4ON1 A;  2WO8 A;  5B5P A;  1K7I A;  2MLS A;  4H84 A;  3DL1 A;  3F1A A;  3DPE A;  1H71 P;  2DW0 A;  3DWB A;  2Y6C A;  3HY7 A;  3DTE A;  5BOY A;  1SU3 A;  1WNI A;  3SHI A;  1ZVX A;  1R1H A;  1ZXC A;  3WV3 A;  2OVZ A;  2XQH A;  3A6Z A;  3KEK A;  4JPA A;  3EHY A;  3OHL A;  3LQB A;  2DDF A;  1XUD A;  2A8H A;  3KME A;  2ERP A;  4I35 A;  2KRJ A;  4PKW A;  3HBU P;  2W14 A;  1EB6 A;  1PWU A;  4H1Q A;  1BSW A;  1CQR A;  1JAO A;  1HV5 A;  1L6J A;  1XUC A;  3OHO A;  4H30 A;  1J7N A;  1OM7 A;  4PKR A;  4PKQ A;  4IN9 A;  4AIG A;  4GQL A;  3DTI A;  3LQ0 A;  1GO8 P;  1IAG A;  2X7M A;  3DTK A;  1OO9 A;  2OI0 A;  3NX7 A;  4H76 A;  3EDH A;  4QKZ A;  2XS4 A;  4GWN A;  2Y6D A;  1R54 A;  3HY9 A;  1G05 A;  4L19 A;  3LE9 A;  3N2V A;  3WV2 A;  3B8Z A;  1D8M A;  4AXQ A;  2N8R A;  1EAK A;  5BPA A;  1KUK A;  3DSL A;  3LIK A;  4GR0 A;  4WF6 A;  1JK3 A;  3B92 A;  3L0T A;  2E3X A;  4H3X A;  3NTN A;  3Q2G A;  5D1T A;  2CLT A;  3G5C A;  1G12 A;  4FU4 A;  1G4K A;  1IAA A;  3AIG A;  2V4B A;  2OXU A;  1I76 A;  3O64 A;  1D8F A;  4GR8 A;  3VI1 A;  2AGM A;  3ULT A;  1RM8 A;  1BKC I;  1GE7 A;  1GE6 A;  1ZXV A;  1O0T A;  1C7K A;  3HBV P;  1HFS A;  3F19 A;  1MMR A;  1MMQ A;  2QUB A;  2YB9 A;  3L0V A;  1AF0 A;  1UTT A;  1MMP A;  4XM8 A;  5I4O A;  456C A;  3P24 A;  3LGP A;  1OM8 A;  2OY4 A;  2J83 A;  5I12 A;  4HMA A;  3HYG A;  1MNC A;  4XM7 A;  1ATL A;  1ROS A;  1AYK A;  2HU6 A;  1IAC A;  2MZI A;  3B2Z A;  1KAP P;  2Z8X A;  4ILW D;  4L7A A;  1GE5 A;  2Z8Z A;  2QPJ A;  1CK7 A;  3WP8 A;  4PKV A;  3N2U A;  3ELM A;  2CKI A;  3KMC A;  4JQG A;  1XFY A;  4WZV A;  1QIB A;  2O3E A;  3ZUK A;  1MMB A;  1D7X A;  1BUD A;  3O2X A;  4XM6 A;  2PJT A;  2ERQ A;  3Q2H A;  3KWV C;  3F15 A;  3KEJ A;  1K7Q A;  3TSK A;  4R3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...