1K7GA

Prtc from erwinia chrysanthemi
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
455
structure length
455
Chain Sequence
NSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPGSEEYGRQTFTHEIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSIMSYWGENETGADYNGHYGGAPMIDDIAAIQRLYGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHGVTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLSAFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDIIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Protease C of Erwinia chrysanthemi: The Crystal Structure and Role of Amino Acids Y228 and E189
pubmed doi rcsb
molecule keywords secreted protease C
molecule tags Hydrolase
source organism Erwinia chrysanthemi
total genus 151
structure length 455
sequence length 455
ec nomenclature ec 3.4.24.40: Serralysin.
pdb deposition date 2001-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
A PF00413 Peptidase_M10 Matrixin
A PF08548 Peptidase_M10_C Peptidase M10 serralysin C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 1k7gA01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1k7gA02
1YQYA 3O2XA 1O0QA 2W14A 1A85A 1ASTA 5D2BA 4JPAA 3TS4A 1BKCI 2J83A 4ILWD 1BM6A 1CIZA 4XM6A 1Z3JA 1XURA 4IUWA 1BKCA 5CXLA 3AIGA 2PJTA 1EB6A 1MNCA 1O0TA 3ULTA 1R1JA 3O64A 4GUYA 1MMBA 2YIGA 1FBLA 1CXVA 1G05A 3A70A 4XM8A 3DPEA 5I3MA 1GKDA 2MLRA 1RM8A 4HX3A 4GQLA 4PKWA 2DW0A 4H1QA 4J4MA 1KUKA 2DDYA 3LMCA 2RJPA 4I03A 3HBVP 3DL1A 1KUFA 1SATA 3WV2A 3F19A 1ATLA 3TSKA 3AYUA 3KRYA 2XS3A 2EROA 4FXYP 2X3BA 2OW2A 2I47A 4EFSA 1R1IA 1QJIA 3KWVC 4HMAA 2OI0A 1BSWA 1K7GA 2X3CA 2QPJA 4DV8A 2QUAA 1G9KA 1OM6A 2ERPA 1OS9A 3Q2HA 3S6LA 4FU4A 2ERQA 1UEAA 1R1HA 2DW1A 2Y6DA 4IN9A 4AUOA 3KECA 4CTHA 3VTGA 3BA0A 2MZIA 3MA2A 4XBHA 4JQGA 1DTHA 4GR3A 2V4BA 3P1VA 3TT4A 1B8YA 3LQBA 1QUAA 1JJ9A 3Q2GA 1OM8A 1G49A 1ND1A 3OHLA 3A6ZA 3NX7A 2D1OA 1GO8P 3LAAA 1JKYA 1CAQA 2JNPA 1UTTA 2K9CA 1I73A 1ZVXA 2Y6CA 1PWVA 1AYKA 3LQ0A 3CKIA 2N8RA 1CK7A 3EDHA 1XFXA 4JIJA 2W0DA 1UMTA 3LJTA 3KMCA 4R3VA 4PKTA 4H82A 3U1RA 2OZRA 2XS4A 1XFUA 4JP4A 4PKQA 2X3AA 3P24A 3WV3A 1GKCA 3KEJA 2O3EA 5CXAA 3I7GA 3ZXHA 2OY2A 2AYKA 3F1AA 1BQQM 1K7QA 5BOYA 1OO9A 4G0DA 1JIZA 1HOVA 3LA9A 3SHIA 2OVZA 2OXZA 1WNIA 3N2UA 4PKRA 2WO8A 2KRJA 1CQRA 2ZJ6A 1XFWA 1C8TA 3AYKA 1A86A 5CVWA 4GR8A 1PWQA 1P9HA 5L79A 3EDIA 1BUDA 1BKCE 3N2VA 3LEAA 1GE6A 1PWPA 2YB9A 3LIKA 4DD8A 2OW0A 1HFCA 1C3IA 4H3XA 3HY7A 1ZXCA 4DPEA 1S4BP 3TVCA 4AIGA 5L7FA 1R54A 3ZUKA 5BPAA 3F16A 5LABA 1KUIA 1SLNA 1GXDA 3HB2P 2Z8XA 3L0TA 1YOUA 3OHOA 2FV9A 1I76A 3LK8A 1XFYA 3EHYA 4L19A 1C7KA 2OW1A 3WV1A 1D5JA 3WP8A 5D1TA 4L63A 3EDGA 2OVXA 1UTZA 3GBOA 5I2ZA 2YO0A 4H49A 5I12A 3VI1A 4H84A 2POJA 4A3WA 4GR0A 3LJZA 1XUDA 1BZSA 4WF6A 1UMSA 1SLMA 1XFVA 2WO9A 1JANA 4AYKA 5I0LA 1RMZA 2A8HA 3F18A 1ZS0A 4WKIA 3DNGA 2YO1A 3ELMA 2Z8ZA 1AF0A 1R55A 5CZMA 5BOTA 3HDAP 1CGFA 456CA 1QIBA 1PWUA 1JH1A 2ML2A 3I7IA 3DPFA 1Q3AA 1EAKA 5D7WA 4XCTA 3F17A 1BUVM 4AXQA 1KUGA 4H2EA 3B8ZA 1G12A 1L6JA 1GE5A 5I43A 1USNA 1Y93A 3KMEA 1IAGA 1ZP5A 2W15A 1I1IP 1D8MA 1KAPP 1BIWA 1ZXVA 1AKLA 2JT6A 1MMRA 3HYGA 4QKZA 966CA 4FXQA 3V96B 1MMQA 2OW9A 1OS2A 1FLSA 3E8RA 2W13A 3NTNA 2ZVDA 4G9LA 2JIHA 3B2ZA 3LUMA 1QIAA 2MLSA 1JIWP 5D1UA 4WK7A 830CA 2XQHA 4ON1A 3ZVSA 5H8XA 2E3XA 3HY9A 1D7XA 1H71P 1OMJA 1JK3A 3G5CA 1ROSA 2QUBA 1HTDA 3LE9A 4ZR5A 1G4KA 1BQOA 4GWMA 4PKSA 2MZEA 2USNA 4A7BA 1ZTQA 3LUNA 2OXUA 4GWNA 2X7MA 1PWWA 3HBUP 5D1SA 3EHXA 4WZVA 4H76A 2JT5A 5D3CA 2OY4A 4I35A 2W12A 1FM1A 3LILA 2FV5A 2ZJ7A 2O36A 4GF1A 2HU6A 4DF9A 1CGEA 2CLTA 3F15A 1YP1A 1Y0VA 3RTSA 2L0RA 1KBCA 1IAAA 4FVLA 4WKEA 1KUHA 1QICA 2RJQA 1QJJA 1XFZA 2CKIA 3K7LA 2JSDA 3LGPA 2SRTA 3LIRA 1JAQA 4L6TA 2J0TA 5JMYA 3K7NA 3KHIA 1SMPA 5B5OA 3UVCA 2E2DA 1GO7P 3L0VA 1Y8JA 2AIGP 1J7NA 3DWBA 3B92A 4H30A 1SRPA 4PKUA 1EUBA 4XM7A 1CGLA 4JA1A 1YCMA 3USNA 3DSLA 1JAOA 1K7IA 3EDZA 1HY7A 2Z2DA 5I4OA 1OM7A 1MMPA 2DDFA 2DW2A 2K2GA 1JAPA 1GE7A 4PKVA 2AGMA 3KEKA 5CUHA 1HV5A 5B5PA 1D8FA 3RTTA 3LKAA 2TCLA 3G42A 3LJGA 2OXWA 4IJOA 1XUCA 4Q1LA 1IABA 1IAEA 3HDBA 1SU3A 3EWJA 1IACA 1IADA 1DMTA 2MZHA 2WOAA 2D1NA 1B3DA 1HFSA
chains in the Genus database with same CATH superfamily
1YQYA 3O2XA 1O0QA 2W14A 1A85A 1ASTA 5D2BA 4JPAA 3TS4A 1BKCI 2J83A 4ILWD 1BM6A 1CIZA 4XM6A 1Z3JA 1XURA 4IUWA 1BKCA 5CXLA 3AIGA 2PJTA 1EB6A 1MNCA 1O0TA 3ULTA 1R1JA 3O64A 4GUYA 1MMBA 2YIGA 1FBLA 1CXVA 1G05A 3A70A 4XM8A 3DPEA 5I3MA 1GKDA 2MLRA 1RM8A 4HX3A 4GQLA 1OZ9A 4PKWA 2DW0A 4H1QA 4J4MA 1KUKA 2DDYA 3LMCA 2RJPA 4I03A 3HBVP 3DL1A 1KUFA 1SATA 3WV2A 3F19A 1ATLA 3TSKA 3AYUA 3KRYA 2XS3A 2EROA 4FXYP 2X3BA 2OW2A 2I47A 4EFSA 1R1IA 1QJIA 3KWVC 4HMAA 2OI0A 1BSWA 1K7GA 1XM5A 2X3CA 2QPJA 4DV8A 2QUAA 1G9KA 1OM6A 2ERPA 1OS9A 3Q2HA 3S6LA 4FU4A 2ERQA 1UEAA 1R1HA 2DW1A 2Y6DA 4IN9A 4AUOA 3KECA 4CTHA 3VTGA 3BA0A 2MZIA 3MA2A 4XBHA 4JQGA 1DTHA 4GR3A 2V4BA 3P1VA 3TT4A 1B8YA 3LQBA 1QUAA 1JJ9A 3Q2GA 1OM8A 1G49A 1ND1A 3OHLA 3A6ZA 3NX7A 2D1OA 1GO8P 3LAAA 1JKYA 1CAQA 2JNPA 1UTTA 2K9CA 1I73A 1ZVXA 2YUFA 2Y6CA 1PWVA 1AYKA 3LQ0A 3CKIA 2N8RA 1CK7A 3EDHA 1XFXA 4JIJA 2W0DA 1UMTA 3LJTA 3KMCA 4R3VA 4PKTA 4L7AA 4H82A 3U1RA 2OZRA 2XS4A 1XFUA 4JP4A 4PKQA 2X3AA 3P24A 3WV3A 1GKCA 3KEJA 3DTIA 2O3EA 5CXAA 3I7GA 3ZXHA 3DTEA 2OY2A 2AYKA 3F1AA 1BQQM 1K7QA 5BOYA 1OO9A 4G0DA 1JIZA 1HOVA 3LA9A 3SHIA 2OVZA 2OXZA 1WNIA 3N2UA 4PKRA 2WO8A 2KRJA 1CQRA 2ZJ6A 1XFWA 1C8TA 3AYKA 1A86A 5CVWA 4GR8A 1PWQA 1P9HA 5L79A 3EDIA 1BUDA 1BKCE 3N2VA 3LEAA 1GE6A 1PWPA 2YB9A 3LIKA 4DD8A 2OW0A 1HFCA 1C3IA 4H3XA 3HY7A 1ZXCA 4DPEA 1S4BP 3TVCA 4AIGA 5L7FA 1R54A 3ZUKA 5BPAA 3F16A 5LABA 1KUIA 1SLNA 1GXDA 3HB2P 2Z8XA 3L0TA 1YOUA 3OHOA 2FV9A 1I76A 3LK8A 1XFYA 3EHYA 4L19A 1C7KA 2OW1A 3WV1A 1D5JA 3WP8A 5D1TA 4L63A 3EDGA 2OVXA 1UTZA 3GBOA 5I2ZA 2YO0A 4H49A 5I12A 3VI1A 4H84A 2POJA 4A3WA 4GR0A 3LJZA 1XUDA 1BZSA 4WF6A 1UMSA 1SLMA 1XFVA 2WO9A 1JANA 4AYKA 5I0LA 1RMZA 2A8HA 3F18A 1ZS0A 4WKIA 3DNGA 2YO1A 3ELMA 3DTKA 2Z8ZA 1AF0A 1R55A 5CZMA 5BOTA 3HDAP 1CGFA 456CA 1QIBA 1PWUA 1JH1A 2ML2A 3I7IA 3DPFA 1Q3AA 1EAKA 5D7WA 4XCTA 3F17A 1BUVM 4AXQA 1KUGA 4H2EA 3B8ZA 1G12A 1L6JA 1GE5A 5I43A 1USNA 1Y93A 3KMEA 1IAGA 1ZP5A 2W15A 1I1IP 1D8MA 1KAPP 1BIWA 1ZXVA 1AKLA 2JT6A 1MMRA 3HYGA 4QKZA 966CA 4FXQA 3V96B 1MMQA 2OW9A 1OS2A 1TVIA 1FLSA 3E8RA 2W13A 3NTNA 2ZVDA 4G9LA 2JIHA 3B2ZA 3LUMA 1QIAA 2MLSA 1JIWP 5D1UA 4WK7A 830CA 2XQHA 4ON1A 3ZVSA 5H8XA 2E3XA 3HY9A 1D7XA 1H71P 1OMJA 1JK3A 3G5CA 1ROSA 2QUBA 1HTDA 3LE9A 4ZR5A 1G4KA 1BQOA 4GWMA 4PKSA 2MZEA 2USNA 4A7BA 1ZTQA 3LUNA 2OXUA 4GWNA 2X7MA 1PWWA 3HBUP 5D1SA 3EHXA 4WZVA 4H76A 2JT5A 5D3CA 2OY4A 4I35A 2W12A 1FM1A 3LILA 2FV5A 2ZJ7A 2O36A 4GF1A 2HU6A 4DF9A 1CGEA 2CLTA 3F15A 1YP1A 1Y0VA 3RTSA 2L0RA 1KBCA 1IAAA 4FVLA 4WKEA 1KUHA 1QICA 2RJQA 1QJJA 1XFZA 2CKIA 3K7LA 2JSDA 3LGPA 2SRTA 3LIRA 1JAQA 4L6TA 2J0TA 5JMYA 3K7NA 3KHIA 1SMPA 5B5OA 3UVCA 2E2DA 1GO7P 3L0VA 1Y8JA 2AIGP 1J7NA 3DWBA 3B92A 4H30A 1SRPA 4PKUA 1EUBA 4XM7A 1CGLA 1XAXA 4JA1A 1YCMA 3USNA 3DSLA 1JAOA 1K7IA 3EDZA 1HY7A 2Z2DA 5I4OA 1OM7A 1MMPA 2DDFA 2DW2A 2K2GA 1JAPA 1GE7A 4PKVA 2AGMA 3KEKA 5CUHA 1HV5A 5B5PA 1D8FA 3RTTA 3LKAA 2TCLA 3G42A 3LJGA 2OXWA 4IJOA 1XUCA 4Q1LA 1IABA 1IAEA 3HDBA 1SU3A 3EWJA 1IACA 1IADA 1DMTA 2MZHA 2WOAA 2D1NA 4DT5A 1B3DA 1HFSA
chains in the Genus database with same CATH topology
1YQYA 3O2XA 1O0QA 2W14A 1A85A 1ASTA 5D2BA 4JPAA 3TS4A 1BKCI 2J83A 4ILWD 1BM6A 1CIZA 4XM6A 1Z3JA 1XURA 4IUWA 1BKCA 5CXLA 3AIGA 2PJTA 1EB6A 1MNCA 1O0TA 3ULTA 1R1JA 3O64A 4GUYA 1MMBA 2YIGA 1FBLA 1CXVA 1G05A 3A70A 4XM8A 3DPEA 5I3MA 1GKDA 2MLRA 1RM8A 4HX3A 4GQLA 4PKWA 2DW0A 4H1QA 4J4MA 1KUKA 2DDYA 3LMCA 2RJPA 4I03A 3HBVP 3DL1A 1KUFA 1SATA 3WV2A 3F19A 1ATLA 3TSKA 3AYUA 3KRYA 2XS3A 2EROA 4FXYP 2X3BA 2OW2A 2I47A 4EFSA 1R1IA 1QJIA 3KWVC 4HMAA 2OI0A 1BSWA 1K7GA 2X3CA 2QPJA 4DV8A 2QUAA 1G9KA 1OM6A 2ERPA 1OS9A 3Q2HA 3S6LA 4FU4A 2ERQA 1UEAA 1R1HA 2DW1A 2Y6DA 4IN9A 4AUOA 3KECA 4CTHA 3VTGA 3BA0A 2MZIA 3MA2A 4XBHA 4JQGA 1DTHA 4GR3A 2V4BA 3P1VA 3TT4A 1B8YA 3LQBA 1QUAA 1JJ9A 3Q2GA 1OM8A 1G49A 1ND1A 3OHLA 3A6ZA 3NX7A 2D1OA 1GO8P 3LAAA 1JKYA 1CAQA 2JNPA 1UTTA 2K9CA 1I73A 1ZVXA 2YUFA 2Y6CA 1PWVA 1AYKA 3LQ0A 3CKIA 2N8RA 1CK7A 3EDHA 1XFXA 4JIJA 2W0DA 1UMTA 3LJTA 3KMCA 4R3VA 4PKTA 4L7AA 4H82A 3U1RA 2OZRA 2XS4A 1XFUA 4JP4A 4PKQA 2X3AA 3P24A 3WV3A 1GKCA 3KEJA 3DTIA 2O3EA 5CXAA 3I7GA 3ZXHA 3DTEA 2OY2A 2AYKA 3F1AA 1BQQM 1K7QA 5BOYA 1OO9A 4G0DA 1JIZA 1HOVA 3LA9A 3SHIA 2OVZA 2OXZA 1WNIA 3N2UA 4PKRA 2WO8A 2KRJA 1CQRA 2ZJ6A 1XFWA 1C8TA 3AYKA 1A86A 5CVWA 4GR8A 1PWQA 1P9HA 5L79A 3EDIA 1BUDA 1BKCE 3N2VA 3LEAA 1GE6A 1PWPA 2YB9A 3LIKA 4DD8A 2OW0A 1HFCA 1C3IA 4H3XA 3HY7A 1ZXCA 4DPEA 1S4BP 3TVCA 4AIGA 5L7FA 1R54A 3ZUKA 5BPAA 3F16A 5LABA 1KUIA 1SLNA 1GXDA 3HB2P 2Z8XA 3L0TA 1YOUA 3OHOA 2FV9A 1I76A 3LK8A 1XFYA 3EHYA 4L19A 1C7KA 2OW1A 3WV1A 1D5JA 3WP8A 5D1TA 4L63A 3EDGA 2OVXA 1UTZA 3GBOA 5I2ZA 2YO0A 4H49A 5I12A 3VI1A 4H84A 2POJA 4A3WA 4GR0A 3LJZA 1XUDA 1BZSA 4WF6A 1UMSA 1SLMA 1XFVA 2WO9A 1JANA 4AYKA 5I0LA 1RMZA 2A8HA 3F18A 1ZS0A 4WKIA 3DNGA 2YO1A 3ELMA 3DTKA 2Z8ZA 1AF0A 1R55A 5CZMA 5BOTA 3HDAP 1CGFA 456CA 1QIBA 1PWUA 1JH1A 2ML2A 3I7IA 3DPFA 1Q3AA 1EAKA 5D7WA 4XCTA 3F17A 1BUVM 4AXQA 1KUGA 4H2EA 3B8ZA 1G12A 1L6JA 1GE5A 5I43A 1USNA 1Y93A 3KMEA 1IAGA 1ZP5A 2W15A 1I1IP 1D8MA 1KAPP 1BIWA 1ZXVA 1AKLA 2JT6A 1MMRA 3HYGA 4QKZA 966CA 4FXQA 3V96B 1MMQA 2OW9A 1OS2A 1FLSA 3E8RA 2W13A 3NTNA 2ZVDA 4G9LA 2JIHA 3B2ZA 3LUMA 1QIAA 2MLSA 1JIWP 5D1UA 4WK7A 830CA 2XQHA 4ON1A 3ZVSA 5H8XA 2E3XA 3HY9A 1D7XA 1H71P 1OMJA 1JK3A 3G5CA 1ROSA 2QUBA 1HTDA 3LE9A 4ZR5A 1G4KA 1BQOA 4GWMA 4PKSA 2MZEA 2USNA 4A7BA 1ZTQA 3LUNA 2OXUA 4GWNA 2X7MA 1PWWA 3HBUP 5D1SA 3EHXA 4WZVA 4H76A 2JT5A 5D3CA 2OY4A 4I35A 2W12A 1FM1A 3LILA 2FV5A 2ZJ7A 2O36A 4GF1A 2HU6A 4DF9A 1CGEA 2CLTA 3F15A 1YP1A 1Y0VA 3RTSA 2L0RA 1KBCA 1IAAA 4FVLA 4WKEA 1KUHA 1QICA 2RJQA 1QJJA 1XFZA 2CKIA 3K7LA 2JSDA 3LGPA 2SRTA 3LIRA 1JAQA 4L6TA 2J0TA 5JMYA 3K7NA 3KHIA 1SMPA 5B5OA 3UVCA 2E2DA 1GO7P 3L0VA 1Y8JA 2AIGP 1J7NA 3DWBA 3B92A 4H30A 1SRPA 4PKUA 1EUBA 4XM7A 1CGLA 4JA1A 1YCMA 3USNA 3DSLA 1JAOA 1K7IA 3EDZA 1HY7A 2Z2DA 5I4OA 1OM7A 1MMPA 2DDFA 2DW2A 2K2GA 1JAPA 1GE7A 4PKVA 2AGMA 3KEKA 5CUHA 1HV5A 5B5PA 1D8FA 3RTTA 3LKAA 2TCLA 3G42A 3LJGA 2OXWA 4IJOA 1XUCA 4Q1LA 1IABA 1IAEA 3HDBA 1SU3A 3EWJA 1IACA 1IADA 1DMTA 2MZHA 2WOAA 2D1NA 1B3DA 1HFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQY A;  3O2X A;  1O0Q A;  2W14 A;  1A85 A;  1AST A;  5D2B A;  4JPA A;  3TS4 A;  1BKC I;  2J83 A;  4ILW D;  1BM6 A;  1CIZ A;  4XM6 A;  1Z3J A;  1XUR A;  4IUW A;  1BKC A;  5CXL A;  3AIG A;  2PJT A;  1EB6 A;  1MNC A;  1O0T A;  3ULT A;  1R1J A;  3O64 A;  4GUY A;  1MMB A;  2YIG A;  1FBL A;  1CXV A;  1G05 A;  3A70 A;  4XM8 A;  3DPE A;  5I3M A;  1GKD A;  2MLR A;  1RM8 A;  4HX3 A;  4GQL A;  4PKW A;  2DW0 A;  4H1Q A;  4J4M A;  1KUK A;  2DDY A;  3LMC A;  2RJP A;  4I03 A;  3HBV P;  3DL1 A;  1KUF A;  1SAT A;  3WV2 A;  3F19 A;  1ATL A;  3TSK A;  3AYU A;  3KRY A;  2XS3 A;  2ERO A;  4FXY P;  2X3B A;  2OW2 A;  2I47 A;  4EFS A;  1R1I A;  1QJI A;  3KWV C;  4HMA A;  2OI0 A;  1BSW A;  1K7G A;  2X3C A;  2QPJ A;  4DV8 A;  2QUA A;  1G9K A;  1OM6 A;  2ERP A;  1OS9 A;  3Q2H A;  3S6L A;  4FU4 A;  2ERQ A;  1UEA A;  1R1H A;  2DW1 A;  2Y6D A;  4IN9 A;  4AUO A;  3KEC A;  4CTH A;  3VTG A;  3BA0 A;  2MZI A;  3MA2 A;  4XBH A;  4JQG A;  1DTH A;  4GR3 A;  2V4B A;  3P1V A;  3TT4 A;  1B8Y A;  3LQB A;  1QUA A;  1JJ9 A;  3Q2G A;  1OM8 A;  1G49 A;  1ND1 A;  3OHL A;  3A6Z A;  3NX7 A;  2D1O A;  1GO8 P;  3LAA A;  1JKY A;  1CAQ A;  2JNP A;  1UTT A;  2K9C A;  1I73 A;  1ZVX A;  2Y6C A;  1PWV A;  1AYK A;  3LQ0 A;  3CKI A;  2N8R A;  1CK7 A;  3EDH A;  1XFX A;  4JIJ A;  2W0D A;  1UMT A;  3LJT A;  3KMC A;  4R3V A;  4PKT A;  4H82 A;  3U1R A;  2OZR A;  2XS4 A;  1XFU A;  4JP4 A;  4PKQ A;  2X3A A;  3P24 A;  3WV3 A;  1GKC A;  3KEJ A;  2O3E A;  5CXA A;  3I7G A;  3ZXH A;  2OY2 A;  2AYK A;  3F1A A;  1BQQ M;  1K7Q A;  5BOY A;  1OO9 A;  4G0D A;  1JIZ A;  1HOV A;  3LA9 A;  3SHI A;  2OVZ A;  2OXZ A;  1WNI A;  3N2U A;  4PKR A;  2WO8 A;  2KRJ A;  1CQR A;  2ZJ6 A;  1XFW A;  1C8T A;  3AYK A;  1A86 A;  5CVW A;  4GR8 A;  1PWQ A;  1P9H A;  5L79 A;  3EDI A;  1BUD A;  1BKC E;  3N2V A;  3LEA A;  1GE6 A;  1PWP A;  2YB9 A;  3LIK A;  4DD8 A;  2OW0 A;  1HFC A;  1C3I A;  4H3X A;  3HY7 A;  1ZXC A;  4DPE A;  1S4B P;  3TVC A;  4AIG A;  5L7F A;  1R54 A;  3ZUK A;  5BPA A;  3F16 A;  5LAB A;  1KUI A;  1SLN A;  1GXD A;  3HB2 P;  2Z8X A;  3L0T A;  1YOU A;  3OHO A;  2FV9 A;  1I76 A;  3LK8 A;  1XFY A;  3EHY A;  4L19 A;  1C7K A;  2OW1 A;  3WV1 A;  1D5J A;  3WP8 A;  5D1T A;  4L63 A;  3EDG A;  2OVX A;  1UTZ A;  3GBO A;  5I2Z A;  2YO0 A;  4H49 A;  5I12 A;  3VI1 A;  4H84 A;  2POJ A;  4A3W A;  4GR0 A;  3LJZ A;  1XUD A;  1BZS A;  4WF6 A;  1UMS A;  1SLM A;  1XFV A;  2WO9 A;  1JAN A;  4AYK A;  5I0L A;  1RMZ A;  2A8H A;  3F18 A;  1ZS0 A;  4WKI A;  3DNG A;  2YO1 A;  3ELM A;  2Z8Z A;  1AF0 A;  1R55 A;  5CZM A;  5BOT A;  3HDA P;  1CGF A;  456C A;  1QIB A;  1PWU A;  1JH1 A;  2ML2 A;  3I7I A;  3DPF A;  1Q3A A;  1EAK A;  5D7W A;  4XCT A;  3F17 A;  1BUV M;  4AXQ A;  1KUG A;  4H2E A;  3B8Z A;  1G12 A;  1L6J A;  1GE5 A;  5I43 A;  1USN A;  1Y93 A;  3KME A;  1IAG A;  1ZP5 A;  2W15 A;  1I1I P;  1D8M A;  1KAP P;  1BIW A;  1ZXV A;  1AKL A;  2JT6 A;  1MMR A;  3HYG A;  4QKZ A;  966C A;  4FXQ A;  3V96 B;  1MMQ A;  2OW9 A;  1OS2 A;  1FLS A;  3E8R A;  2W13 A;  3NTN A;  2ZVD A;  4G9L A;  2JIH A;  3B2Z A;  3LUM A;  1QIA A;  2MLS A;  1JIW P;  5D1U A;  4WK7 A;  830C A;  2XQH A;  4ON1 A;  3ZVS A;  5H8X A;  2E3X A;  3HY9 A;  1D7X A;  1H71 P;  1OMJ A;  1JK3 A;  3G5C A;  1ROS A;  2QUB A;  1HTD A;  3LE9 A;  4ZR5 A;  1G4K A;  1BQO A;  4GWM A;  4PKS A;  2MZE A;  2USN A;  4A7B A;  1ZTQ A;  3LUN A;  2OXU A;  4GWN A;  2X7M A;  1PWW A;  3HBU P;  5D1S A;  3EHX A;  4WZV A;  4H76 A;  2JT5 A;  5D3C A;  2OY4 A;  4I35 A;  2W12 A;  1FM1 A;  3LIL A;  2FV5 A;  2ZJ7 A;  2O36 A;  4GF1 A;  2HU6 A;  4DF9 A;  1CGE A;  2CLT A;  3F15 A;  1YP1 A;  1Y0V A;  3RTS A;  2L0R A;  1KBC A;  1IAA A;  4FVL A;  4WKE A;  1KUH A;  1QIC A;  2RJQ A;  1QJJ A;  1XFZ A;  2CKI A;  3K7L A;  2JSD A;  3LGP A;  2SRT A;  3LIR A;  1JAQ A;  4L6T A;  2J0T A;  5JMY A;  3K7N A;  3KHI A;  1SMP A;  5B5O A;  3UVC A;  2E2D A;  1GO7 P;  3L0V A;  1Y8J A;  2AIG P;  1J7N A;  3DWB A;  3B92 A;  4H30 A;  1SRP A;  4PKU A;  1EUB A;  4XM7 A;  1CGL A;  4JA1 A;  1YCM A;  3USN A;  3DSL A;  1JAO A;  1K7I A;  3EDZ A;  1HY7 A;  2Z2D A;  5I4O A;  1OM7 A;  1MMP A;  2DDF A;  2DW2 A;  2K2G A;  1JAP A;  1GE7 A;  4PKV A;  2AGM A;  3KEK A;  5CUH A;  1HV5 A;  5B5P A;  1D8F A;  3RTT A;  3LKA A;  2TCL A;  3G42 A;  3LJG A;  2OXW A;  4IJO A;  1XUC A;  4Q1L A;  1IAB A;  1IAE A;  3HDB A;  1SU3 A;  3EWJ A;  1IAC A;  1IAD A;  1DMT A;  2MZH A;  2WOA A;  2D1N A;  1B3D A;  1HFS A; 
#chains in the Genus database with same CATH topology
 1YQY A;  3O2X A;  1O0Q A;  2W14 A;  1A85 A;  1AST A;  5D2B A;  4JPA A;  3TS4 A;  1BKC I;  2J83 A;  4ILW D;  1BM6 A;  1CIZ A;  4XM6 A;  1Z3J A;  1XUR A;  4IUW A;  1BKC A;  5CXL A;  3AIG A;  2PJT A;  1EB6 A;  1MNC A;  1O0T A;  3ULT A;  1R1J A;  3O64 A;  4GUY A;  1MMB A;  2YIG A;  1FBL A;  1CXV A;  1G05 A;  3A70 A;  4XM8 A;  3DPE A;  5I3M A;  1GKD A;  2MLR A;  1RM8 A;  4HX3 A;  4GQL A;  1OZ9 A;  4PKW A;  2DW0 A;  4H1Q A;  4J4M A;  1KUK A;  2DDY A;  3LMC A;  2RJP A;  4I03 A;  3HBV P;  3DL1 A;  1KUF A;  1SAT A;  3WV2 A;  3F19 A;  1ATL A;  3TSK A;  3AYU A;  3KRY A;  2XS3 A;  2ERO A;  4FXY P;  2X3B A;  2OW2 A;  2I47 A;  4EFS A;  1R1I A;  1QJI A;  3KWV C;  4HMA A;  2OI0 A;  1BSW A;  1K7G A;  1XM5 A;  2X3C A;  2QPJ A;  4DV8 A;  2QUA A;  1G9K A;  1OM6 A;  2ERP A;  1OS9 A;  3Q2H A;  3S6L A;  4FU4 A;  2ERQ A;  1UEA A;  1R1H A;  2DW1 A;  2Y6D A;  4IN9 A;  4AUO A;  3KEC A;  4CTH A;  3VTG A;  3BA0 A;  2MZI A;  3MA2 A;  4XBH A;  4JQG A;  1DTH A;  4GR3 A;  2V4B A;  3P1V A;  3TT4 A;  1B8Y A;  3LQB A;  1QUA A;  1JJ9 A;  3Q2G A;  1OM8 A;  1G49 A;  1ND1 A;  3OHL A;  3A6Z A;  3NX7 A;  2D1O A;  1GO8 P;  3LAA A;  1JKY A;  1CAQ A;  2JNP A;  1UTT A;  2K9C A;  1I73 A;  1ZVX A;  2YUF A;  2Y6C A;  1PWV A;  1AYK A;  3LQ0 A;  3CKI A;  2N8R A;  1CK7 A;  3EDH A;  1XFX A;  4JIJ A;  2W0D A;  1UMT A;  3LJT A;  3KMC A;  4R3V A;  4PKT A;  4L7A A;  4H82 A;  3U1R A;  2OZR A;  2XS4 A;  1XFU A;  4JP4 A;  4PKQ A;  2X3A A;  3P24 A;  3WV3 A;  1GKC A;  3KEJ A;  3DTI A;  2O3E A;  5CXA A;  3I7G A;  3ZXH A;  3DTE A;  2OY2 A;  2AYK A;  3F1A A;  1BQQ M;  1K7Q A;  5BOY A;  1OO9 A;  4G0D A;  1JIZ A;  1HOV A;  3LA9 A;  3SHI A;  2OVZ A;  2OXZ A;  1WNI A;  3N2U A;  4PKR A;  2WO8 A;  2KRJ A;  1CQR A;  2ZJ6 A;  1XFW A;  1C8T A;  3AYK A;  1A86 A;  5CVW A;  4GR8 A;  1PWQ A;  1P9H A;  5L79 A;  3EDI A;  1BUD A;  1BKC E;  3N2V A;  3LEA A;  1GE6 A;  1PWP A;  2YB9 A;  3LIK A;  4DD8 A;  2OW0 A;  1HFC A;  1C3I A;  4H3X A;  3HY7 A;  1ZXC A;  4DPE A;  1S4B P;  3TVC A;  4AIG A;  5L7F A;  1R54 A;  3ZUK A;  5BPA A;  3F16 A;  5LAB A;  1KUI A;  1SLN A;  1GXD A;  3HB2 P;  2Z8X A;  3L0T A;  1YOU A;  3OHO A;  2FV9 A;  1I76 A;  3LK8 A;  1XFY A;  3EHY A;  4L19 A;  1C7K A;  2OW1 A;  3WV1 A;  1D5J A;  3WP8 A;  5D1T A;  4L63 A;  3EDG A;  2OVX A;  1UTZ A;  3GBO A;  5I2Z A;  2YO0 A;  4H49 A;  5I12 A;  3VI1 A;  4H84 A;  2POJ A;  4A3W A;  4GR0 A;  3LJZ A;  1XUD A;  1BZS A;  4WF6 A;  1UMS A;  1SLM A;  1XFV A;  2WO9 A;  1JAN A;  4AYK A;  5I0L A;  1RMZ A;  2A8H A;  3F18 A;  1ZS0 A;  4WKI A;  3DNG A;  2YO1 A;  3ELM A;  3DTK A;  2Z8Z A;  1AF0 A;  1R55 A;  5CZM A;  5BOT A;  3HDA P;  1CGF A;  456C A;  1QIB A;  1PWU A;  1JH1 A;  2ML2 A;  3I7I A;  3DPF A;  1Q3A A;  1EAK A;  5D7W A;  4XCT A;  3F17 A;  1BUV M;  4AXQ A;  1KUG A;  4H2E A;  3B8Z A;  1G12 A;  1L6J A;  1GE5 A;  5I43 A;  1USN A;  1Y93 A;  3KME A;  1IAG A;  1ZP5 A;  2W15 A;  1I1I P;  1D8M A;  1KAP P;  1BIW A;  1ZXV A;  1AKL A;  2JT6 A;  1MMR A;  3HYG A;  4QKZ A;  966C A;  4FXQ A;  3V96 B;  1MMQ A;  2OW9 A;  1OS2 A;  1TVI A;  1FLS A;  3E8R A;  2W13 A;  3NTN A;  2ZVD A;  4G9L A;  2JIH A;  3B2Z A;  3LUM A;  1QIA A;  2MLS A;  1JIW P;  5D1U A;  4WK7 A;  830C A;  2XQH A;  4ON1 A;  3ZVS A;  5H8X A;  2E3X A;  3HY9 A;  1D7X A;  1H71 P;  1OMJ A;  1JK3 A;  3G5C A;  1ROS A;  2QUB A;  1HTD A;  3LE9 A;  4ZR5 A;  1G4K A;  1BQO A;  4GWM A;  4PKS A;  2MZE A;  2USN A;  4A7B A;  1ZTQ A;  3LUN A;  2OXU A;  4GWN A;  2X7M A;  1PWW A;  3HBU P;  5D1S A;  3EHX A;  4WZV A;  4H76 A;  2JT5 A;  5D3C A;  2OY4 A;  4I35 A;  2W12 A;  1FM1 A;  3LIL A;  2FV5 A;  2ZJ7 A;  2O36 A;  4GF1 A;  2HU6 A;  4DF9 A;  1CGE A;  2CLT A;  3F15 A;  1YP1 A;  1Y0V A;  3RTS A;  2L0R A;  1KBC A;  1IAA A;  4FVL A;  4WKE A;  1KUH A;  1QIC A;  2RJQ A;  1QJJ A;  1XFZ A;  2CKI A;  3K7L A;  2JSD A;  3LGP A;  2SRT A;  3LIR A;  1JAQ A;  4L6T A;  2J0T A;  5JMY A;  3K7N A;  3KHI A;  1SMP A;  5B5O A;  3UVC A;  2E2D A;  1GO7 P;  3L0V A;  1Y8J A;  2AIG P;  1J7N A;  3DWB A;  3B92 A;  4H30 A;  1SRP A;  4PKU A;  1EUB A;  4XM7 A;  1CGL A;  1XAX A;  4JA1 A;  1YCM A;  3USN A;  3DSL A;  1JAO A;  1K7I A;  3EDZ A;  1HY7 A;  2Z2D A;  5I4O A;  1OM7 A;  1MMP A;  2DDF A;  2DW2 A;  2K2G A;  1JAP A;  1GE7 A;  4PKV A;  2AGM A;  3KEK A;  5CUH A;  1HV5 A;  5B5P A;  1D8F A;  3RTT A;  3LKA A;  2TCL A;  3G42 A;  3LJG A;  2OXW A;  4IJO A;  1XUC A;  4Q1L A;  1IAB A;  1IAE A;  3HDB A;  1SU3 A;  3EWJ A;  1IAC A;  1IAD A;  1DMT A;  2MZH A;  2WOA A;  2D1N A;  4DT5 A;  1B3D A;  1HFS A; 
#chains in the Genus database with same CATH homology
 1YQY A;  3O2X A;  1O0Q A;  2W14 A;  1A85 A;  1AST A;  5D2B A;  4JPA A;  3TS4 A;  1BKC I;  2J83 A;  4ILW D;  1BM6 A;  1CIZ A;  4XM6 A;  1Z3J A;  1XUR A;  4IUW A;  1BKC A;  5CXL A;  3AIG A;  2PJT A;  1EB6 A;  1MNC A;  1O0T A;  3ULT A;  1R1J A;  3O64 A;  4GUY A;  1MMB A;  2YIG A;  1FBL A;  1CXV A;  1G05 A;  3A70 A;  4XM8 A;  3DPE A;  5I3M A;  1GKD A;  2MLR A;  1RM8 A;  4HX3 A;  4GQL A;  4PKW A;  2DW0 A;  4H1Q A;  4J4M A;  1KUK A;  2DDY A;  3LMC A;  2RJP A;  4I03 A;  3HBV P;  3DL1 A;  1KUF A;  1SAT A;  3WV2 A;  3F19 A;  1ATL A;  3TSK A;  3AYU A;  3KRY A;  2XS3 A;  2ERO A;  4FXY P;  2X3B A;  2OW2 A;  2I47 A;  4EFS A;  1R1I A;  1QJI A;  3KWV C;  4HMA A;  2OI0 A;  1BSW A;  1K7G A;  2X3C A;  2QPJ A;  4DV8 A;  2QUA A;  1G9K A;  1OM6 A;  2ERP A;  1OS9 A;  3Q2H A;  3S6L A;  4FU4 A;  2ERQ A;  1UEA A;  1R1H A;  2DW1 A;  2Y6D A;  4IN9 A;  4AUO A;  3KEC A;  4CTH A;  3VTG A;  3BA0 A;  2MZI A;  3MA2 A;  4XBH A;  4JQG A;  1DTH A;  4GR3 A;  2V4B A;  3P1V A;  3TT4 A;  1B8Y A;  3LQB A;  1QUA A;  1JJ9 A;  3Q2G A;  1OM8 A;  1G49 A;  1ND1 A;  3OHL A;  3A6Z A;  3NX7 A;  2D1O A;  1GO8 P;  3LAA A;  1JKY A;  1CAQ A;  2JNP A;  1UTT A;  2K9C A;  1I73 A;  1ZVX A;  2YUF A;  2Y6C A;  1PWV A;  1AYK A;  3LQ0 A;  3CKI A;  2N8R A;  1CK7 A;  3EDH A;  1XFX A;  4JIJ A;  2W0D A;  1UMT A;  3LJT A;  3KMC A;  4R3V A;  4PKT A;  4L7A A;  4H82 A;  3U1R A;  2OZR A;  2XS4 A;  1XFU A;  4JP4 A;  4PKQ A;  2X3A A;  3P24 A;  3WV3 A;  1GKC A;  3KEJ A;  3DTI A;  2O3E A;  5CXA A;  3I7G A;  3ZXH A;  3DTE A;  2OY2 A;  2AYK A;  3F1A A;  1BQQ M;  1K7Q A;  5BOY A;  1OO9 A;  4G0D A;  1JIZ A;  1HOV A;  3LA9 A;  3SHI A;  2OVZ A;  2OXZ A;  1WNI A;  3N2U A;  4PKR A;  2WO8 A;  2KRJ A;  1CQR A;  2ZJ6 A;  1XFW A;  1C8T A;  3AYK A;  1A86 A;  5CVW A;  4GR8 A;  1PWQ A;  1P9H A;  5L79 A;  3EDI A;  1BUD A;  1BKC E;  3N2V A;  3LEA A;  1GE6 A;  1PWP A;  2YB9 A;  3LIK A;  4DD8 A;  2OW0 A;  1HFC A;  1C3I A;  4H3X A;  3HY7 A;  1ZXC A;  4DPE A;  1S4B P;  3TVC A;  4AIG A;  5L7F A;  1R54 A;  3ZUK A;  5BPA A;  3F16 A;  5LAB A;  1KUI A;  1SLN A;  1GXD A;  3HB2 P;  2Z8X A;  3L0T A;  1YOU A;  3OHO A;  2FV9 A;  1I76 A;  3LK8 A;  1XFY A;  3EHY A;  4L19 A;  1C7K A;  2OW1 A;  3WV1 A;  1D5J A;  3WP8 A;  5D1T A;  4L63 A;  3EDG A;  2OVX A;  1UTZ A;  3GBO A;  5I2Z A;  2YO0 A;  4H49 A;  5I12 A;  3VI1 A;  4H84 A;  2POJ A;  4A3W A;  4GR0 A;  3LJZ A;  1XUD A;  1BZS A;  4WF6 A;  1UMS A;  1SLM A;  1XFV A;  2WO9 A;  1JAN A;  4AYK A;  5I0L A;  1RMZ A;  2A8H A;  3F18 A;  1ZS0 A;  4WKI A;  3DNG A;  2YO1 A;  3ELM A;  3DTK A;  2Z8Z A;  1AF0 A;  1R55 A;  5CZM A;  5BOT A;  3HDA P;  1CGF A;  456C A;  1QIB A;  1PWU A;  1JH1 A;  2ML2 A;  3I7I A;  3DPF A;  1Q3A A;  1EAK A;  5D7W A;  4XCT A;  3F17 A;  1BUV M;  4AXQ A;  1KUG A;  4H2E A;  3B8Z A;  1G12 A;  1L6J A;  1GE5 A;  5I43 A;  1USN A;  1Y93 A;  3KME A;  1IAG A;  1ZP5 A;  2W15 A;  1I1I P;  1D8M A;  1KAP P;  1BIW A;  1ZXV A;  1AKL A;  2JT6 A;  1MMR A;  3HYG A;  4QKZ A;  966C A;  4FXQ A;  3V96 B;  1MMQ A;  2OW9 A;  1OS2 A;  1FLS A;  3E8R A;  2W13 A;  3NTN A;  2ZVD A;  4G9L A;  2JIH A;  3B2Z A;  3LUM A;  1QIA A;  2MLS A;  1JIW P;  5D1U A;  4WK7 A;  830C A;  2XQH A;  4ON1 A;  3ZVS A;  5H8X A;  2E3X A;  3HY9 A;  1D7X A;  1H71 P;  1OMJ A;  1JK3 A;  3G5C A;  1ROS A;  2QUB A;  1HTD A;  3LE9 A;  4ZR5 A;  1G4K A;  1BQO A;  4GWM A;  4PKS A;  2MZE A;  2USN A;  4A7B A;  1ZTQ A;  3LUN A;  2OXU A;  4GWN A;  2X7M A;  1PWW A;  3HBU P;  5D1S A;  3EHX A;  4WZV A;  4H76 A;  2JT5 A;  5D3C A;  2OY4 A;  4I35 A;  2W12 A;  1FM1 A;  3LIL A;  2FV5 A;  2ZJ7 A;  2O36 A;  4GF1 A;  2HU6 A;  4DF9 A;  1CGE A;  2CLT A;  3F15 A;  1YP1 A;  1Y0V A;  3RTS A;  2L0R A;  1KBC A;  1IAA A;  4FVL A;  4WKE A;  1KUH A;  1QIC A;  2RJQ A;  1QJJ A;  1XFZ A;  2CKI A;  3K7L A;  2JSD A;  3LGP A;  2SRT A;  3LIR A;  1JAQ A;  4L6T A;  2J0T A;  5JMY A;  3K7N A;  3KHI A;  1SMP A;  5B5O A;  3UVC A;  2E2D A;  1GO7 P;  3L0V A;  1Y8J A;  2AIG P;  1J7N A;  3DWB A;  3B92 A;  4H30 A;  1SRP A;  4PKU A;  1EUB A;  4XM7 A;  1CGL A;  4JA1 A;  1YCM A;  3USN A;  3DSL A;  1JAO A;  1K7I A;  3EDZ A;  1HY7 A;  2Z2D A;  5I4O A;  1OM7 A;  1MMP A;  2DDF A;  2DW2 A;  2K2G A;  1JAP A;  1GE7 A;  4PKV A;  2AGM A;  3KEK A;  5CUH A;  1HV5 A;  5B5P A;  1D8F A;  3RTT A;  3LKA A;  2TCL A;  3G42 A;  3LJG A;  2OXW A;  4IJO A;  1XUC A;  4Q1L A;  1IAB A;  1IAE A;  3HDB A;  1SU3 A;  3EWJ A;  1IAC A;  1IAD A;  1DMT A;  2MZH A;  2WOA A;  2D1N A;  1B3D A;  1HFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...