1K7GA

Prtc from erwinia chrysanthemi
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
455
structure length
455
Chain Sequence
b'NSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPGSEEYGRQTFTHEIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSIMSYWGENETGADYNGHYGGAPMIDDIAAIQRLYGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHGVTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLSAFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDIIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords secreted protease C
publication title Protease C of Erwinia chrysanthemi: The Crystal Structure and Role of Amino Acids Y228 and E189
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 151
structure length 455
sequence length 455
ec nomenclature ec 3.4.24.40: Serralysin.
pdb deposition date 2001-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
A PF00413 Peptidase_M10 Matrixin
A PF08548 Peptidase_M10_C Peptidase M10 serralysin C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 1k7gA01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1k7gA02
2JSDA 1GO7P 2RJPA 2N8RA 3UVCA 2OVZA 1KUKA 1IAAA 1GE6A 1P9HA 4DV8A 2X3BA 1SATA 1A86A 5BOTA 2WO9A 5I12A 3P24A 5BPAA 1QICA 2ZJ6A 2OW1A 2XS4A 3DWBA 5CUHA 1OM7A 4XCTA 1R54A 2V4BA 1J7NA 1XUCA 2JT6A 1IABA 4J4MA 3N2UA 1MMBA 2OY2A 3DL1A 1CK7A 2YIGA 1KUGA 1R1HA 830CA 3LMCA 3I7GA 1QUAA 4GR0A 1HY7A 1I1IP 3KEKA 3HY7A 5CXAA 3WV2A 2YO0A 4H2EA 4PKSA 1SU3A 1K7QA 4CTHA 2OY4A 1JAQA 3F18A 2I47A 1JJ9A 2OW2A 4GR3A 3LUNA 3HB2P 2OXZA 4GR8A 4IUWA 1D8MA 2X3AA 1XFWA 1PWPA 5D7WA 1GE7A 1QJJA 5L7FA 1PWQA 2K9CA 3EWJA 3SHIA 2A8HA 2W15A 1HV5A 3RTSA 5D1UA 2E2DA 1CAQA 1XFZA 1EB6A 5LABA 1BUDA 3DPFA 1FM1A 5D2BA 1BUVM 2X7MA 1IAGA 3DPEA 2JIHA 2L0RA 2WO8A 1R1IA 456CA 1OM6A 3HBVP 5I43A 1CIZA 1CGEA 1BZSA 1KUHA 3BA0A 4WF6A 4H30A 1BSWA 2QPJA 3LJTA 3ZVSA 4H82A 2E3XA 1GO8P 1ND1A 3AIGA 3HYGA 3DSLA 1C8TA 4AXQA 3LQBA 2O36A 3TT4A 1K7IA 3KHIA 1JIWP 3LJZA 3Q2GA 4PKRA 1UEAA 2J83A 3ZXHA 4JPAA 3TVCA 1UMTA 3KECA 3LUMA 1Y8JA 1XFVA 2Y6DA 1QIAA 3LJGA 4EFSA 1GKCA 1MMQA 4FXQA 2FV9A 1KUFA 3LA9A 4PKWA 3LIRA 1BM6A 3OHOA 2MLSA 4GQLA 4WKEA 2W0DA 5I3MA 1D5JA 3LEAA 1BKCI 1JKYA 4GWNA 1YCMA 4G0DA 1BQOA 1UTTA 3V96B 4AUOA 1RM8A 1SMPA 3AYKA 3L0VA 1XFXA 3EDGA 2DW1A 1B3DA 3KWVC 4A3WA 966CA 3N2VA 1FLSA 1HFSA 3K7NA 1QIBA 1UTZA 3A70A 4AIGA 2W14A 4WZVA 4XM8A 1JANA 1XFUA 1R55A 4I35A 3F17A 4GUYA 3F19A 5CXLA 1L6JA 2ML2A 2J0TA 1XFYA 4HX3A 4R3VA 3GBOA 5BOYA 3E8RA 1AKLA 4PKQA 1JAPA 1FBLA 4GF1A 2DDFA 3OHLA 4H1QA 5D1TA 3EDZA 1G05A 2W13A 1HOVA 1DMTA 1S4BP 1EAKA 2OI0A 4DF9A 3WV3A 1MMPA 5L79A 1IACA 3LKAA 3S6LA 1SLNA 4QKZA 1Z3JA 1SRPA 5I0LA 3RTTA 2Z2DA 3MA2A 2OW0A 5I2ZA 1Q3AA 3K7LA 3HDBA 1R1JA 1OM8A 2HU6A 1I73A 1K7GA 3ZUKA 3AYUA 4HMAA 4JIJA 1AYKA 1HTDA 1ASTA 2QUAA 2ZVDA 2XQHA 3Q2HA 3VI1A 1CGLA 3KEJA 2W12A 1XUDA 4XM6A 4H76A 1O0QA 3EHYA 2ERQA 1ZS0A 1JIZA 1CGFA 2MLRA 1I76A 4FU4A 1OO9A 4WKIA 4IN9A 2WOAA 2TCLA 4DPEA 2XS3A 2Z8XA 3LILA 1USNA 1IAEA 2ERPA 3F16A 3B2ZA 2DW2A 2X3CA 2DW0A 5CZMA 1PWVA 4XM7A 1RMZA 3B8ZA 5H8XA 4L63A 3HDAP 4PKUA 1B8YA 3KMCA 1XURA 2CKIA 1D7XA 1IADA 1G49A 1UMSA 2POJA 4JQGA 2KRJA 2QUBA 1BKCE 2JT5A 4Q1LA 4PKVA 3LE9A 1SLMA 2D1OA 1PWUA 4ILWD 3B92A 1JK3A 1YOUA 1ZTQA 1KUIA 2Z8ZA 2AIGP 3TS4A 3F1AA 3G42A 2MZIA 4G9LA 3O64A 3VTGA 1G12A 1YP1A 1ZXVA 1GKDA 3CKIA 1OMJA 4AYKA 2OZRA 3USNA 2YB9A 1QJIA 5D1SA 2O3EA 2OXWA 3KRYA 4I03A 1C3IA 3LAAA 1O0TA 4H3XA 4ZR5A 5CVWA 1DTHA 3O2XA 3A6ZA 5B5OA 1OS2A 3U1RA 2EROA 2OXUA 1ZP5A 1ZXCA 2YO1A 1ATLA 1H71P 3HBUP 3ULTA 1HFCA 4JP4A 2AYKA 1OS9A 4GWMA 3EDIA 3EHXA 4FXYP 4JA1A 1GE5A 2USNA 4DD8A 3DNGA 3WP8A 4XBHA 3LK8A 1YQYA 3P1VA 2AGMA 3ELMA 4H84A 1KAPP 4FVLA 1WNIA 2FV5A 3WV1A 2MZHA 4WK7A 1AF0A 1KBCA 2ZJ7A 3EDHA 1A85A 3I7IA 2DDYA 2D1NA 4IJOA 2RJQA 1Y0VA 1JH1A 1CXVA 2OVXA 4L6TA 1MMRA 2Y6CA 2PJTA 3F15A 3NX7A 3NTNA 3L0TA 1PWWA 1G9KA 5D3CA 1CQRA 3HY9A 3LQ0A 1C7KA 2CLTA 1G4KA 3KMEA 3LIKA 1ZVXA 3LGPA 1D8FA 1ROSA 5B5PA 4ON1A 2JNPA 3G5CA 1MNCA 4PKTA 1BKCA 2MZEA 5I4OA 1GXDA 3TSKA 1BQQM 4A7BA 1Y93A 4H49A 1BIWA 1JAOA 2SRTA 4L19A 5JMYA 2OW9A 1EUBA 2K2GA
chains in the Genus database with same CATH superfamily
2JSDA 1GO7P 2RJPA 2N8RA 3UVCA 2OVZA 1KUKA 1IAAA 1XAXA 1GE6A 1P9HA 4DV8A 2X3BA 1SATA 1A86A 5BOTA 2WO9A 5I12A 3P24A 5BPAA 1QICA 2ZJ6A 2OW1A 2XS4A 3DWBA 5CUHA 1OM7A 4XCTA 1R54A 2V4BA 1J7NA 1XUCA 2JT6A 1IABA 4J4MA 3N2UA 1MMBA 2OY2A 3DL1A 1CK7A 2YIGA 1KUGA 1R1HA 830CA 3LMCA 3I7GA 1QUAA 4GR0A 1HY7A 1I1IP 3KEKA 3HY7A 5CXAA 3DTEA 3WV2A 2YO0A 4H2EA 4PKSA 1SU3A 1K7QA 3DTIA 4CTHA 2OY4A 1JAQA 3F18A 2I47A 1JJ9A 2OW2A 4GR3A 3LUNA 3HB2P 2OXZA 4GR8A 4IUWA 1D8MA 2X3AA 1XFWA 2YUFA 1PWPA 5D7WA 1GE7A 1QJJA 5L7FA 1PWQA 2K9CA 3EWJA 3SHIA 2A8HA 2W15A 1HV5A 3RTSA 5D1UA 2E2DA 1CAQA 1XFZA 1EB6A 5LABA 1BUDA 3DPFA 1FM1A 5D2BA 1BUVM 2X7MA 1IAGA 3DPEA 2JIHA 2L0RA 2WO8A 1R1IA 456CA 1OM6A 3HBVP 5I43A 1CIZA 1CGEA 1BZSA 1KUHA 3BA0A 4WF6A 4H30A 1BSWA 2QPJA 3LJTA 3ZVSA 1TVIA 4H82A 2E3XA 1GO8P 1ND1A 3AIGA 3HYGA 3DSLA 1C8TA 4AXQA 3LQBA 2O36A 3TT4A 1K7IA 3KHIA 1JIWP 3LJZA 3Q2GA 4PKRA 1UEAA 2J83A 3ZXHA 4JPAA 3TVCA 1UMTA 3KECA 3LUMA 1Y8JA 1XFVA 2Y6DA 1QIAA 3LJGA 4EFSA 1GKCA 1MMQA 3DTKA 4FXQA 2FV9A 1KUFA 3LA9A 4PKWA 3LIRA 1BM6A 3OHOA 2MLSA 4GQLA 4WKEA 2W0DA 5I3MA 1D5JA 3LEAA 1BKCI 1JKYA 4GWNA 1YCMA 4G0DA 1BQOA 1UTTA 3V96B 4AUOA 1RM8A 1SMPA 3AYKA 3L0VA 1XFXA 3EDGA 2DW1A 1B3DA 3KWVC 4A3WA 966CA 3N2VA 1FLSA 1HFSA 3K7NA 1QIBA 1UTZA 3A70A 4AIGA 2W14A 4WZVA 4XM8A 1JANA 1XFUA 1R55A 4I35A 3F17A 4GUYA 3F19A 5CXLA 1L6JA 2ML2A 1OZ9A 2J0TA 1XFYA 4HX3A 4R3VA 4L7AA 3GBOA 5BOYA 3E8RA 1AKLA 4PKQA 1JAPA 1FBLA 4GF1A 2DDFA 3OHLA 4H1QA 5D1TA 3EDZA 1G05A 2W13A 1HOVA 1DMTA 1S4BP 1EAKA 2OI0A 4DF9A 3WV3A 1MMPA 5L79A 1IACA 3LKAA 3S6LA 1SLNA 4QKZA 1Z3JA 1SRPA 5I0LA 3RTTA 2Z2DA 3MA2A 2OW0A 5I2ZA 1Q3AA 3K7LA 3HDBA 1R1JA 1OM8A 2HU6A 1I73A 1K7GA 3ZUKA 3AYUA 4HMAA 4JIJA 1AYKA 1HTDA 1ASTA 2QUAA 2ZVDA 2XQHA 3Q2HA 3VI1A 1CGLA 3KEJA 2W12A 1XUDA 4XM6A 4H76A 1O0QA 3EHYA 2ERQA 1ZS0A 1JIZA 1CGFA 2MLRA 1I76A 4FU4A 1OO9A 4WKIA 4IN9A 2WOAA 2TCLA 4DPEA 2XS3A 2Z8XA 3LILA 1USNA 1IAEA 2ERPA 3F16A 3B2ZA 2DW2A 2X3CA 2DW0A 5CZMA 1PWVA 4XM7A 1RMZA 3B8ZA 5H8XA 4L63A 3HDAP 4PKUA 1B8YA 3KMCA 1XURA 2CKIA 1D7XA 1IADA 1G49A 1UMSA 2POJA 4JQGA 2KRJA 2QUBA 1BKCE 2JT5A 4Q1LA 4PKVA 3LE9A 1SLMA 2D1OA 1PWUA 4ILWD 3B92A 1JK3A 1YOUA 1ZTQA 1KUIA 2Z8ZA 2AIGP 3TS4A 3F1AA 3G42A 2MZIA 4G9LA 3O64A 3VTGA 1G12A 1YP1A 1ZXVA 1GKDA 3CKIA 1OMJA 4AYKA 2OZRA 3USNA 2YB9A 1QJIA 5D1SA 2O3EA 2OXWA 3KRYA 4I03A 1C3IA 3LAAA 1O0TA 4H3XA 4ZR5A 5CVWA 1DTHA 3O2XA 3A6ZA 5B5OA 1OS2A 3U1RA 2EROA 2OXUA 1ZP5A 1ZXCA 2YO1A 1ATLA 1H71P 3HBUP 3ULTA 1HFCA 4JP4A 2AYKA 1OS9A 4GWMA 3EDIA 3EHXA 4FXYP 4JA1A 1GE5A 2USNA 4DD8A 3DNGA 3WP8A 4XBHA 3LK8A 1YQYA 3P1VA 2AGMA 3ELMA 4H84A 4DT5A 1KAPP 4FVLA 1WNIA 2FV5A 3WV1A 2MZHA 4WK7A 1AF0A 1KBCA 2ZJ7A 3EDHA 1A85A 3I7IA 2DDYA 2D1NA 4IJOA 2RJQA 1Y0VA 1JH1A 1CXVA 2OVXA 4L6TA 1MMRA 2Y6CA 2PJTA 3F15A 3NX7A 3NTNA 3L0TA 1PWWA 1G9KA 5D3CA 1CQRA 3HY9A 3LQ0A 1C7KA 2CLTA 1G4KA 3KMEA 3LIKA 1ZVXA 3LGPA 1D8FA 1ROSA 5B5PA 4ON1A 2JNPA 3G5CA 1MNCA 4PKTA 1BKCA 2MZEA 1XM5A 5I4OA 1GXDA 3TSKA 1BQQM 4A7BA 1Y93A 4H49A 1BIWA 1JAOA 2SRTA 4L19A 5JMYA 2OW9A 1EUBA 2K2GA
chains in the Genus database with same CATH topology
2JSDA 1GO7P 2RJPA 2N8RA 3UVCA 2OVZA 1KUKA 1IAAA 1GE6A 1P9HA 4DV8A 2X3BA 1SATA 1A86A 5BOTA 2WO9A 5I12A 3P24A 5BPAA 1QICA 2ZJ6A 2OW1A 2XS4A 3DWBA 5CUHA 1OM7A 4XCTA 1R54A 2V4BA 1J7NA 1XUCA 2JT6A 1IABA 4J4MA 3N2UA 1MMBA 2OY2A 3DL1A 1CK7A 2YIGA 1KUGA 1R1HA 830CA 3LMCA 3I7GA 1QUAA 4GR0A 1HY7A 1I1IP 3KEKA 3HY7A 5CXAA 3DTEA 3WV2A 2YO0A 4H2EA 4PKSA 1SU3A 1K7QA 3DTIA 4CTHA 2OY4A 1JAQA 3F18A 2I47A 1JJ9A 2OW2A 4GR3A 3LUNA 3HB2P 2OXZA 4GR8A 4IUWA 1D8MA 2X3AA 1XFWA 2YUFA 1PWPA 5D7WA 1GE7A 1QJJA 5L7FA 1PWQA 2K9CA 3EWJA 3SHIA 2A8HA 2W15A 1HV5A 3RTSA 5D1UA 2E2DA 1CAQA 1XFZA 1EB6A 5LABA 1BUDA 3DPFA 1FM1A 5D2BA 1BUVM 2X7MA 1IAGA 3DPEA 2JIHA 2L0RA 2WO8A 1R1IA 456CA 1OM6A 3HBVP 5I43A 1CIZA 1CGEA 1BZSA 1KUHA 3BA0A 4WF6A 4H30A 1BSWA 2QPJA 3LJTA 3ZVSA 4H82A 2E3XA 1GO8P 1ND1A 3AIGA 3HYGA 3DSLA 1C8TA 4AXQA 3LQBA 2O36A 3TT4A 1K7IA 3KHIA 1JIWP 3LJZA 3Q2GA 4PKRA 1UEAA 2J83A 3ZXHA 4JPAA 3TVCA 1UMTA 3KECA 3LUMA 1Y8JA 1XFVA 2Y6DA 1QIAA 3LJGA 4EFSA 1GKCA 1MMQA 3DTKA 4FXQA 2FV9A 1KUFA 3LA9A 4PKWA 3LIRA 1BM6A 3OHOA 2MLSA 4GQLA 4WKEA 2W0DA 5I3MA 1D5JA 3LEAA 1BKCI 1JKYA 4GWNA 1YCMA 4G0DA 1BQOA 1UTTA 3V96B 4AUOA 1RM8A 1SMPA 3AYKA 3L0VA 1XFXA 3EDGA 2DW1A 1B3DA 3KWVC 4A3WA 966CA 3N2VA 1FLSA 1HFSA 3K7NA 1QIBA 1UTZA 3A70A 4AIGA 2W14A 4WZVA 4XM8A 1JANA 1XFUA 1R55A 4I35A 3F17A 4GUYA 3F19A 5CXLA 1L6JA 2ML2A 2J0TA 1XFYA 4HX3A 4R3VA 4L7AA 3GBOA 5BOYA 3E8RA 1AKLA 4PKQA 1JAPA 1FBLA 4GF1A 2DDFA 3OHLA 4H1QA 5D1TA 3EDZA 1G05A 2W13A 1HOVA 1DMTA 1S4BP 1EAKA 2OI0A 4DF9A 3WV3A 1MMPA 5L79A 1IACA 3LKAA 3S6LA 1SLNA 4QKZA 1Z3JA 1SRPA 5I0LA 3RTTA 2Z2DA 3MA2A 2OW0A 5I2ZA 1Q3AA 3K7LA 3HDBA 1R1JA 1OM8A 2HU6A 1I73A 1K7GA 3ZUKA 3AYUA 4HMAA 4JIJA 1AYKA 1HTDA 1ASTA 2QUAA 2ZVDA 2XQHA 3Q2HA 3VI1A 1CGLA 3KEJA 2W12A 1XUDA 4XM6A 4H76A 1O0QA 3EHYA 2ERQA 1ZS0A 1JIZA 1CGFA 2MLRA 1I76A 4FU4A 1OO9A 4WKIA 4IN9A 2WOAA 2TCLA 4DPEA 2XS3A 2Z8XA 3LILA 1USNA 1IAEA 2ERPA 3F16A 3B2ZA 2DW2A 2X3CA 2DW0A 5CZMA 1PWVA 4XM7A 1RMZA 3B8ZA 5H8XA 4L63A 3HDAP 4PKUA 1B8YA 3KMCA 1XURA 2CKIA 1D7XA 1IADA 1G49A 1UMSA 2POJA 4JQGA 2KRJA 2QUBA 1BKCE 2JT5A 4Q1LA 4PKVA 3LE9A 1SLMA 2D1OA 1PWUA 4ILWD 3B92A 1JK3A 1YOUA 1ZTQA 1KUIA 2Z8ZA 2AIGP 3TS4A 3F1AA 3G42A 2MZIA 4G9LA 3O64A 3VTGA 1G12A 1YP1A 1ZXVA 1GKDA 3CKIA 1OMJA 4AYKA 2OZRA 3USNA 2YB9A 1QJIA 5D1SA 2O3EA 2OXWA 3KRYA 4I03A 1C3IA 3LAAA 1O0TA 4H3XA 4ZR5A 5CVWA 1DTHA 3O2XA 3A6ZA 5B5OA 1OS2A 3U1RA 2EROA 2OXUA 1ZP5A 1ZXCA 2YO1A 1ATLA 1H71P 3HBUP 3ULTA 1HFCA 4JP4A 2AYKA 1OS9A 4GWMA 3EDIA 3EHXA 4FXYP 4JA1A 1GE5A 2USNA 4DD8A 3DNGA 3WP8A 4XBHA 3LK8A 1YQYA 3P1VA 2AGMA 3ELMA 4H84A 1KAPP 4FVLA 1WNIA 2FV5A 3WV1A 2MZHA 4WK7A 1AF0A 1KBCA 2ZJ7A 3EDHA 1A85A 3I7IA 2DDYA 2D1NA 4IJOA 2RJQA 1Y0VA 1JH1A 1CXVA 2OVXA 4L6TA 1MMRA 2Y6CA 2PJTA 3F15A 3NX7A 3NTNA 3L0TA 1PWWA 1G9KA 5D3CA 1CQRA 3HY9A 3LQ0A 1C7KA 2CLTA 1G4KA 3KMEA 3LIKA 1ZVXA 3LGPA 1D8FA 1ROSA 5B5PA 4ON1A 2JNPA 3G5CA 1MNCA 4PKTA 1BKCA 2MZEA 5I4OA 1GXDA 3TSKA 1BQQM 4A7BA 1Y93A 4H49A 1BIWA 1JAOA 2SRTA 4L19A 5JMYA 2OW9A 1EUBA 2K2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JSD A;  1GO7 P;  2RJP A;  2N8R A;  3UVC A;  2OVZ A;  1KUK A;  1IAA A;  1GE6 A;  1P9H A;  4DV8 A;  2X3B A;  1SAT A;  1A86 A;  5BOT A;  2WO9 A;  5I12 A;  3P24 A;  5BPA A;  1QIC A;  2ZJ6 A;  2OW1 A;  2XS4 A;  3DWB A;  5CUH A;  1OM7 A;  4XCT A;  1R54 A;  2V4B A;  1J7N A;  1XUC A;  2JT6 A;  1IAB A;  4J4M A;  3N2U A;  1MMB A;  2OY2 A;  3DL1 A;  1CK7 A;  2YIG A;  1KUG A;  1R1H A;  830C A;  3LMC A;  3I7G A;  1QUA A;  4GR0 A;  1HY7 A;  1I1I P;  3KEK A;  3HY7 A;  5CXA A;  3WV2 A;  2YO0 A;  4H2E A;  4PKS A;  1SU3 A;  1K7Q A;  4CTH A;  2OY4 A;  1JAQ A;  3F18 A;  2I47 A;  1JJ9 A;  2OW2 A;  4GR3 A;  3LUN A;  3HB2 P;  2OXZ A;  4GR8 A;  4IUW A;  1D8M A;  2X3A A;  1XFW A;  1PWP A;  5D7W A;  1GE7 A;  1QJJ A;  5L7F A;  1PWQ A;  2K9C A;  3EWJ A;  3SHI A;  2A8H A;  2W15 A;  1HV5 A;  3RTS A;  5D1U A;  2E2D A;  1CAQ A;  1XFZ A;  1EB6 A;  5LAB A;  1BUD A;  3DPF A;  1FM1 A;  5D2B A;  1BUV M;  2X7M A;  1IAG A;  3DPE A;  2JIH A;  2L0R A;  2WO8 A;  1R1I A;  456C A;  1OM6 A;  3HBV P;  5I43 A;  1CIZ A;  1CGE A;  1BZS A;  1KUH A;  3BA0 A;  4WF6 A;  4H30 A;  1BSW A;  2QPJ A;  3LJT A;  3ZVS A;  4H82 A;  2E3X A;  1GO8 P;  1ND1 A;  3AIG A;  3HYG A;  3DSL A;  1C8T A;  4AXQ A;  3LQB A;  2O36 A;  3TT4 A;  1K7I A;  3KHI A;  1JIW P;  3LJZ A;  3Q2G A;  4PKR A;  1UEA A;  2J83 A;  3ZXH A;  4JPA A;  3TVC A;  1UMT A;  3KEC A;  3LUM A;  1Y8J A;  1XFV A;  2Y6D A;  1QIA A;  3LJG A;  4EFS A;  1GKC A;  1MMQ A;  4FXQ A;  2FV9 A;  1KUF A;  3LA9 A;  4PKW A;  3LIR A;  1BM6 A;  3OHO A;  2MLS A;  4GQL A;  4WKE A;  2W0D A;  5I3M A;  1D5J A;  3LEA A;  1BKC I;  1JKY A;  4GWN A;  1YCM A;  4G0D A;  1BQO A;  1UTT A;  3V96 B;  4AUO A;  1RM8 A;  1SMP A;  3AYK A;  3L0V A;  1XFX A;  3EDG A;  2DW1 A;  1B3D A;  3KWV C;  4A3W A;  966C A;  3N2V A;  1FLS A;  1HFS A;  3K7N A;  1QIB A;  1UTZ A;  3A70 A;  4AIG A;  2W14 A;  4WZV A;  4XM8 A;  1JAN A;  1XFU A;  1R55 A;  4I35 A;  3F17 A;  4GUY A;  3F19 A;  5CXL A;  1L6J A;  2ML2 A;  2J0T A;  1XFY A;  4HX3 A;  4R3V A;  3GBO A;  5BOY A;  3E8R A;  1AKL A;  4PKQ A;  1JAP A;  1FBL A;  4GF1 A;  2DDF A;  3OHL A;  4H1Q A;  5D1T A;  3EDZ A;  1G05 A;  2W13 A;  1HOV A;  1DMT A;  1S4B P;  1EAK A;  2OI0 A;  4DF9 A;  3WV3 A;  1MMP A;  5L79 A;  1IAC A;  3LKA A;  3S6L A;  1SLN A;  4QKZ A;  1Z3J A;  1SRP A;  5I0L A;  3RTT A;  2Z2D A;  3MA2 A;  2OW0 A;  5I2Z A;  1Q3A A;  3K7L A;  3HDB A;  1R1J A;  1OM8 A;  2HU6 A;  1I73 A;  1K7G A;  3ZUK A;  3AYU A;  4HMA A;  4JIJ A;  1AYK A;  1HTD A;  1AST A;  2QUA A;  2ZVD A;  2XQH A;  3Q2H A;  3VI1 A;  1CGL A;  3KEJ A;  2W12 A;  1XUD A;  4XM6 A;  4H76 A;  1O0Q A;  3EHY A;  2ERQ A;  1ZS0 A;  1JIZ A;  1CGF A;  2MLR A;  1I76 A;  4FU4 A;  1OO9 A;  4WKI A;  4IN9 A;  2WOA A;  2TCL A;  4DPE A;  2XS3 A;  2Z8X A;  3LIL A;  1USN A;  1IAE A;  2ERP A;  3F16 A;  3B2Z A;  2DW2 A;  2X3C A;  2DW0 A;  5CZM A;  1PWV A;  4XM7 A;  1RMZ A;  3B8Z A;  5H8X A;  4L63 A;  3HDA P;  4PKU A;  1B8Y A;  3KMC A;  1XUR A;  2CKI A;  1D7X A;  1IAD A;  1G49 A;  1UMS A;  2POJ A;  4JQG A;  2KRJ A;  2QUB A;  1BKC E;  2JT5 A;  4Q1L A;  4PKV A;  3LE9 A;  1SLM A;  2D1O A;  1PWU A;  4ILW D;  3B92 A;  1JK3 A;  1YOU A;  1ZTQ A;  1KUI A;  2Z8Z A;  2AIG P;  3TS4 A;  3F1A A;  3G42 A;  2MZI A;  4G9L A;  3O64 A;  3VTG A;  1G12 A;  1YP1 A;  1ZXV A;  1GKD A;  3CKI A;  1OMJ A;  4AYK A;  2OZR A;  3USN A;  2YB9 A;  1QJI A;  5D1S A;  2O3E A;  2OXW A;  3KRY A;  4I03 A;  1C3I A;  3LAA A;  1O0T A;  4H3X A;  4ZR5 A;  5CVW A;  1DTH A;  3O2X A;  3A6Z A;  5B5O A;  1OS2 A;  3U1R A;  2ERO A;  2OXU A;  1ZP5 A;  1ZXC A;  2YO1 A;  1ATL A;  1H71 P;  3HBU P;  3ULT A;  1HFC A;  4JP4 A;  2AYK A;  1OS9 A;  4GWM A;  3EDI A;  3EHX A;  4FXY P;  4JA1 A;  1GE5 A;  2USN A;  4DD8 A;  3DNG A;  3WP8 A;  4XBH A;  3LK8 A;  1YQY A;  3P1V A;  2AGM A;  3ELM A;  4H84 A;  1KAP P;  4FVL A;  1WNI A;  2FV5 A;  3WV1 A;  2MZH A;  4WK7 A;  1AF0 A;  1KBC A;  2ZJ7 A;  3EDH A;  1A85 A;  3I7I A;  2DDY A;  2D1N A;  4IJO A;  2RJQ A;  1Y0V A;  1JH1 A;  1CXV A;  2OVX A;  4L6T A;  1MMR A;  2Y6C A;  2PJT A;  3F15 A;  3NX7 A;  3NTN A;  3L0T A;  1PWW A;  1G9K A;  5D3C A;  1CQR A;  3HY9 A;  3LQ0 A;  1C7K A;  2CLT A;  1G4K A;  3KME A;  3LIK A;  1ZVX A;  3LGP A;  1D8F A;  1ROS A;  5B5P A;  4ON1 A;  2JNP A;  3G5C A;  1MNC A;  4PKT A;  1BKC A;  2MZE A;  5I4O A;  1GXD A;  3TSK A;  1BQQ M;  4A7B A;  1Y93 A;  4H49 A;  1BIW A;  1JAO A;  2SRT A;  4L19 A;  5JMY A;  2OW9 A;  1EUB A;  2K2G A; 
#chains in the Genus database with same CATH topology
 2JSD A;  1GO7 P;  2RJP A;  2N8R A;  3UVC A;  2OVZ A;  1KUK A;  1IAA A;  1XAX A;  1GE6 A;  1P9H A;  4DV8 A;  2X3B A;  1SAT A;  1A86 A;  5BOT A;  2WO9 A;  5I12 A;  3P24 A;  5BPA A;  1QIC A;  2ZJ6 A;  2OW1 A;  2XS4 A;  3DWB A;  5CUH A;  1OM7 A;  4XCT A;  1R54 A;  2V4B A;  1J7N A;  1XUC A;  2JT6 A;  1IAB A;  4J4M A;  3N2U A;  1MMB A;  2OY2 A;  3DL1 A;  1CK7 A;  2YIG A;  1KUG A;  1R1H A;  830C A;  3LMC A;  3I7G A;  1QUA A;  4GR0 A;  1HY7 A;  1I1I P;  3KEK A;  3HY7 A;  5CXA A;  3DTE A;  3WV2 A;  2YO0 A;  4H2E A;  4PKS A;  1SU3 A;  1K7Q A;  3DTI A;  4CTH A;  2OY4 A;  1JAQ A;  3F18 A;  2I47 A;  1JJ9 A;  2OW2 A;  4GR3 A;  3LUN A;  3HB2 P;  2OXZ A;  4GR8 A;  4IUW A;  1D8M A;  2X3A A;  1XFW A;  2YUF A;  1PWP A;  5D7W A;  1GE7 A;  1QJJ A;  5L7F A;  1PWQ A;  2K9C A;  3EWJ A;  3SHI A;  2A8H A;  2W15 A;  1HV5 A;  3RTS A;  5D1U A;  2E2D A;  1CAQ A;  1XFZ A;  1EB6 A;  5LAB A;  1BUD A;  3DPF A;  1FM1 A;  5D2B A;  1BUV M;  2X7M A;  1IAG A;  3DPE A;  2JIH A;  2L0R A;  2WO8 A;  1R1I A;  456C A;  1OM6 A;  3HBV P;  5I43 A;  1CIZ A;  1CGE A;  1BZS A;  1KUH A;  3BA0 A;  4WF6 A;  4H30 A;  1BSW A;  2QPJ A;  3LJT A;  3ZVS A;  1TVI A;  4H82 A;  2E3X A;  1GO8 P;  1ND1 A;  3AIG A;  3HYG A;  3DSL A;  1C8T A;  4AXQ A;  3LQB A;  2O36 A;  3TT4 A;  1K7I A;  3KHI A;  1JIW P;  3LJZ A;  3Q2G A;  4PKR A;  1UEA A;  2J83 A;  3ZXH A;  4JPA A;  3TVC A;  1UMT A;  3KEC A;  3LUM A;  1Y8J A;  1XFV A;  2Y6D A;  1QIA A;  3LJG A;  4EFS A;  1GKC A;  1MMQ A;  3DTK A;  4FXQ A;  2FV9 A;  1KUF A;  3LA9 A;  4PKW A;  3LIR A;  1BM6 A;  3OHO A;  2MLS A;  4GQL A;  4WKE A;  2W0D A;  5I3M A;  1D5J A;  3LEA A;  1BKC I;  1JKY A;  4GWN A;  1YCM A;  4G0D A;  1BQO A;  1UTT A;  3V96 B;  4AUO A;  1RM8 A;  1SMP A;  3AYK A;  3L0V A;  1XFX A;  3EDG A;  2DW1 A;  1B3D A;  3KWV C;  4A3W A;  966C A;  3N2V A;  1FLS A;  1HFS A;  3K7N A;  1QIB A;  1UTZ A;  3A70 A;  4AIG A;  2W14 A;  4WZV A;  4XM8 A;  1JAN A;  1XFU A;  1R55 A;  4I35 A;  3F17 A;  4GUY A;  3F19 A;  5CXL A;  1L6J A;  2ML2 A;  1OZ9 A;  2J0T A;  1XFY A;  4HX3 A;  4R3V A;  4L7A A;  3GBO A;  5BOY A;  3E8R A;  1AKL A;  4PKQ A;  1JAP A;  1FBL A;  4GF1 A;  2DDF A;  3OHL A;  4H1Q A;  5D1T A;  3EDZ A;  1G05 A;  2W13 A;  1HOV A;  1DMT A;  1S4B P;  1EAK A;  2OI0 A;  4DF9 A;  3WV3 A;  1MMP A;  5L79 A;  1IAC A;  3LKA A;  3S6L A;  1SLN A;  4QKZ A;  1Z3J A;  1SRP A;  5I0L A;  3RTT A;  2Z2D A;  3MA2 A;  2OW0 A;  5I2Z A;  1Q3A A;  3K7L A;  3HDB A;  1R1J A;  1OM8 A;  2HU6 A;  1I73 A;  1K7G A;  3ZUK A;  3AYU A;  4HMA A;  4JIJ A;  1AYK A;  1HTD A;  1AST A;  2QUA A;  2ZVD A;  2XQH A;  3Q2H A;  3VI1 A;  1CGL A;  3KEJ A;  2W12 A;  1XUD A;  4XM6 A;  4H76 A;  1O0Q A;  3EHY A;  2ERQ A;  1ZS0 A;  1JIZ A;  1CGF A;  2MLR A;  1I76 A;  4FU4 A;  1OO9 A;  4WKI A;  4IN9 A;  2WOA A;  2TCL A;  4DPE A;  2XS3 A;  2Z8X A;  3LIL A;  1USN A;  1IAE A;  2ERP A;  3F16 A;  3B2Z A;  2DW2 A;  2X3C A;  2DW0 A;  5CZM A;  1PWV A;  4XM7 A;  1RMZ A;  3B8Z A;  5H8X A;  4L63 A;  3HDA P;  4PKU A;  1B8Y A;  3KMC A;  1XUR A;  2CKI A;  1D7X A;  1IAD A;  1G49 A;  1UMS A;  2POJ A;  4JQG A;  2KRJ A;  2QUB A;  1BKC E;  2JT5 A;  4Q1L A;  4PKV A;  3LE9 A;  1SLM A;  2D1O A;  1PWU A;  4ILW D;  3B92 A;  1JK3 A;  1YOU A;  1ZTQ A;  1KUI A;  2Z8Z A;  2AIG P;  3TS4 A;  3F1A A;  3G42 A;  2MZI A;  4G9L A;  3O64 A;  3VTG A;  1G12 A;  1YP1 A;  1ZXV A;  1GKD A;  3CKI A;  1OMJ A;  4AYK A;  2OZR A;  3USN A;  2YB9 A;  1QJI A;  5D1S A;  2O3E A;  2OXW A;  3KRY A;  4I03 A;  1C3I A;  3LAA A;  1O0T A;  4H3X A;  4ZR5 A;  5CVW A;  1DTH A;  3O2X A;  3A6Z A;  5B5O A;  1OS2 A;  3U1R A;  2ERO A;  2OXU A;  1ZP5 A;  1ZXC A;  2YO1 A;  1ATL A;  1H71 P;  3HBU P;  3ULT A;  1HFC A;  4JP4 A;  2AYK A;  1OS9 A;  4GWM A;  3EDI A;  3EHX A;  4FXY P;  4JA1 A;  1GE5 A;  2USN A;  4DD8 A;  3DNG A;  3WP8 A;  4XBH A;  3LK8 A;  1YQY A;  3P1V A;  2AGM A;  3ELM A;  4H84 A;  4DT5 A;  1KAP P;  4FVL A;  1WNI A;  2FV5 A;  3WV1 A;  2MZH A;  4WK7 A;  1AF0 A;  1KBC A;  2ZJ7 A;  3EDH A;  1A85 A;  3I7I A;  2DDY A;  2D1N A;  4IJO A;  2RJQ A;  1Y0V A;  1JH1 A;  1CXV A;  2OVX A;  4L6T A;  1MMR A;  2Y6C A;  2PJT A;  3F15 A;  3NX7 A;  3NTN A;  3L0T A;  1PWW A;  1G9K A;  5D3C A;  1CQR A;  3HY9 A;  3LQ0 A;  1C7K A;  2CLT A;  1G4K A;  3KME A;  3LIK A;  1ZVX A;  3LGP A;  1D8F A;  1ROS A;  5B5P A;  4ON1 A;  2JNP A;  3G5C A;  1MNC A;  4PKT A;  1BKC A;  2MZE A;  1XM5 A;  5I4O A;  1GXD A;  3TSK A;  1BQQ M;  4A7B A;  1Y93 A;  4H49 A;  1BIW A;  1JAO A;  2SRT A;  4L19 A;  5JMY A;  2OW9 A;  1EUB A;  2K2G A; 
#chains in the Genus database with same CATH homology
 2JSD A;  1GO7 P;  2RJP A;  2N8R A;  3UVC A;  2OVZ A;  1KUK A;  1IAA A;  1GE6 A;  1P9H A;  4DV8 A;  2X3B A;  1SAT A;  1A86 A;  5BOT A;  2WO9 A;  5I12 A;  3P24 A;  5BPA A;  1QIC A;  2ZJ6 A;  2OW1 A;  2XS4 A;  3DWB A;  5CUH A;  1OM7 A;  4XCT A;  1R54 A;  2V4B A;  1J7N A;  1XUC A;  2JT6 A;  1IAB A;  4J4M A;  3N2U A;  1MMB A;  2OY2 A;  3DL1 A;  1CK7 A;  2YIG A;  1KUG A;  1R1H A;  830C A;  3LMC A;  3I7G A;  1QUA A;  4GR0 A;  1HY7 A;  1I1I P;  3KEK A;  3HY7 A;  5CXA A;  3DTE A;  3WV2 A;  2YO0 A;  4H2E A;  4PKS A;  1SU3 A;  1K7Q A;  3DTI A;  4CTH A;  2OY4 A;  1JAQ A;  3F18 A;  2I47 A;  1JJ9 A;  2OW2 A;  4GR3 A;  3LUN A;  3HB2 P;  2OXZ A;  4GR8 A;  4IUW A;  1D8M A;  2X3A A;  1XFW A;  2YUF A;  1PWP A;  5D7W A;  1GE7 A;  1QJJ A;  5L7F A;  1PWQ A;  2K9C A;  3EWJ A;  3SHI A;  2A8H A;  2W15 A;  1HV5 A;  3RTS A;  5D1U A;  2E2D A;  1CAQ A;  1XFZ A;  1EB6 A;  5LAB A;  1BUD A;  3DPF A;  1FM1 A;  5D2B A;  1BUV M;  2X7M A;  1IAG A;  3DPE A;  2JIH A;  2L0R A;  2WO8 A;  1R1I A;  456C A;  1OM6 A;  3HBV P;  5I43 A;  1CIZ A;  1CGE A;  1BZS A;  1KUH A;  3BA0 A;  4WF6 A;  4H30 A;  1BSW A;  2QPJ A;  3LJT A;  3ZVS A;  4H82 A;  2E3X A;  1GO8 P;  1ND1 A;  3AIG A;  3HYG A;  3DSL A;  1C8T A;  4AXQ A;  3LQB A;  2O36 A;  3TT4 A;  1K7I A;  3KHI A;  1JIW P;  3LJZ A;  3Q2G A;  4PKR A;  1UEA A;  2J83 A;  3ZXH A;  4JPA A;  3TVC A;  1UMT A;  3KEC A;  3LUM A;  1Y8J A;  1XFV A;  2Y6D A;  1QIA A;  3LJG A;  4EFS A;  1GKC A;  1MMQ A;  3DTK A;  4FXQ A;  2FV9 A;  1KUF A;  3LA9 A;  4PKW A;  3LIR A;  1BM6 A;  3OHO A;  2MLS A;  4GQL A;  4WKE A;  2W0D A;  5I3M A;  1D5J A;  3LEA A;  1BKC I;  1JKY A;  4GWN A;  1YCM A;  4G0D A;  1BQO A;  1UTT A;  3V96 B;  4AUO A;  1RM8 A;  1SMP A;  3AYK A;  3L0V A;  1XFX A;  3EDG A;  2DW1 A;  1B3D A;  3KWV C;  4A3W A;  966C A;  3N2V A;  1FLS A;  1HFS A;  3K7N A;  1QIB A;  1UTZ A;  3A70 A;  4AIG A;  2W14 A;  4WZV A;  4XM8 A;  1JAN A;  1XFU A;  1R55 A;  4I35 A;  3F17 A;  4GUY A;  3F19 A;  5CXL A;  1L6J A;  2ML2 A;  2J0T A;  1XFY A;  4HX3 A;  4R3V A;  4L7A A;  3GBO A;  5BOY A;  3E8R A;  1AKL A;  4PKQ A;  1JAP A;  1FBL A;  4GF1 A;  2DDF A;  3OHL A;  4H1Q A;  5D1T A;  3EDZ A;  1G05 A;  2W13 A;  1HOV A;  1DMT A;  1S4B P;  1EAK A;  2OI0 A;  4DF9 A;  3WV3 A;  1MMP A;  5L79 A;  1IAC A;  3LKA A;  3S6L A;  1SLN A;  4QKZ A;  1Z3J A;  1SRP A;  5I0L A;  3RTT A;  2Z2D A;  3MA2 A;  2OW0 A;  5I2Z A;  1Q3A A;  3K7L A;  3HDB A;  1R1J A;  1OM8 A;  2HU6 A;  1I73 A;  1K7G A;  3ZUK A;  3AYU A;  4HMA A;  4JIJ A;  1AYK A;  1HTD A;  1AST A;  2QUA A;  2ZVD A;  2XQH A;  3Q2H A;  3VI1 A;  1CGL A;  3KEJ A;  2W12 A;  1XUD A;  4XM6 A;  4H76 A;  1O0Q A;  3EHY A;  2ERQ A;  1ZS0 A;  1JIZ A;  1CGF A;  2MLR A;  1I76 A;  4FU4 A;  1OO9 A;  4WKI A;  4IN9 A;  2WOA A;  2TCL A;  4DPE A;  2XS3 A;  2Z8X A;  3LIL A;  1USN A;  1IAE A;  2ERP A;  3F16 A;  3B2Z A;  2DW2 A;  2X3C A;  2DW0 A;  5CZM A;  1PWV A;  4XM7 A;  1RMZ A;  3B8Z A;  5H8X A;  4L63 A;  3HDA P;  4PKU A;  1B8Y A;  3KMC A;  1XUR A;  2CKI A;  1D7X A;  1IAD A;  1G49 A;  1UMS A;  2POJ A;  4JQG A;  2KRJ A;  2QUB A;  1BKC E;  2JT5 A;  4Q1L A;  4PKV A;  3LE9 A;  1SLM A;  2D1O A;  1PWU A;  4ILW D;  3B92 A;  1JK3 A;  1YOU A;  1ZTQ A;  1KUI A;  2Z8Z A;  2AIG P;  3TS4 A;  3F1A A;  3G42 A;  2MZI A;  4G9L A;  3O64 A;  3VTG A;  1G12 A;  1YP1 A;  1ZXV A;  1GKD A;  3CKI A;  1OMJ A;  4AYK A;  2OZR A;  3USN A;  2YB9 A;  1QJI A;  5D1S A;  2O3E A;  2OXW A;  3KRY A;  4I03 A;  1C3I A;  3LAA A;  1O0T A;  4H3X A;  4ZR5 A;  5CVW A;  1DTH A;  3O2X A;  3A6Z A;  5B5O A;  1OS2 A;  3U1R A;  2ERO A;  2OXU A;  1ZP5 A;  1ZXC A;  2YO1 A;  1ATL A;  1H71 P;  3HBU P;  3ULT A;  1HFC A;  4JP4 A;  2AYK A;  1OS9 A;  4GWM A;  3EDI A;  3EHX A;  4FXY P;  4JA1 A;  1GE5 A;  2USN A;  4DD8 A;  3DNG A;  3WP8 A;  4XBH A;  3LK8 A;  1YQY A;  3P1V A;  2AGM A;  3ELM A;  4H84 A;  1KAP P;  4FVL A;  1WNI A;  2FV5 A;  3WV1 A;  2MZH A;  4WK7 A;  1AF0 A;  1KBC A;  2ZJ7 A;  3EDH A;  1A85 A;  3I7I A;  2DDY A;  2D1N A;  4IJO A;  2RJQ A;  1Y0V A;  1JH1 A;  1CXV A;  2OVX A;  4L6T A;  1MMR A;  2Y6C A;  2PJT A;  3F15 A;  3NX7 A;  3NTN A;  3L0T A;  1PWW A;  1G9K A;  5D3C A;  1CQR A;  3HY9 A;  3LQ0 A;  1C7K A;  2CLT A;  1G4K A;  3KME A;  3LIK A;  1ZVX A;  3LGP A;  1D8F A;  1ROS A;  5B5P A;  4ON1 A;  2JNP A;  3G5C A;  1MNC A;  4PKT A;  1BKC A;  2MZE A;  5I4O A;  1GXD A;  3TSK A;  1BQQ M;  4A7B A;  1Y93 A;  4H49 A;  1BIW A;  1JAO A;  2SRT A;  4L19 A;  5JMY A;  2OW9 A;  1EUB A;  2K2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...