1K7GA

Prtc from erwinia chrysanthemi
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
455
structure length
455
Chain Sequence
NSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPGSEEYGRQTFTHEIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSIMSYWGENETGADYNGHYGGAPMIDDIAAIQRLYGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHGVTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLSAFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDIIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords secreted protease C
publication title Protease C of Erwinia chrysanthemi: The Crystal Structure and Role of Amino Acids Y228 and E189
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 151
structure length 455
sequence length 455
ec nomenclature ec 3.4.24.40: Serralysin.
pdb deposition date 2001-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
A PF00413 Peptidase_M10 Matrixin
A PF08548 Peptidase_M10_C Peptidase M10 serralysin C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 1k7gA01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1k7gA02
1UTZA 3HYGA 4Q1LA 2QPJA 3E8RA 1YOUA 1PWUA 2RJQA 3DPEA 2CLTA 3LQ0A 4G0DA 1R55A 1FLSA 3SHIA 2EROA 1BUDA 4H1QA 2JT5A 2Z2DA 3LILA 1OM6A 1BZSA 5BOTA 3S6LA 2OXUA 4PKVA 1JJ9A 4H30A 3DWBA 2YO1A 3CKIA 3LJZA 5D1TA 4WKEA 1XFWA 4PKWA 5BOYA 1QUAA 3O64A 1CAQA 4IUWA 3V96B 3OHLA 2WOAA 2L0RA 1IADA 2OW0A 1ATLA 3USNA 1CQRA 4GR8A 1H71P 5CVWA 3K7NA 3ZUKA 1CIZA 1XUDA 4FXYP 3RTTA 1GE6A 2OY4A 2W13A 1IABA 5CXLA 3LEAA 1IAEA 2E3XA 3KEKA 1D8FA 3KMEA 3LJGA 3EHXA 4FU4A 4PKTA 1AYKA 2OXWA 1P9HA 1RMZA 3G42A 2OVZA 3B92A 1EAKA 2XS3A 1SATA 3NX7A 1G12A 3LAAA 1JAQA 5CUHA 2FV5A 3LQBA 4EFSA 3I7GA 4H2EA 4GF1A 2DW2A 4DD8A 2OI0A 4IN9A 2OXZA 3I7IA 4GUYA 3KRYA 1D7XA 1ZS0A 1A85A 2I47A 3WV2A 4A3WA 1KUKA 3TS4A 4DPEA 1Y8JA 5I0LA 1XURA 4I35A 3KWVC 1EB6A 1WNIA 1G4KA 3AIGA 3EDGA 2MLRA 2MZHA 2DDFA 2TCLA 3G5CA 3OHOA 4H3XA 2W12A 1JAOA 3ZVSA 4AXQA 1Q3AA 4CTHA 2XS4A 3DL1A 2ERPA 1ZXVA 1IACA 1IAGA 2ZVDA 4GR0A 1BIWA 2OZRA 3HB2P 1PWVA 3LIKA 3P1VA 2MZEA 4L19A 4DF9A 3F17A 2E2DA 1A86A 4L6TA 3U1RA 2HU6A 5BPAA 1C8TA 1ZP5A 1SU3A 1R1IA 5B5OA 1KAPP 4PKRA 1J7NA 3LUNA 4JPAA 1IAAA 3KECA 2QUAA 5H8XA 1Y0VA 1MNCA 1GE5A 1BKCI 5I43A 2ZJ7A 1SLMA 4IJOA 1KUIA 4JP4A 2DW1A 2AYKA 3WP8A 2Y6DA 3TT4A 1DTHA 4XM7A 1R54A 3TSKA 2QUBA 5CXAA 2SRTA 1JAPA 5I2ZA 3GBOA 4ILWD 1B3DA 2XQHA 3LMCA 4XBHA 3KEJA 2ZJ6A 1XFZA 3F18A 5JMYA 5I4OA 2O36A 1GE7A 1YQYA 4ZR5A 3RTSA 3AYKA 2X7MA 1C7KA 4WZVA 3KMCA 966CA 1BQOA 2YO0A 5D1SA 1MMBA 3K7LA 3LGPA 1UMTA 1SLNA 1ZVXA 3EDHA 1KUHA 3EWJA 3LKAA 1R1JA 1Z3JA 1JIZA 5D2BA 2X3AA 1MMPA 1K7IA 2N8RA 2X3BA 3EDZA 1D8MA 2DDYA 3HY7A 1HOVA 3VTGA 1GXDA 1QICA 5I12A 4PKQA 5LABA 1B8YA 2PJTA 5D3CA 4PKSA 1YP1A 1FM1A 1GO8P 1I73A 2OW1A 2YIGA 1OM7A 1JKYA 1GKCA 3Q2HA 3BA0A 1RM8A 1OS2A 1DMTA 1I1IP 4HMAA 2ML2A 4WKIA 3EHYA 1USNA 2JNPA 2WO9A 1YCMA 3ULTA 4GWMA 4JIJA 3LE9A 1GKDA 3L0TA 2AGMA 1CGLA 3ELMA 1ND1A 4H49A 5L7FA 4H82A 1O0QA 3A6ZA 2OW9A 2D1OA 1G49A 4H84A 3B8ZA 3DNGA 3WV1A 4ON1A 1KUFA 1BQQM 2USNA 1UMSA 3F15A 1OO9A 3HDBA 3HBVP 1HV5A 3F1AA 3MA2A 830CA 2K9CA 1BSWA 1ROSA 2JSDA 1JH1A 1S4BP 5D7WA 2OY2A 1OS9A 2AIGP 4PKUA 2MLSA 1QJIA 1G05A 2J83A 1PWPA 3AYUA 5L79A 1MMQA 4WF6A 2WO8A 1SRPA 1OM8A 4AIGA 3B2ZA 1Y93A 2YB9A 3LA9A 4A7BA 4XCTA 2X3CA 1EUBA 1BUVM 2O3EA 1XFUA 3Q2GA 1HTDA 1JIWP 4FXQA 4GQLA 2A8HA 2POJA 1BKCA 1GO7P 1XFYA 1OMJA 1ASTA 1D5JA 2Z8XA 2ERQA 1CGEA 3F16A 1R1HA 1K7GA 4R3VA 2J0TA 3UVCA 1BM6A 1XFVA 4GWNA 3HY9A 1O0TA 3N2VA 1PWQA 2Y6CA 456CA 4JQGA 2JT6A 1ZXCA 1HFCA 2V4BA 2D1NA 2OVXA 1I76A 3DSLA 1G9KA 3TVCA 4WK7A 1MMRA 3NTNA 1FBLA 3A70A 4AUOA 5CZMA 2W15A 5D1UA 3KHIA 1SMPA 1QJJA 2MZIA 2CKIA 4I03A 1K7QA 3P24A 1KUGA 4DV8A 3O2XA 1CK7A 2OW2A 2K2GA 4XM6A 2RJPA 4GR3A 3L0VA 1QIAA 5B5PA 1CXVA 1L6JA 2W0DA 3HBUP 1C3IA 1KBCA 4HX3A 3HDAP 3N2UA 4QKZA 1UTTA 3LK8A 4J4MA 3F19A 4JA1A 1CGFA 4G9LA 3EDIA 2JIHA 3LIRA 2Z8ZA 1QIBA 4H76A 1JANA 4AYKA 1HFSA 1HY7A 3ZXHA 1XFXA 4XM8A 4FVLA 1AKLA 1PWWA 4L63A 2FV9A 3DPFA 3LUMA 5I3MA 1AF0A 2DW0A 1XUCA 2W14A 1UEAA 3VI1A 1JK3A 1BKCE 1ZTQA 3WV3A 3LJTA 2KRJA
chains in the Genus database with same CATH superfamily
1UTZA 3HYGA 4Q1LA 2QPJA 3E8RA 1YOUA 4DT5A 1PWUA 2RJQA 3DPEA 4L7AA 2CLTA 3LQ0A 4G0DA 1R55A 1FLSA 3SHIA 2EROA 1BUDA 4H1QA 2JT5A 2Z2DA 3LILA 1OM6A 1BZSA 5BOTA 3S6LA 2OXUA 4PKVA 1JJ9A 4H30A 3DWBA 2YO1A 3CKIA 3LJZA 5D1TA 1TVIA 4WKEA 1XFWA 4PKWA 5BOYA 1QUAA 3O64A 1CAQA 4IUWA 3V96B 3OHLA 2WOAA 2L0RA 1IADA 2OW0A 1ATLA 3USNA 1CQRA 4GR8A 1H71P 5CVWA 3K7NA 3ZUKA 1CIZA 1XUDA 4FXYP 3RTTA 1GE6A 2OY4A 2W13A 1IABA 5CXLA 3LEAA 1IAEA 2E3XA 3KEKA 1D8FA 3KMEA 3LJGA 3EHXA 4FU4A 4PKTA 1AYKA 2OXWA 1P9HA 1RMZA 3G42A 2OVZA 3B92A 1EAKA 2XS3A 1SATA 3NX7A 1G12A 3LAAA 1JAQA 5CUHA 3DTEA 2FV5A 3LQBA 4EFSA 3I7GA 4H2EA 4GF1A 2DW2A 4DD8A 2OI0A 4IN9A 2OXZA 3I7IA 4GUYA 3KRYA 1D7XA 1ZS0A 1A85A 2I47A 3WV2A 4A3WA 1KUKA 3TS4A 4DPEA 1Y8JA 5I0LA 1XURA 4I35A 3KWVC 1EB6A 1WNIA 1G4KA 3AIGA 3EDGA 2MLRA 1XAXA 2MZHA 2DDFA 2TCLA 3G5CA 3OHOA 4H3XA 2W12A 1JAOA 3ZVSA 4AXQA 1Q3AA 4CTHA 2XS4A 3DL1A 2ERPA 1ZXVA 1IACA 1IAGA 2ZVDA 4GR0A 1BIWA 2OZRA 3HB2P 1PWVA 3LIKA 3P1VA 2MZEA 4L19A 4DF9A 3F17A 2E2DA 1A86A 4L6TA 3U1RA 2HU6A 5BPAA 1C8TA 1ZP5A 1SU3A 1R1IA 5B5OA 1KAPP 4PKRA 1J7NA 3LUNA 4JPAA 1IAAA 3KECA 2QUAA 5H8XA 1Y0VA 1MNCA 1GE5A 1BKCI 5I43A 2ZJ7A 1SLMA 4IJOA 1KUIA 4JP4A 2DW1A 2AYKA 3WP8A 2Y6DA 3TT4A 1DTHA 4XM7A 1R54A 3TSKA 2QUBA 5CXAA 2SRTA 1JAPA 5I2ZA 3GBOA 4ILWD 1B3DA 2XQHA 3LMCA 4XBHA 3KEJA 2ZJ6A 1XFZA 3F18A 5JMYA 5I4OA 2O36A 1GE7A 1YQYA 4ZR5A 3RTSA 3AYKA 2X7MA 1C7KA 4WZVA 3KMCA 966CA 1BQOA 2YO0A 5D1SA 1MMBA 3K7LA 3LGPA 1UMTA 1SLNA 1ZVXA 3EDHA 1KUHA 3EWJA 3LKAA 1R1JA 1Z3JA 1JIZA 5D2BA 2X3AA 1MMPA 1K7IA 2N8RA 2X3BA 3EDZA 1D8MA 2DDYA 3HY7A 1HOVA 3VTGA 1GXDA 1QICA 5I12A 4PKQA 5LABA 1B8YA 2PJTA 5D3CA 4PKSA 1YP1A 1FM1A 1GO8P 1I73A 3DTKA 2OW1A 2YIGA 1OM7A 1JKYA 1GKCA 3Q2HA 3BA0A 1RM8A 1OS2A 1DMTA 1I1IP 4HMAA 2ML2A 4WKIA 3EHYA 1USNA 2JNPA 2WO9A 1YCMA 3ULTA 4GWMA 4JIJA 3LE9A 1GKDA 3L0TA 2AGMA 1CGLA 3ELMA 1ND1A 4H49A 5L7FA 4H82A 1O0QA 3A6ZA 2OW9A 2D1OA 1G49A 4H84A 3B8ZA 3DNGA 3WV1A 4ON1A 1KUFA 1BQQM 2USNA 1UMSA 3F15A 1OO9A 3HDBA 3HBVP 1HV5A 3F1AA 3MA2A 830CA 2K9CA 1BSWA 1ROSA 2JSDA 1JH1A 1S4BP 5D7WA 2OY2A 1OS9A 2AIGP 4PKUA 3DTIA 2MLSA 1QJIA 1G05A 2J83A 1PWPA 3AYUA 2YUFA 5L79A 1MMQA 4WF6A 2WO8A 1SRPA 1OM8A 4AIGA 3B2ZA 1Y93A 2YB9A 3LA9A 4A7BA 4XCTA 2X3CA 1EUBA 1BUVM 2O3EA 1XFUA 3Q2GA 1HTDA 1JIWP 4FXQA 4GQLA 2A8HA 2POJA 1BKCA 1GO7P 1XFYA 1OMJA 1ASTA 1XM5A 1D5JA 2Z8XA 2ERQA 1CGEA 3F16A 1R1HA 1K7GA 1OZ9A 4R3VA 2J0TA 3UVCA 1BM6A 1XFVA 4GWNA 3HY9A 1O0TA 3N2VA 1PWQA 2Y6CA 456CA 4JQGA 2JT6A 1ZXCA 1HFCA 2V4BA 2D1NA 2OVXA 1I76A 3DSLA 1G9KA 3TVCA 4WK7A 1MMRA 3NTNA 1FBLA 3A70A 4AUOA 5CZMA 2W15A 5D1UA 3KHIA 1SMPA 1QJJA 2MZIA 2CKIA 4I03A 1K7QA 3P24A 1KUGA 4DV8A 3O2XA 1CK7A 2OW2A 2K2GA 4XM6A 2RJPA 4GR3A 3L0VA 1QIAA 5B5PA 1CXVA 1L6JA 2W0DA 3HBUP 1C3IA 1KBCA 4HX3A 3HDAP 3N2UA 4QKZA 1UTTA 3LK8A 4J4MA 3F19A 4JA1A 1CGFA 4G9LA 3EDIA 2JIHA 3LIRA 2Z8ZA 1QIBA 4H76A 1JANA 4AYKA 1HFSA 1HY7A 3ZXHA 1XFXA 4XM8A 4FVLA 1AKLA 1PWWA 4L63A 2FV9A 3DPFA 3LUMA 5I3MA 1AF0A 2DW0A 1XUCA 2W14A 1UEAA 3VI1A 1JK3A 1BKCE 1ZTQA 3WV3A 3LJTA 2KRJA
chains in the Genus database with same CATH topology
1UTZA 3HYGA 4Q1LA 2QPJA 3E8RA 1YOUA 1PWUA 2RJQA 3DPEA 4L7AA 2CLTA 3LQ0A 4G0DA 1R55A 1FLSA 3SHIA 2EROA 1BUDA 4H1QA 2JT5A 2Z2DA 3LILA 1OM6A 1BZSA 5BOTA 3S6LA 2OXUA 4PKVA 1JJ9A 4H30A 3DWBA 2YO1A 3CKIA 3LJZA 5D1TA 4WKEA 1XFWA 4PKWA 5BOYA 1QUAA 3O64A 1CAQA 4IUWA 3V96B 3OHLA 2WOAA 2L0RA 1IADA 2OW0A 1ATLA 3USNA 1CQRA 4GR8A 1H71P 5CVWA 3K7NA 3ZUKA 1CIZA 1XUDA 4FXYP 3RTTA 1GE6A 2OY4A 2W13A 1IABA 5CXLA 3LEAA 1IAEA 2E3XA 3KEKA 1D8FA 3KMEA 3LJGA 3EHXA 4FU4A 4PKTA 1AYKA 2OXWA 1P9HA 1RMZA 3G42A 2OVZA 3B92A 1EAKA 2XS3A 1SATA 3NX7A 1G12A 3LAAA 1JAQA 5CUHA 3DTEA 2FV5A 3LQBA 4EFSA 3I7GA 4H2EA 4GF1A 2DW2A 4DD8A 2OI0A 4IN9A 2OXZA 3I7IA 4GUYA 3KRYA 1D7XA 1ZS0A 1A85A 2I47A 3WV2A 4A3WA 1KUKA 3TS4A 4DPEA 1Y8JA 5I0LA 1XURA 4I35A 3KWVC 1EB6A 1WNIA 1G4KA 3AIGA 3EDGA 2MLRA 2MZHA 2DDFA 2TCLA 3G5CA 3OHOA 4H3XA 2W12A 1JAOA 3ZVSA 4AXQA 1Q3AA 4CTHA 2XS4A 3DL1A 2ERPA 1ZXVA 1IACA 1IAGA 2ZVDA 4GR0A 1BIWA 2OZRA 3HB2P 1PWVA 3LIKA 3P1VA 2MZEA 4L19A 4DF9A 3F17A 2E2DA 1A86A 4L6TA 3U1RA 2HU6A 5BPAA 1C8TA 1ZP5A 1SU3A 1R1IA 5B5OA 1KAPP 4PKRA 1J7NA 3LUNA 4JPAA 1IAAA 3KECA 2QUAA 5H8XA 1Y0VA 1MNCA 1GE5A 1BKCI 5I43A 2ZJ7A 1SLMA 4IJOA 1KUIA 4JP4A 2DW1A 2AYKA 3WP8A 2Y6DA 3TT4A 1DTHA 4XM7A 1R54A 3TSKA 2QUBA 5CXAA 2SRTA 1JAPA 5I2ZA 3GBOA 4ILWD 1B3DA 2XQHA 3LMCA 4XBHA 3KEJA 2ZJ6A 1XFZA 3F18A 5JMYA 5I4OA 2O36A 1GE7A 1YQYA 4ZR5A 3RTSA 3AYKA 2X7MA 1C7KA 4WZVA 3KMCA 966CA 1BQOA 2YO0A 5D1SA 1MMBA 3K7LA 3LGPA 1UMTA 1SLNA 1ZVXA 3EDHA 1KUHA 3EWJA 3LKAA 1R1JA 1Z3JA 1JIZA 5D2BA 2X3AA 1MMPA 1K7IA 2N8RA 2X3BA 3EDZA 1D8MA 2DDYA 3HY7A 1HOVA 3VTGA 1GXDA 1QICA 5I12A 4PKQA 5LABA 1B8YA 2PJTA 5D3CA 4PKSA 1YP1A 1FM1A 1GO8P 1I73A 3DTKA 2OW1A 2YIGA 1OM7A 1JKYA 1GKCA 3Q2HA 3BA0A 1RM8A 1OS2A 1DMTA 1I1IP 4HMAA 2ML2A 4WKIA 3EHYA 1USNA 2JNPA 2WO9A 1YCMA 3ULTA 4GWMA 4JIJA 3LE9A 1GKDA 3L0TA 2AGMA 1CGLA 3ELMA 1ND1A 4H49A 5L7FA 4H82A 1O0QA 3A6ZA 2OW9A 2D1OA 1G49A 4H84A 3B8ZA 3DNGA 3WV1A 4ON1A 1KUFA 1BQQM 2USNA 1UMSA 3F15A 1OO9A 3HDBA 3HBVP 1HV5A 3F1AA 3MA2A 830CA 2K9CA 1BSWA 1ROSA 2JSDA 1JH1A 1S4BP 5D7WA 2OY2A 1OS9A 2AIGP 4PKUA 3DTIA 2MLSA 1QJIA 1G05A 2J83A 1PWPA 3AYUA 2YUFA 5L79A 1MMQA 4WF6A 2WO8A 1SRPA 1OM8A 4AIGA 3B2ZA 1Y93A 2YB9A 3LA9A 4A7BA 4XCTA 2X3CA 1EUBA 1BUVM 2O3EA 1XFUA 3Q2GA 1HTDA 1JIWP 4FXQA 4GQLA 2A8HA 2POJA 1BKCA 1GO7P 1XFYA 1OMJA 1ASTA 1D5JA 2Z8XA 2ERQA 1CGEA 3F16A 1R1HA 1K7GA 4R3VA 2J0TA 3UVCA 1BM6A 1XFVA 4GWNA 3HY9A 1O0TA 3N2VA 1PWQA 2Y6CA 456CA 4JQGA 2JT6A 1ZXCA 1HFCA 2V4BA 2D1NA 2OVXA 1I76A 3DSLA 1G9KA 3TVCA 4WK7A 1MMRA 3NTNA 1FBLA 3A70A 4AUOA 5CZMA 2W15A 5D1UA 3KHIA 1SMPA 1QJJA 2MZIA 2CKIA 4I03A 1K7QA 3P24A 1KUGA 4DV8A 3O2XA 1CK7A 2OW2A 2K2GA 4XM6A 2RJPA 4GR3A 3L0VA 1QIAA 5B5PA 1CXVA 1L6JA 2W0DA 3HBUP 1C3IA 1KBCA 4HX3A 3HDAP 3N2UA 4QKZA 1UTTA 3LK8A 4J4MA 3F19A 4JA1A 1CGFA 4G9LA 3EDIA 2JIHA 3LIRA 2Z8ZA 1QIBA 4H76A 1JANA 4AYKA 1HFSA 1HY7A 3ZXHA 1XFXA 4XM8A 4FVLA 1AKLA 1PWWA 4L63A 2FV9A 3DPFA 3LUMA 5I3MA 1AF0A 2DW0A 1XUCA 2W14A 1UEAA 3VI1A 1JK3A 1BKCE 1ZTQA 3WV3A 3LJTA 2KRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UTZ A;  3HYG A;  4Q1L A;  2QPJ A;  3E8R A;  1YOU A;  1PWU A;  2RJQ A;  3DPE A;  2CLT A;  3LQ0 A;  4G0D A;  1R55 A;  1FLS A;  3SHI A;  2ERO A;  1BUD A;  4H1Q A;  2JT5 A;  2Z2D A;  3LIL A;  1OM6 A;  1BZS A;  5BOT A;  3S6L A;  2OXU A;  4PKV A;  1JJ9 A;  4H30 A;  3DWB A;  2YO1 A;  3CKI A;  3LJZ A;  5D1T A;  4WKE A;  1XFW A;  4PKW A;  5BOY A;  1QUA A;  3O64 A;  1CAQ A;  4IUW A;  3V96 B;  3OHL A;  2WOA A;  2L0R A;  1IAD A;  2OW0 A;  1ATL A;  3USN A;  1CQR A;  4GR8 A;  1H71 P;  5CVW A;  3K7N A;  3ZUK A;  1CIZ A;  1XUD A;  4FXY P;  3RTT A;  1GE6 A;  2OY4 A;  2W13 A;  1IAB A;  5CXL A;  3LEA A;  1IAE A;  2E3X A;  3KEK A;  1D8F A;  3KME A;  3LJG A;  3EHX A;  4FU4 A;  4PKT A;  1AYK A;  2OXW A;  1P9H A;  1RMZ A;  3G42 A;  2OVZ A;  3B92 A;  1EAK A;  2XS3 A;  1SAT A;  3NX7 A;  1G12 A;  3LAA A;  1JAQ A;  5CUH A;  2FV5 A;  3LQB A;  4EFS A;  3I7G A;  4H2E A;  4GF1 A;  2DW2 A;  4DD8 A;  2OI0 A;  4IN9 A;  2OXZ A;  3I7I A;  4GUY A;  3KRY A;  1D7X A;  1ZS0 A;  1A85 A;  2I47 A;  3WV2 A;  4A3W A;  1KUK A;  3TS4 A;  4DPE A;  1Y8J A;  5I0L A;  1XUR A;  4I35 A;  3KWV C;  1EB6 A;  1WNI A;  1G4K A;  3AIG A;  3EDG A;  2MLR A;  2MZH A;  2DDF A;  2TCL A;  3G5C A;  3OHO A;  4H3X A;  2W12 A;  1JAO A;  3ZVS A;  4AXQ A;  1Q3A A;  4CTH A;  2XS4 A;  3DL1 A;  2ERP A;  1ZXV A;  1IAC A;  1IAG A;  2ZVD A;  4GR0 A;  1BIW A;  2OZR A;  3HB2 P;  1PWV A;  3LIK A;  3P1V A;  2MZE A;  4L19 A;  4DF9 A;  3F17 A;  2E2D A;  1A86 A;  4L6T A;  3U1R A;  2HU6 A;  5BPA A;  1C8T A;  1ZP5 A;  1SU3 A;  1R1I A;  5B5O A;  1KAP P;  4PKR A;  1J7N A;  3LUN A;  4JPA A;  1IAA A;  3KEC A;  2QUA A;  5H8X A;  1Y0V A;  1MNC A;  1GE5 A;  1BKC I;  5I43 A;  2ZJ7 A;  1SLM A;  4IJO A;  1KUI A;  4JP4 A;  2DW1 A;  2AYK A;  3WP8 A;  2Y6D A;  3TT4 A;  1DTH A;  4XM7 A;  1R54 A;  3TSK A;  2QUB A;  5CXA A;  2SRT A;  1JAP A;  5I2Z A;  3GBO A;  4ILW D;  1B3D A;  2XQH A;  3LMC A;  4XBH A;  3KEJ A;  2ZJ6 A;  1XFZ A;  3F18 A;  5JMY A;  5I4O A;  2O36 A;  1GE7 A;  1YQY A;  4ZR5 A;  3RTS A;  3AYK A;  2X7M A;  1C7K A;  4WZV A;  3KMC A;  966C A;  1BQO A;  2YO0 A;  5D1S A;  1MMB A;  3K7L A;  3LGP A;  1UMT A;  1SLN A;  1ZVX A;  3EDH A;  1KUH A;  3EWJ A;  3LKA A;  1R1J A;  1Z3J A;  1JIZ A;  5D2B A;  2X3A A;  1MMP A;  1K7I A;  2N8R A;  2X3B A;  3EDZ A;  1D8M A;  2DDY A;  3HY7 A;  1HOV A;  3VTG A;  1GXD A;  1QIC A;  5I12 A;  4PKQ A;  5LAB A;  1B8Y A;  2PJT A;  5D3C A;  4PKS A;  1YP1 A;  1FM1 A;  1GO8 P;  1I73 A;  2OW1 A;  2YIG A;  1OM7 A;  1JKY A;  1GKC A;  3Q2H A;  3BA0 A;  1RM8 A;  1OS2 A;  1DMT A;  1I1I P;  4HMA A;  2ML2 A;  4WKI A;  3EHY A;  1USN A;  2JNP A;  2WO9 A;  1YCM A;  3ULT A;  4GWM A;  4JIJ A;  3LE9 A;  1GKD A;  3L0T A;  2AGM A;  1CGL A;  3ELM A;  1ND1 A;  4H49 A;  5L7F A;  4H82 A;  1O0Q A;  3A6Z A;  2OW9 A;  2D1O A;  1G49 A;  4H84 A;  3B8Z A;  3DNG A;  3WV1 A;  4ON1 A;  1KUF A;  1BQQ M;  2USN A;  1UMS A;  3F15 A;  1OO9 A;  3HDB A;  3HBV P;  1HV5 A;  3F1A A;  3MA2 A;  830C A;  2K9C A;  1BSW A;  1ROS A;  2JSD A;  1JH1 A;  1S4B P;  5D7W A;  2OY2 A;  1OS9 A;  2AIG P;  4PKU A;  2MLS A;  1QJI A;  1G05 A;  2J83 A;  1PWP A;  3AYU A;  5L79 A;  1MMQ A;  4WF6 A;  2WO8 A;  1SRP A;  1OM8 A;  4AIG A;  3B2Z A;  1Y93 A;  2YB9 A;  3LA9 A;  4A7B A;  4XCT A;  2X3C A;  1EUB A;  1BUV M;  2O3E A;  1XFU A;  3Q2G A;  1HTD A;  1JIW P;  4FXQ A;  4GQL A;  2A8H A;  2POJ A;  1BKC A;  1GO7 P;  1XFY A;  1OMJ A;  1AST A;  1D5J A;  2Z8X A;  2ERQ A;  1CGE A;  3F16 A;  1R1H A;  1K7G A;  4R3V A;  2J0T A;  3UVC A;  1BM6 A;  1XFV A;  4GWN A;  3HY9 A;  1O0T A;  3N2V A;  1PWQ A;  2Y6C A;  456C A;  4JQG A;  2JT6 A;  1ZXC A;  1HFC A;  2V4B A;  2D1N A;  2OVX A;  1I76 A;  3DSL A;  1G9K A;  3TVC A;  4WK7 A;  1MMR A;  3NTN A;  1FBL A;  3A70 A;  4AUO A;  5CZM A;  2W15 A;  5D1U A;  3KHI A;  1SMP A;  1QJJ A;  2MZI A;  2CKI A;  4I03 A;  1K7Q A;  3P24 A;  1KUG A;  4DV8 A;  3O2X A;  1CK7 A;  2OW2 A;  2K2G A;  4XM6 A;  2RJP A;  4GR3 A;  3L0V A;  1QIA A;  5B5P A;  1CXV A;  1L6J A;  2W0D A;  3HBU P;  1C3I A;  1KBC A;  4HX3 A;  3HDA P;  3N2U A;  4QKZ A;  1UTT A;  3LK8 A;  4J4M A;  3F19 A;  4JA1 A;  1CGF A;  4G9L A;  3EDI A;  2JIH A;  3LIR A;  2Z8Z A;  1QIB A;  4H76 A;  1JAN A;  4AYK A;  1HFS A;  1HY7 A;  3ZXH A;  1XFX A;  4XM8 A;  4FVL A;  1AKL A;  1PWW A;  4L63 A;  2FV9 A;  3DPF A;  3LUM A;  5I3M A;  1AF0 A;  2DW0 A;  1XUC A;  2W14 A;  1UEA A;  3VI1 A;  1JK3 A;  1BKC E;  1ZTQ A;  3WV3 A;  3LJT A;  2KRJ A; 
#chains in the Genus database with same CATH topology
 1UTZ A;  3HYG A;  4Q1L A;  2QPJ A;  3E8R A;  1YOU A;  4DT5 A;  1PWU A;  2RJQ A;  3DPE A;  4L7A A;  2CLT A;  3LQ0 A;  4G0D A;  1R55 A;  1FLS A;  3SHI A;  2ERO A;  1BUD A;  4H1Q A;  2JT5 A;  2Z2D A;  3LIL A;  1OM6 A;  1BZS A;  5BOT A;  3S6L A;  2OXU A;  4PKV A;  1JJ9 A;  4H30 A;  3DWB A;  2YO1 A;  3CKI A;  3LJZ A;  5D1T A;  1TVI A;  4WKE A;  1XFW A;  4PKW A;  5BOY A;  1QUA A;  3O64 A;  1CAQ A;  4IUW A;  3V96 B;  3OHL A;  2WOA A;  2L0R A;  1IAD A;  2OW0 A;  1ATL A;  3USN A;  1CQR A;  4GR8 A;  1H71 P;  5CVW A;  3K7N A;  3ZUK A;  1CIZ A;  1XUD A;  4FXY P;  3RTT A;  1GE6 A;  2OY4 A;  2W13 A;  1IAB A;  5CXL A;  3LEA A;  1IAE A;  2E3X A;  3KEK A;  1D8F A;  3KME A;  3LJG A;  3EHX A;  4FU4 A;  4PKT A;  1AYK A;  2OXW A;  1P9H A;  1RMZ A;  3G42 A;  2OVZ A;  3B92 A;  1EAK A;  2XS3 A;  1SAT A;  3NX7 A;  1G12 A;  3LAA A;  1JAQ A;  5CUH A;  3DTE A;  2FV5 A;  3LQB A;  4EFS A;  3I7G A;  4H2E A;  4GF1 A;  2DW2 A;  4DD8 A;  2OI0 A;  4IN9 A;  2OXZ A;  3I7I A;  4GUY A;  3KRY A;  1D7X A;  1ZS0 A;  1A85 A;  2I47 A;  3WV2 A;  4A3W A;  1KUK A;  3TS4 A;  4DPE A;  1Y8J A;  5I0L A;  1XUR A;  4I35 A;  3KWV C;  1EB6 A;  1WNI A;  1G4K A;  3AIG A;  3EDG A;  2MLR A;  1XAX A;  2MZH A;  2DDF A;  2TCL A;  3G5C A;  3OHO A;  4H3X A;  2W12 A;  1JAO A;  3ZVS A;  4AXQ A;  1Q3A A;  4CTH A;  2XS4 A;  3DL1 A;  2ERP A;  1ZXV A;  1IAC A;  1IAG A;  2ZVD A;  4GR0 A;  1BIW A;  2OZR A;  3HB2 P;  1PWV A;  3LIK A;  3P1V A;  2MZE A;  4L19 A;  4DF9 A;  3F17 A;  2E2D A;  1A86 A;  4L6T A;  3U1R A;  2HU6 A;  5BPA A;  1C8T A;  1ZP5 A;  1SU3 A;  1R1I A;  5B5O A;  1KAP P;  4PKR A;  1J7N A;  3LUN A;  4JPA A;  1IAA A;  3KEC A;  2QUA A;  5H8X A;  1Y0V A;  1MNC A;  1GE5 A;  1BKC I;  5I43 A;  2ZJ7 A;  1SLM A;  4IJO A;  1KUI A;  4JP4 A;  2DW1 A;  2AYK A;  3WP8 A;  2Y6D A;  3TT4 A;  1DTH A;  4XM7 A;  1R54 A;  3TSK A;  2QUB A;  5CXA A;  2SRT A;  1JAP A;  5I2Z A;  3GBO A;  4ILW D;  1B3D A;  2XQH A;  3LMC A;  4XBH A;  3KEJ A;  2ZJ6 A;  1XFZ A;  3F18 A;  5JMY A;  5I4O A;  2O36 A;  1GE7 A;  1YQY A;  4ZR5 A;  3RTS A;  3AYK A;  2X7M A;  1C7K A;  4WZV A;  3KMC A;  966C A;  1BQO A;  2YO0 A;  5D1S A;  1MMB A;  3K7L A;  3LGP A;  1UMT A;  1SLN A;  1ZVX A;  3EDH A;  1KUH A;  3EWJ A;  3LKA A;  1R1J A;  1Z3J A;  1JIZ A;  5D2B A;  2X3A A;  1MMP A;  1K7I A;  2N8R A;  2X3B A;  3EDZ A;  1D8M A;  2DDY A;  3HY7 A;  1HOV A;  3VTG A;  1GXD A;  1QIC A;  5I12 A;  4PKQ A;  5LAB A;  1B8Y A;  2PJT A;  5D3C A;  4PKS A;  1YP1 A;  1FM1 A;  1GO8 P;  1I73 A;  3DTK A;  2OW1 A;  2YIG A;  1OM7 A;  1JKY A;  1GKC A;  3Q2H A;  3BA0 A;  1RM8 A;  1OS2 A;  1DMT A;  1I1I P;  4HMA A;  2ML2 A;  4WKI A;  3EHY A;  1USN A;  2JNP A;  2WO9 A;  1YCM A;  3ULT A;  4GWM A;  4JIJ A;  3LE9 A;  1GKD A;  3L0T A;  2AGM A;  1CGL A;  3ELM A;  1ND1 A;  4H49 A;  5L7F A;  4H82 A;  1O0Q A;  3A6Z A;  2OW9 A;  2D1O A;  1G49 A;  4H84 A;  3B8Z A;  3DNG A;  3WV1 A;  4ON1 A;  1KUF A;  1BQQ M;  2USN A;  1UMS A;  3F15 A;  1OO9 A;  3HDB A;  3HBV P;  1HV5 A;  3F1A A;  3MA2 A;  830C A;  2K9C A;  1BSW A;  1ROS A;  2JSD A;  1JH1 A;  1S4B P;  5D7W A;  2OY2 A;  1OS9 A;  2AIG P;  4PKU A;  3DTI A;  2MLS A;  1QJI A;  1G05 A;  2J83 A;  1PWP A;  3AYU A;  2YUF A;  5L79 A;  1MMQ A;  4WF6 A;  2WO8 A;  1SRP A;  1OM8 A;  4AIG A;  3B2Z A;  1Y93 A;  2YB9 A;  3LA9 A;  4A7B A;  4XCT A;  2X3C A;  1EUB A;  1BUV M;  2O3E A;  1XFU A;  3Q2G A;  1HTD A;  1JIW P;  4FXQ A;  4GQL A;  2A8H A;  2POJ A;  1BKC A;  1GO7 P;  1XFY A;  1OMJ A;  1AST A;  1XM5 A;  1D5J A;  2Z8X A;  2ERQ A;  1CGE A;  3F16 A;  1R1H A;  1K7G A;  1OZ9 A;  4R3V A;  2J0T A;  3UVC A;  1BM6 A;  1XFV A;  4GWN A;  3HY9 A;  1O0T A;  3N2V A;  1PWQ A;  2Y6C A;  456C A;  4JQG A;  2JT6 A;  1ZXC A;  1HFC A;  2V4B A;  2D1N A;  2OVX A;  1I76 A;  3DSL A;  1G9K A;  3TVC A;  4WK7 A;  1MMR A;  3NTN A;  1FBL A;  3A70 A;  4AUO A;  5CZM A;  2W15 A;  5D1U A;  3KHI A;  1SMP A;  1QJJ A;  2MZI A;  2CKI A;  4I03 A;  1K7Q A;  3P24 A;  1KUG A;  4DV8 A;  3O2X A;  1CK7 A;  2OW2 A;  2K2G A;  4XM6 A;  2RJP A;  4GR3 A;  3L0V A;  1QIA A;  5B5P A;  1CXV A;  1L6J A;  2W0D A;  3HBU P;  1C3I A;  1KBC A;  4HX3 A;  3HDA P;  3N2U A;  4QKZ A;  1UTT A;  3LK8 A;  4J4M A;  3F19 A;  4JA1 A;  1CGF A;  4G9L A;  3EDI A;  2JIH A;  3LIR A;  2Z8Z A;  1QIB A;  4H76 A;  1JAN A;  4AYK A;  1HFS A;  1HY7 A;  3ZXH A;  1XFX A;  4XM8 A;  4FVL A;  1AKL A;  1PWW A;  4L63 A;  2FV9 A;  3DPF A;  3LUM A;  5I3M A;  1AF0 A;  2DW0 A;  1XUC A;  2W14 A;  1UEA A;  3VI1 A;  1JK3 A;  1BKC E;  1ZTQ A;  3WV3 A;  3LJT A;  2KRJ A; 
#chains in the Genus database with same CATH homology
 1UTZ A;  3HYG A;  4Q1L A;  2QPJ A;  3E8R A;  1YOU A;  1PWU A;  2RJQ A;  3DPE A;  4L7A A;  2CLT A;  3LQ0 A;  4G0D A;  1R55 A;  1FLS A;  3SHI A;  2ERO A;  1BUD A;  4H1Q A;  2JT5 A;  2Z2D A;  3LIL A;  1OM6 A;  1BZS A;  5BOT A;  3S6L A;  2OXU A;  4PKV A;  1JJ9 A;  4H30 A;  3DWB A;  2YO1 A;  3CKI A;  3LJZ A;  5D1T A;  4WKE A;  1XFW A;  4PKW A;  5BOY A;  1QUA A;  3O64 A;  1CAQ A;  4IUW A;  3V96 B;  3OHL A;  2WOA A;  2L0R A;  1IAD A;  2OW0 A;  1ATL A;  3USN A;  1CQR A;  4GR8 A;  1H71 P;  5CVW A;  3K7N A;  3ZUK A;  1CIZ A;  1XUD A;  4FXY P;  3RTT A;  1GE6 A;  2OY4 A;  2W13 A;  1IAB A;  5CXL A;  3LEA A;  1IAE A;  2E3X A;  3KEK A;  1D8F A;  3KME A;  3LJG A;  3EHX A;  4FU4 A;  4PKT A;  1AYK A;  2OXW A;  1P9H A;  1RMZ A;  3G42 A;  2OVZ A;  3B92 A;  1EAK A;  2XS3 A;  1SAT A;  3NX7 A;  1G12 A;  3LAA A;  1JAQ A;  5CUH A;  3DTE A;  2FV5 A;  3LQB A;  4EFS A;  3I7G A;  4H2E A;  4GF1 A;  2DW2 A;  4DD8 A;  2OI0 A;  4IN9 A;  2OXZ A;  3I7I A;  4GUY A;  3KRY A;  1D7X A;  1ZS0 A;  1A85 A;  2I47 A;  3WV2 A;  4A3W A;  1KUK A;  3TS4 A;  4DPE A;  1Y8J A;  5I0L A;  1XUR A;  4I35 A;  3KWV C;  1EB6 A;  1WNI A;  1G4K A;  3AIG A;  3EDG A;  2MLR A;  2MZH A;  2DDF A;  2TCL A;  3G5C A;  3OHO A;  4H3X A;  2W12 A;  1JAO A;  3ZVS A;  4AXQ A;  1Q3A A;  4CTH A;  2XS4 A;  3DL1 A;  2ERP A;  1ZXV A;  1IAC A;  1IAG A;  2ZVD A;  4GR0 A;  1BIW A;  2OZR A;  3HB2 P;  1PWV A;  3LIK A;  3P1V A;  2MZE A;  4L19 A;  4DF9 A;  3F17 A;  2E2D A;  1A86 A;  4L6T A;  3U1R A;  2HU6 A;  5BPA A;  1C8T A;  1ZP5 A;  1SU3 A;  1R1I A;  5B5O A;  1KAP P;  4PKR A;  1J7N A;  3LUN A;  4JPA A;  1IAA A;  3KEC A;  2QUA A;  5H8X A;  1Y0V A;  1MNC A;  1GE5 A;  1BKC I;  5I43 A;  2ZJ7 A;  1SLM A;  4IJO A;  1KUI A;  4JP4 A;  2DW1 A;  2AYK A;  3WP8 A;  2Y6D A;  3TT4 A;  1DTH A;  4XM7 A;  1R54 A;  3TSK A;  2QUB A;  5CXA A;  2SRT A;  1JAP A;  5I2Z A;  3GBO A;  4ILW D;  1B3D A;  2XQH A;  3LMC A;  4XBH A;  3KEJ A;  2ZJ6 A;  1XFZ A;  3F18 A;  5JMY A;  5I4O A;  2O36 A;  1GE7 A;  1YQY A;  4ZR5 A;  3RTS A;  3AYK A;  2X7M A;  1C7K A;  4WZV A;  3KMC A;  966C A;  1BQO A;  2YO0 A;  5D1S A;  1MMB A;  3K7L A;  3LGP A;  1UMT A;  1SLN A;  1ZVX A;  3EDH A;  1KUH A;  3EWJ A;  3LKA A;  1R1J A;  1Z3J A;  1JIZ A;  5D2B A;  2X3A A;  1MMP A;  1K7I A;  2N8R A;  2X3B A;  3EDZ A;  1D8M A;  2DDY A;  3HY7 A;  1HOV A;  3VTG A;  1GXD A;  1QIC A;  5I12 A;  4PKQ A;  5LAB A;  1B8Y A;  2PJT A;  5D3C A;  4PKS A;  1YP1 A;  1FM1 A;  1GO8 P;  1I73 A;  3DTK A;  2OW1 A;  2YIG A;  1OM7 A;  1JKY A;  1GKC A;  3Q2H A;  3BA0 A;  1RM8 A;  1OS2 A;  1DMT A;  1I1I P;  4HMA A;  2ML2 A;  4WKI A;  3EHY A;  1USN A;  2JNP A;  2WO9 A;  1YCM A;  3ULT A;  4GWM A;  4JIJ A;  3LE9 A;  1GKD A;  3L0T A;  2AGM A;  1CGL A;  3ELM A;  1ND1 A;  4H49 A;  5L7F A;  4H82 A;  1O0Q A;  3A6Z A;  2OW9 A;  2D1O A;  1G49 A;  4H84 A;  3B8Z A;  3DNG A;  3WV1 A;  4ON1 A;  1KUF A;  1BQQ M;  2USN A;  1UMS A;  3F15 A;  1OO9 A;  3HDB A;  3HBV P;  1HV5 A;  3F1A A;  3MA2 A;  830C A;  2K9C A;  1BSW A;  1ROS A;  2JSD A;  1JH1 A;  1S4B P;  5D7W A;  2OY2 A;  1OS9 A;  2AIG P;  4PKU A;  3DTI A;  2MLS A;  1QJI A;  1G05 A;  2J83 A;  1PWP A;  3AYU A;  2YUF A;  5L79 A;  1MMQ A;  4WF6 A;  2WO8 A;  1SRP A;  1OM8 A;  4AIG A;  3B2Z A;  1Y93 A;  2YB9 A;  3LA9 A;  4A7B A;  4XCT A;  2X3C A;  1EUB A;  1BUV M;  2O3E A;  1XFU A;  3Q2G A;  1HTD A;  1JIW P;  4FXQ A;  4GQL A;  2A8H A;  2POJ A;  1BKC A;  1GO7 P;  1XFY A;  1OMJ A;  1AST A;  1D5J A;  2Z8X A;  2ERQ A;  1CGE A;  3F16 A;  1R1H A;  1K7G A;  4R3V A;  2J0T A;  3UVC A;  1BM6 A;  1XFV A;  4GWN A;  3HY9 A;  1O0T A;  3N2V A;  1PWQ A;  2Y6C A;  456C A;  4JQG A;  2JT6 A;  1ZXC A;  1HFC A;  2V4B A;  2D1N A;  2OVX A;  1I76 A;  3DSL A;  1G9K A;  3TVC A;  4WK7 A;  1MMR A;  3NTN A;  1FBL A;  3A70 A;  4AUO A;  5CZM A;  2W15 A;  5D1U A;  3KHI A;  1SMP A;  1QJJ A;  2MZI A;  2CKI A;  4I03 A;  1K7Q A;  3P24 A;  1KUG A;  4DV8 A;  3O2X A;  1CK7 A;  2OW2 A;  2K2G A;  4XM6 A;  2RJP A;  4GR3 A;  3L0V A;  1QIA A;  5B5P A;  1CXV A;  1L6J A;  2W0D A;  3HBU P;  1C3I A;  1KBC A;  4HX3 A;  3HDA P;  3N2U A;  4QKZ A;  1UTT A;  3LK8 A;  4J4M A;  3F19 A;  4JA1 A;  1CGF A;  4G9L A;  3EDI A;  2JIH A;  3LIR A;  2Z8Z A;  1QIB A;  4H76 A;  1JAN A;  4AYK A;  1HFS A;  1HY7 A;  3ZXH A;  1XFX A;  4XM8 A;  4FVL A;  1AKL A;  1PWW A;  4L63 A;  2FV9 A;  3DPF A;  3LUM A;  5I3M A;  1AF0 A;  2DW0 A;  1XUC A;  2W14 A;  1UEA A;  3VI1 A;  1JK3 A;  1BKC E;  1ZTQ A;  3WV3 A;  3LJT A;  2KRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...