1K7IA

Prtc from erwinia chrysanthemi: y228f mutant
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
462
structure length
462
Chain Sequence
ANTSSAYNSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPGSEEYGRQTFTHEIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSIMSFWGENETGADYNGHYGGAPMIDDIAAIQRLYGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHGVTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLSAFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDIIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords secreted protease C
publication title Protease C of Erwinia chrysanthemi: The Crystal Structure and Role of Amino Acids Y228 and E189
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 153
structure length 462
sequence length 462
ec nomenclature ec 3.4.24.40: Serralysin.
pdb deposition date 2001-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
A PF00413 Peptidase_M10 Matrixin
A PF08548 Peptidase_M10_C Peptidase M10 serralysin C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 1k7iA01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1k7iA02
1C7KA 2RJQA 1JANA 2AYKA 2X3BA 1BUDA 2OXZA 2YB9A 456CA 3F15A 1JAPA 5I4OA 2QUAA 1CQRA 2DDYA 1G49A 1GO7P 1GE6A 1YCMA 4GUYA 4PKVA 3B8ZA 1OM7A 2JT6A 2E2DA 4GF1A 4IN9A 1KUIA 1I73A 2Y6CA 2W0DA 5BPAA 3DNGA 1O0TA 1ZXCA 1GO8P 2A8HA 1JAOA 1P9HA 4JA1A 1RM8A 1QIBA 3F19A 4AYKA 4WZVA 3E8RA 3ELMA 3LKAA 3P24A 4PKQA 1Y93A 2DW0A 3WV2A 5D7WA 1HV5A 1HTDA 2AIGP 5CVWA 2TCLA 1R1JA 1MMQA 5D1UA 1B3DA 4H76A 2X3AA 2K2GA 3A70A 1BIWA 1OO9A 2OY4A 1QUAA 2X7MA 3OHLA 2OW2A 3HBUP 1CAQA 3EDZA 5CUHA 3I7IA 1KUHA 4JQGA 1MMPA 1KAPP 1K7IA 2MLRA 2OVXA 4FU4A 1XURA 2OW1A 1Y0VA 4PKTA 3TVCA 1JIZA 1O0QA 1QIAA 1PWQA 3HY7A 1R55A 4XCTA 4GR0A 1G05A 1QICA 1UTZA 4L19A 3I7GA 3KECA 2MZHA 4IJOA 3BA0A 2OVZA 1I1IP 1YOUA 1UMSA 1R1IA 4L6TA 1K7QA 1ROSA 2JNPA 2JIHA 3KMCA 4I03A 1DMTA 3LGPA 4XM8A 1IAEA 1UTTA 1BKCE 1FM1A 3DPFA 3K7NA 3U1RA 2OW9A 3GBOA 4AUOA 3UVCA 5D2BA 2WO9A 4HMAA 3CKIA 1JAQA 5D1SA 5BOYA 1CGLA 5JMYA 3EDIA 3DSLA 5LABA 3HBVP 2Z2DA 3ULTA 1GKCA 3O64A 4DF9A 3N2UA 830CA 2O36A 1BSWA 2XS4A 1BKCA 4DV8A 5I0LA 2OI0A 2W14A 2PJTA 4JP4A 3V96B 3L0VA 4ILWD 4R3VA 4XBHA 966CA 3F16A 4JPAA 1OM6A 4PKRA 3NTNA 5I43A 1KUGA 1UEAA 1JH1A 4ZR5A 1SRPA 4CTHA 1IAAA 1H71P 1ZS0A 3KEJA 1UMTA 3KMEA 1CXVA 5I12A 4PKSA 5CXAA 1EB6A 1JJ9A 2D1OA 4EFSA 1DTHA 2ERPA 3DPEA 1XUDA 3AIGA 3EDHA 3Q2HA 5I3MA 1R1HA 1BQQM 4H84A 4XM6A 1IADA 4GR3A 2QPJA 4QKZA 3B92A 3WV3A 3AYUA 1GE7A 3VI1A 2ML2A 1XFWA 4FXQA 3OHOA 1AYKA 1JIWP 3EHXA 1ZVXA 1ZXVA 4GWNA 1SLNA 3SHIA 1HFSA 1SATA 3LIKA 1C8TA 2ERQA 3HY9A 2Y6DA 3KRYA 1KBCA 1HOVA 5L7FA 3KWVC 2ZVDA 2K9CA 2SRTA 1KUFA 3ZVSA 3F17A 1MNCA 1PWPA 2Z8ZA 3F1AA 5CXLA 1ATLA 3DWBA 2OZRA 5H8XA 3EDGA 2AGMA 1ASTA 1R54A 3USNA 2MLSA 3LIRA 4G0DA 4H49A 1XFZA 1USNA 1I76A 2YIGA 2DW1A 5D3CA 5B5PA 3RTSA 4WKEA 1YP1A 1OMJA 4DD8A 1BKCI 4JIJA 1G4KA 4FVLA 3HYGA 3LK8A 3NX7A 2Z8XA 3LAAA 1PWVA 4HX3A 3MA2A 4L63A 4WK7A 3LA9A 3LJGA 3HDAP 2J83A 2OXUA 1L6JA 1GXDA 2DW2A 2OW0A 2J0TA 1D7XA 2OXWA 3P1VA 3Q2GA 2POJA 1PWWA 5B5OA 2FV5A 3L0TA 2JT5A 1A86A 4GR8A 3S6LA 2HU6A 1D5JA 4J4MA 1PWUA 4WF6A 4I35A 4WKIA 3RTTA 1Y8JA 1G9KA 2FV9A 3TT4A 1XFYA 3LJTA 2WOAA 3LILA 1S4BP 3VTGA 3WV1A 4PKWA 1HFCA 1D8MA 2N8RA 3B2ZA 4GWMA 2D1NA 3KHIA 3TSKA 1KUKA 2RJPA 2ZJ7A 3LMCA 1J7NA 3EHYA 4H82A 2I47A 1CK7A 2USNA 1AKLA 1ZTQA 4XM7A 1IACA 3LEAA 1SU3A 1AF0A 1GKDA 2MZIA 1A85A 4PKUA 2O3EA 1FLSA 4AXQA 3LUNA 3WP8A 1ND1A 3KEKA 2MZEA 2ZJ6A 1JK3A 1EUBA 1IABA 1EAKA 3AYKA 2JSDA 3F18A 1HY7A 3LQ0A 2YO0A 1GE5A 1MMBA 2X3CA 1OM8A 1QJJA 2XQHA 1XFUA 4AIGA 1ZP5A 4Q1LA 2QUBA 3LQBA 3LUMA 2EROA 2OY2A 1BQOA 4A7BA 4A3WA 1IAGA 2CKIA 4FXYP 1BUVM 3DL1A 2XS3A 3K7LA 5D1TA 2KRJA 4DPEA 4GQLA 5I2ZA 3G5CA 3HB2P 3ZXHA 4ON1A 2W13A 1JKYA 1Z3JA 1CGFA 1Q3AA 3EWJA 3TS4A 2YO1A 1MMRA 3ZUKA 4H30A 2WO8A 1G12A 1YQYA 2CLTA 1B8YA 3N2VA 1WNIA 1BM6A 1CIZA 1C3IA 5L79A 3LJZA 2V4BA 2W15A 4IUWA 5CZMA 4H2EA 1CGEA 3G42A 4H3XA 1QJIA 1SLMA 4G9LA 3HDBA 2L0RA 1BZSA 1XFVA 1D8FA 3LE9A 1OS2A 5BOTA 2W12A 1XUCA 1FBLA 1SMPA 1XFXA 1K7GA 2DDFA 2E3XA 4H1QA 3A6ZA 1RMZA 1OS9A 3O2XA
chains in the Genus database with same CATH superfamily
1C7KA 1XAXA 2RJQA 1JANA 2AYKA 2X3BA 1BUDA 2OXZA 2YB9A 456CA 3F15A 1JAPA 5I4OA 2QUAA 1CQRA 2DDYA 1G49A 1GO7P 1GE6A 1YCMA 4GUYA 4PKVA 3B8ZA 1OM7A 2JT6A 2E2DA 4GF1A 4IN9A 1KUIA 1I73A 2Y6CA 2W0DA 5BPAA 3DNGA 1O0TA 1ZXCA 1GO8P 2A8HA 1JAOA 1P9HA 4JA1A 1RM8A 1QIBA 3F19A 4AYKA 4WZVA 3E8RA 3ELMA 3LKAA 3P24A 4PKQA 1Y93A 2DW0A 3WV2A 5D7WA 1HV5A 1HTDA 2AIGP 5CVWA 2TCLA 1R1JA 1MMQA 5D1UA 1B3DA 4H76A 2X3AA 2K2GA 3A70A 1BIWA 1OO9A 2OY4A 1QUAA 2X7MA 3OHLA 2OW2A 3HBUP 1CAQA 3EDZA 5CUHA 3I7IA 1KUHA 4JQGA 1MMPA 1KAPP 1K7IA 2MLRA 2OVXA 4FU4A 1XURA 2OW1A 1Y0VA 4PKTA 3TVCA 1JIZA 1O0QA 1QIAA 1PWQA 3HY7A 1R55A 4XCTA 4GR0A 1G05A 1QICA 1UTZA 4L19A 3I7GA 3KECA 2MZHA 4IJOA 3BA0A 2OVZA 1I1IP 3DTKA 1YOUA 1UMSA 1R1IA 4L6TA 1K7QA 1ROSA 2JNPA 2JIHA 3KMCA 4I03A 1DMTA 3LGPA 4XM8A 1IAEA 1UTTA 1BKCE 1FM1A 3DPFA 3K7NA 3U1RA 2OW9A 3GBOA 4AUOA 3UVCA 5D2BA 2WO9A 4HMAA 3CKIA 1JAQA 5D1SA 5BOYA 1CGLA 5JMYA 3EDIA 3DSLA 1XM5A 5LABA 3HBVP 2Z2DA 3ULTA 1GKCA 3O64A 4DF9A 3N2UA 830CA 2O36A 1BSWA 2XS4A 1BKCA 4DV8A 5I0LA 2OI0A 2W14A 2PJTA 4JP4A 3V96B 3L0VA 4ILWD 4R3VA 4XBHA 966CA 3F16A 4JPAA 1OM6A 4PKRA 3NTNA 5I43A 1KUGA 1UEAA 1JH1A 3DTEA 4ZR5A 1SRPA 4CTHA 1IAAA 1H71P 1ZS0A 3KEJA 1UMTA 3KMEA 1CXVA 5I12A 4PKSA 5CXAA 1EB6A 1JJ9A 2D1OA 4EFSA 1DTHA 2ERPA 3DPEA 1XUDA 2YUFA 3AIGA 3EDHA 3Q2HA 5I3MA 1R1HA 1BQQM 4H84A 4XM6A 1IADA 4GR3A 2QPJA 4QKZA 3B92A 3WV3A 3AYUA 1GE7A 3VI1A 2ML2A 1XFWA 4FXQA 3OHOA 1AYKA 1JIWP 3EHXA 1ZVXA 1ZXVA 4GWNA 1SLNA 3SHIA 1HFSA 1SATA 3LIKA 1C8TA 2ERQA 3HY9A 2Y6DA 3KRYA 1KBCA 1HOVA 5L7FA 3KWVC 2ZVDA 2K9CA 2SRTA 1KUFA 3ZVSA 3F17A 1MNCA 1PWPA 2Z8ZA 3F1AA 5CXLA 1ATLA 3DWBA 2OZRA 5H8XA 3EDGA 2AGMA 1ASTA 1R54A 3USNA 2MLSA 3LIRA 4G0DA 4H49A 1XFZA 1USNA 1I76A 2YIGA 2DW1A 5D3CA 5B5PA 3RTSA 4WKEA 1TVIA 1YP1A 1OMJA 4DD8A 1BKCI 4JIJA 1G4KA 4FVLA 3HYGA 3LK8A 3NX7A 2Z8XA 3LAAA 1PWVA 4HX3A 3MA2A 4L63A 4WK7A 3LA9A 3LJGA 3HDAP 2J83A 2OXUA 1L6JA 1GXDA 2DW2A 2OW0A 2J0TA 1D7XA 2OXWA 3P1VA 3Q2GA 2POJA 1PWWA 5B5OA 2FV5A 3L0TA 2JT5A 1A86A 4GR8A 3S6LA 2HU6A 1D5JA 4J4MA 3DTIA 1PWUA 4WF6A 4I35A 4WKIA 3RTTA 1Y8JA 1G9KA 2FV9A 3TT4A 1XFYA 3LJTA 2WOAA 3LILA 1S4BP 3VTGA 3WV1A 4PKWA 4DT5A 1HFCA 1D8MA 2N8RA 3B2ZA 4GWMA 2D1NA 3KHIA 3TSKA 1KUKA 2RJPA 2ZJ7A 3LMCA 1J7NA 3EHYA 4H82A 2I47A 1CK7A 2USNA 1AKLA 1ZTQA 4XM7A 1IACA 3LEAA 1SU3A 1AF0A 1GKDA 2MZIA 1A85A 4PKUA 2O3EA 1FLSA 4AXQA 1OZ9A 3LUNA 3WP8A 1ND1A 3KEKA 2MZEA 2ZJ6A 1JK3A 1EUBA 1IABA 1EAKA 3AYKA 2JSDA 3F18A 1HY7A 3LQ0A 2YO0A 1GE5A 1MMBA 2X3CA 1OM8A 1QJJA 2XQHA 1XFUA 4AIGA 1ZP5A 4Q1LA 2QUBA 3LQBA 3LUMA 2EROA 2OY2A 1BQOA 4A7BA 4A3WA 1IAGA 2CKIA 4FXYP 1BUVM 3DL1A 2XS3A 3K7LA 5D1TA 2KRJA 4DPEA 4GQLA 5I2ZA 3G5CA 3HB2P 3ZXHA 4ON1A 2W13A 1JKYA 1Z3JA 1CGFA 1Q3AA 3EWJA 3TS4A 2YO1A 1MMRA 3ZUKA 4H30A 2WO8A 1G12A 1YQYA 2CLTA 1B8YA 3N2VA 1WNIA 1BM6A 1CIZA 1C3IA 5L79A 3LJZA 2V4BA 2W15A 4IUWA 5CZMA 4H2EA 1CGEA 3G42A 4H3XA 1QJIA 1SLMA 4G9LA 3HDBA 2L0RA 1BZSA 1XFVA 1D8FA 3LE9A 1OS2A 5BOTA 2W12A 1XUCA 4L7AA 1FBLA 1SMPA 1XFXA 1K7GA 2DDFA 2E3XA 4H1QA 3A6ZA 1RMZA 1OS9A 3O2XA
chains in the Genus database with same CATH topology
1C7KA 2RJQA 1JANA 2AYKA 2X3BA 1BUDA 2OXZA 2YB9A 456CA 3F15A 1JAPA 5I4OA 2QUAA 1CQRA 2DDYA 1G49A 1GO7P 1GE6A 1YCMA 4GUYA 4PKVA 3B8ZA 1OM7A 2JT6A 2E2DA 4GF1A 4IN9A 1KUIA 1I73A 2Y6CA 2W0DA 5BPAA 3DNGA 1O0TA 1ZXCA 1GO8P 2A8HA 1JAOA 1P9HA 4JA1A 1RM8A 1QIBA 3F19A 4AYKA 4WZVA 3E8RA 3ELMA 3LKAA 3P24A 4PKQA 1Y93A 2DW0A 3WV2A 5D7WA 1HV5A 1HTDA 2AIGP 5CVWA 2TCLA 1R1JA 1MMQA 5D1UA 1B3DA 4H76A 2X3AA 2K2GA 3A70A 1BIWA 1OO9A 2OY4A 1QUAA 2X7MA 3OHLA 2OW2A 3HBUP 1CAQA 3EDZA 5CUHA 3I7IA 1KUHA 4JQGA 1MMPA 1KAPP 1K7IA 2MLRA 2OVXA 4FU4A 1XURA 2OW1A 1Y0VA 4PKTA 3TVCA 1JIZA 1O0QA 1QIAA 1PWQA 3HY7A 1R55A 4XCTA 4GR0A 1G05A 1QICA 1UTZA 4L19A 3I7GA 3KECA 2MZHA 4IJOA 3BA0A 2OVZA 1I1IP 3DTKA 1YOUA 1UMSA 1R1IA 4L6TA 1K7QA 1ROSA 2JNPA 2JIHA 3KMCA 4I03A 1DMTA 3LGPA 4XM8A 1IAEA 1UTTA 1BKCE 1FM1A 3DPFA 3K7NA 3U1RA 2OW9A 3GBOA 4AUOA 3UVCA 5D2BA 2WO9A 4HMAA 3CKIA 1JAQA 5D1SA 5BOYA 1CGLA 5JMYA 3EDIA 3DSLA 5LABA 3HBVP 2Z2DA 3ULTA 1GKCA 3O64A 4DF9A 3N2UA 830CA 2O36A 1BSWA 2XS4A 1BKCA 4DV8A 5I0LA 2OI0A 2W14A 2PJTA 4JP4A 3V96B 3L0VA 4ILWD 4R3VA 4XBHA 966CA 3F16A 4JPAA 1OM6A 4PKRA 3NTNA 5I43A 1KUGA 1UEAA 1JH1A 3DTEA 4ZR5A 1SRPA 4CTHA 1IAAA 1H71P 1ZS0A 3KEJA 1UMTA 3KMEA 1CXVA 5I12A 4PKSA 5CXAA 1EB6A 1JJ9A 2D1OA 4EFSA 1DTHA 2ERPA 3DPEA 1XUDA 2YUFA 3AIGA 3EDHA 3Q2HA 5I3MA 1R1HA 1BQQM 4H84A 4XM6A 1IADA 4GR3A 2QPJA 4QKZA 3B92A 3WV3A 3AYUA 1GE7A 3VI1A 2ML2A 1XFWA 4FXQA 3OHOA 1AYKA 1JIWP 3EHXA 1ZVXA 1ZXVA 4GWNA 1SLNA 3SHIA 1HFSA 1SATA 3LIKA 1C8TA 2ERQA 3HY9A 2Y6DA 3KRYA 1KBCA 1HOVA 5L7FA 3KWVC 2ZVDA 2K9CA 2SRTA 1KUFA 3ZVSA 3F17A 1MNCA 1PWPA 2Z8ZA 3F1AA 5CXLA 1ATLA 3DWBA 2OZRA 5H8XA 3EDGA 2AGMA 1ASTA 1R54A 3USNA 2MLSA 3LIRA 4G0DA 4H49A 1XFZA 1USNA 1I76A 2YIGA 2DW1A 5D3CA 5B5PA 3RTSA 4WKEA 1YP1A 1OMJA 4DD8A 1BKCI 4JIJA 1G4KA 4FVLA 3HYGA 3LK8A 3NX7A 2Z8XA 3LAAA 1PWVA 4HX3A 3MA2A 4L63A 4WK7A 3LA9A 3LJGA 3HDAP 2J83A 2OXUA 1L6JA 1GXDA 2DW2A 2OW0A 2J0TA 1D7XA 2OXWA 3P1VA 3Q2GA 2POJA 1PWWA 5B5OA 2FV5A 3L0TA 2JT5A 1A86A 4GR8A 3S6LA 2HU6A 1D5JA 4J4MA 3DTIA 1PWUA 4WF6A 4I35A 4WKIA 3RTTA 1Y8JA 1G9KA 2FV9A 3TT4A 1XFYA 3LJTA 2WOAA 3LILA 1S4BP 3VTGA 3WV1A 4PKWA 1HFCA 1D8MA 2N8RA 3B2ZA 4GWMA 2D1NA 3KHIA 3TSKA 1KUKA 2RJPA 2ZJ7A 3LMCA 1J7NA 3EHYA 4H82A 2I47A 1CK7A 2USNA 1AKLA 1ZTQA 4XM7A 1IACA 3LEAA 1SU3A 1AF0A 1GKDA 2MZIA 1A85A 4PKUA 2O3EA 1FLSA 4AXQA 3LUNA 3WP8A 1ND1A 3KEKA 2MZEA 2ZJ6A 1JK3A 1EUBA 1IABA 1EAKA 3AYKA 2JSDA 3F18A 1HY7A 3LQ0A 2YO0A 1GE5A 1MMBA 2X3CA 1OM8A 1QJJA 2XQHA 1XFUA 4AIGA 1ZP5A 4Q1LA 2QUBA 3LQBA 3LUMA 2EROA 2OY2A 1BQOA 4A7BA 4A3WA 1IAGA 2CKIA 4FXYP 1BUVM 3DL1A 2XS3A 3K7LA 5D1TA 2KRJA 4DPEA 4GQLA 5I2ZA 3G5CA 3HB2P 3ZXHA 4ON1A 2W13A 1JKYA 1Z3JA 1CGFA 1Q3AA 3EWJA 3TS4A 2YO1A 1MMRA 3ZUKA 4H30A 2WO8A 1G12A 1YQYA 2CLTA 1B8YA 3N2VA 1WNIA 1BM6A 1CIZA 1C3IA 5L79A 3LJZA 2V4BA 2W15A 4IUWA 5CZMA 4H2EA 1CGEA 3G42A 4H3XA 1QJIA 1SLMA 4G9LA 3HDBA 2L0RA 1BZSA 1XFVA 1D8FA 3LE9A 1OS2A 5BOTA 2W12A 1XUCA 4L7AA 1FBLA 1SMPA 1XFXA 1K7GA 2DDFA 2E3XA 4H1QA 3A6ZA 1RMZA 1OS9A 3O2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C7K A;  2RJQ A;  1JAN A;  2AYK A;  2X3B A;  1BUD A;  2OXZ A;  2YB9 A;  456C A;  3F15 A;  1JAP A;  5I4O A;  2QUA A;  1CQR A;  2DDY A;  1G49 A;  1GO7 P;  1GE6 A;  1YCM A;  4GUY A;  4PKV A;  3B8Z A;  1OM7 A;  2JT6 A;  2E2D A;  4GF1 A;  4IN9 A;  1KUI A;  1I73 A;  2Y6C A;  2W0D A;  5BPA A;  3DNG A;  1O0T A;  1ZXC A;  1GO8 P;  2A8H A;  1JAO A;  1P9H A;  4JA1 A;  1RM8 A;  1QIB A;  3F19 A;  4AYK A;  4WZV A;  3E8R A;  3ELM A;  3LKA A;  3P24 A;  4PKQ A;  1Y93 A;  2DW0 A;  3WV2 A;  5D7W A;  1HV5 A;  1HTD A;  2AIG P;  5CVW A;  2TCL A;  1R1J A;  1MMQ A;  5D1U A;  1B3D A;  4H76 A;  2X3A A;  2K2G A;  3A70 A;  1BIW A;  1OO9 A;  2OY4 A;  1QUA A;  2X7M A;  3OHL A;  2OW2 A;  3HBU P;  1CAQ A;  3EDZ A;  5CUH A;  3I7I A;  1KUH A;  4JQG A;  1MMP A;  1KAP P;  1K7I A;  2MLR A;  2OVX A;  4FU4 A;  1XUR A;  2OW1 A;  1Y0V A;  4PKT A;  3TVC A;  1JIZ A;  1O0Q A;  1QIA A;  1PWQ A;  3HY7 A;  1R55 A;  4XCT A;  4GR0 A;  1G05 A;  1QIC A;  1UTZ A;  4L19 A;  3I7G A;  3KEC A;  2MZH A;  4IJO A;  3BA0 A;  2OVZ A;  1I1I P;  1YOU A;  1UMS A;  1R1I A;  4L6T A;  1K7Q A;  1ROS A;  2JNP A;  2JIH A;  3KMC A;  4I03 A;  1DMT A;  3LGP A;  4XM8 A;  1IAE A;  1UTT A;  1BKC E;  1FM1 A;  3DPF A;  3K7N A;  3U1R A;  2OW9 A;  3GBO A;  4AUO A;  3UVC A;  5D2B A;  2WO9 A;  4HMA A;  3CKI A;  1JAQ A;  5D1S A;  5BOY A;  1CGL A;  5JMY A;  3EDI A;  3DSL A;  5LAB A;  3HBV P;  2Z2D A;  3ULT A;  1GKC A;  3O64 A;  4DF9 A;  3N2U A;  830C A;  2O36 A;  1BSW A;  2XS4 A;  1BKC A;  4DV8 A;  5I0L A;  2OI0 A;  2W14 A;  2PJT A;  4JP4 A;  3V96 B;  3L0V A;  4ILW D;  4R3V A;  4XBH A;  966C A;  3F16 A;  4JPA A;  1OM6 A;  4PKR A;  3NTN A;  5I43 A;  1KUG A;  1UEA A;  1JH1 A;  4ZR5 A;  1SRP A;  4CTH A;  1IAA A;  1H71 P;  1ZS0 A;  3KEJ A;  1UMT A;  3KME A;  1CXV A;  5I12 A;  4PKS A;  5CXA A;  1EB6 A;  1JJ9 A;  2D1O A;  4EFS A;  1DTH A;  2ERP A;  3DPE A;  1XUD A;  3AIG A;  3EDH A;  3Q2H A;  5I3M A;  1R1H A;  1BQQ M;  4H84 A;  4XM6 A;  1IAD A;  4GR3 A;  2QPJ A;  4QKZ A;  3B92 A;  3WV3 A;  3AYU A;  1GE7 A;  3VI1 A;  2ML2 A;  1XFW A;  4FXQ A;  3OHO A;  1AYK A;  1JIW P;  3EHX A;  1ZVX A;  1ZXV A;  4GWN A;  1SLN A;  3SHI A;  1HFS A;  1SAT A;  3LIK A;  1C8T A;  2ERQ A;  3HY9 A;  2Y6D A;  3KRY A;  1KBC A;  1HOV A;  5L7F A;  3KWV C;  2ZVD A;  2K9C A;  2SRT A;  1KUF A;  3ZVS A;  3F17 A;  1MNC A;  1PWP A;  2Z8Z A;  3F1A A;  5CXL A;  1ATL A;  3DWB A;  2OZR A;  5H8X A;  3EDG A;  2AGM A;  1AST A;  1R54 A;  3USN A;  2MLS A;  3LIR A;  4G0D A;  4H49 A;  1XFZ A;  1USN A;  1I76 A;  2YIG A;  2DW1 A;  5D3C A;  5B5P A;  3RTS A;  4WKE A;  1YP1 A;  1OMJ A;  4DD8 A;  1BKC I;  4JIJ A;  1G4K A;  4FVL A;  3HYG A;  3LK8 A;  3NX7 A;  2Z8X A;  3LAA A;  1PWV A;  4HX3 A;  3MA2 A;  4L63 A;  4WK7 A;  3LA9 A;  3LJG A;  3HDA P;  2J83 A;  2OXU A;  1L6J A;  1GXD A;  2DW2 A;  2OW0 A;  2J0T A;  1D7X A;  2OXW A;  3P1V A;  3Q2G A;  2POJ A;  1PWW A;  5B5O A;  2FV5 A;  3L0T A;  2JT5 A;  1A86 A;  4GR8 A;  3S6L A;  2HU6 A;  1D5J A;  4J4M A;  1PWU A;  4WF6 A;  4I35 A;  4WKI A;  3RTT A;  1Y8J A;  1G9K A;  2FV9 A;  3TT4 A;  1XFY A;  3LJT A;  2WOA A;  3LIL A;  1S4B P;  3VTG A;  3WV1 A;  4PKW A;  1HFC A;  1D8M A;  2N8R A;  3B2Z A;  4GWM A;  2D1N A;  3KHI A;  3TSK A;  1KUK A;  2RJP A;  2ZJ7 A;  3LMC A;  1J7N A;  3EHY A;  4H82 A;  2I47 A;  1CK7 A;  2USN A;  1AKL A;  1ZTQ A;  4XM7 A;  1IAC A;  3LEA A;  1SU3 A;  1AF0 A;  1GKD A;  2MZI A;  1A85 A;  4PKU A;  2O3E A;  1FLS A;  4AXQ A;  3LUN A;  3WP8 A;  1ND1 A;  3KEK A;  2MZE A;  2ZJ6 A;  1JK3 A;  1EUB A;  1IAB A;  1EAK A;  3AYK A;  2JSD A;  3F18 A;  1HY7 A;  3LQ0 A;  2YO0 A;  1GE5 A;  1MMB A;  2X3C A;  1OM8 A;  1QJJ A;  2XQH A;  1XFU A;  4AIG A;  1ZP5 A;  4Q1L A;  2QUB A;  3LQB A;  3LUM A;  2ERO A;  2OY2 A;  1BQO A;  4A7B A;  4A3W A;  1IAG A;  2CKI A;  4FXY P;  1BUV M;  3DL1 A;  2XS3 A;  3K7L A;  5D1T A;  2KRJ A;  4DPE A;  4GQL A;  5I2Z A;  3G5C A;  3HB2 P;  3ZXH A;  4ON1 A;  2W13 A;  1JKY A;  1Z3J A;  1CGF A;  1Q3A A;  3EWJ A;  3TS4 A;  2YO1 A;  1MMR A;  3ZUK A;  4H30 A;  2WO8 A;  1G12 A;  1YQY A;  2CLT A;  1B8Y A;  3N2V A;  1WNI A;  1BM6 A;  1CIZ A;  1C3I A;  5L79 A;  3LJZ A;  2V4B A;  2W15 A;  4IUW A;  5CZM A;  4H2E A;  1CGE A;  3G42 A;  4H3X A;  1QJI A;  1SLM A;  4G9L A;  3HDB A;  2L0R A;  1BZS A;  1XFV A;  1D8F A;  3LE9 A;  1OS2 A;  5BOT A;  2W12 A;  1XUC A;  1FBL A;  1SMP A;  1XFX A;  1K7G A;  2DDF A;  2E3X A;  4H1Q A;  3A6Z A;  1RMZ A;  1OS9 A;  3O2X A; 
#chains in the Genus database with same CATH topology
 1C7K A;  1XAX A;  2RJQ A;  1JAN A;  2AYK A;  2X3B A;  1BUD A;  2OXZ A;  2YB9 A;  456C A;  3F15 A;  1JAP A;  5I4O A;  2QUA A;  1CQR A;  2DDY A;  1G49 A;  1GO7 P;  1GE6 A;  1YCM A;  4GUY A;  4PKV A;  3B8Z A;  1OM7 A;  2JT6 A;  2E2D A;  4GF1 A;  4IN9 A;  1KUI A;  1I73 A;  2Y6C A;  2W0D A;  5BPA A;  3DNG A;  1O0T A;  1ZXC A;  1GO8 P;  2A8H A;  1JAO A;  1P9H A;  4JA1 A;  1RM8 A;  1QIB A;  3F19 A;  4AYK A;  4WZV A;  3E8R A;  3ELM A;  3LKA A;  3P24 A;  4PKQ A;  1Y93 A;  2DW0 A;  3WV2 A;  5D7W A;  1HV5 A;  1HTD A;  2AIG P;  5CVW A;  2TCL A;  1R1J A;  1MMQ A;  5D1U A;  1B3D A;  4H76 A;  2X3A A;  2K2G A;  3A70 A;  1BIW A;  1OO9 A;  2OY4 A;  1QUA A;  2X7M A;  3OHL A;  2OW2 A;  3HBU P;  1CAQ A;  3EDZ A;  5CUH A;  3I7I A;  1KUH A;  4JQG A;  1MMP A;  1KAP P;  1K7I A;  2MLR A;  2OVX A;  4FU4 A;  1XUR A;  2OW1 A;  1Y0V A;  4PKT A;  3TVC A;  1JIZ A;  1O0Q A;  1QIA A;  1PWQ A;  3HY7 A;  1R55 A;  4XCT A;  4GR0 A;  1G05 A;  1QIC A;  1UTZ A;  4L19 A;  3I7G A;  3KEC A;  2MZH A;  4IJO A;  3BA0 A;  2OVZ A;  1I1I P;  3DTK A;  1YOU A;  1UMS A;  1R1I A;  4L6T A;  1K7Q A;  1ROS A;  2JNP A;  2JIH A;  3KMC A;  4I03 A;  1DMT A;  3LGP A;  4XM8 A;  1IAE A;  1UTT A;  1BKC E;  1FM1 A;  3DPF A;  3K7N A;  3U1R A;  2OW9 A;  3GBO A;  4AUO A;  3UVC A;  5D2B A;  2WO9 A;  4HMA A;  3CKI A;  1JAQ A;  5D1S A;  5BOY A;  1CGL A;  5JMY A;  3EDI A;  3DSL A;  1XM5 A;  5LAB A;  3HBV P;  2Z2D A;  3ULT A;  1GKC A;  3O64 A;  4DF9 A;  3N2U A;  830C A;  2O36 A;  1BSW A;  2XS4 A;  1BKC A;  4DV8 A;  5I0L A;  2OI0 A;  2W14 A;  2PJT A;  4JP4 A;  3V96 B;  3L0V A;  4ILW D;  4R3V A;  4XBH A;  966C A;  3F16 A;  4JPA A;  1OM6 A;  4PKR A;  3NTN A;  5I43 A;  1KUG A;  1UEA A;  1JH1 A;  3DTE A;  4ZR5 A;  1SRP A;  4CTH A;  1IAA A;  1H71 P;  1ZS0 A;  3KEJ A;  1UMT A;  3KME A;  1CXV A;  5I12 A;  4PKS A;  5CXA A;  1EB6 A;  1JJ9 A;  2D1O A;  4EFS A;  1DTH A;  2ERP A;  3DPE A;  1XUD A;  2YUF A;  3AIG A;  3EDH A;  3Q2H A;  5I3M A;  1R1H A;  1BQQ M;  4H84 A;  4XM6 A;  1IAD A;  4GR3 A;  2QPJ A;  4QKZ A;  3B92 A;  3WV3 A;  3AYU A;  1GE7 A;  3VI1 A;  2ML2 A;  1XFW A;  4FXQ A;  3OHO A;  1AYK A;  1JIW P;  3EHX A;  1ZVX A;  1ZXV A;  4GWN A;  1SLN A;  3SHI A;  1HFS A;  1SAT A;  3LIK A;  1C8T A;  2ERQ A;  3HY9 A;  2Y6D A;  3KRY A;  1KBC A;  1HOV A;  5L7F A;  3KWV C;  2ZVD A;  2K9C A;  2SRT A;  1KUF A;  3ZVS A;  3F17 A;  1MNC A;  1PWP A;  2Z8Z A;  3F1A A;  5CXL A;  1ATL A;  3DWB A;  2OZR A;  5H8X A;  3EDG A;  2AGM A;  1AST A;  1R54 A;  3USN A;  2MLS A;  3LIR A;  4G0D A;  4H49 A;  1XFZ A;  1USN A;  1I76 A;  2YIG A;  2DW1 A;  5D3C A;  5B5P A;  3RTS A;  4WKE A;  1TVI A;  1YP1 A;  1OMJ A;  4DD8 A;  1BKC I;  4JIJ A;  1G4K A;  4FVL A;  3HYG A;  3LK8 A;  3NX7 A;  2Z8X A;  3LAA A;  1PWV A;  4HX3 A;  3MA2 A;  4L63 A;  4WK7 A;  3LA9 A;  3LJG A;  3HDA P;  2J83 A;  2OXU A;  1L6J A;  1GXD A;  2DW2 A;  2OW0 A;  2J0T A;  1D7X A;  2OXW A;  3P1V A;  3Q2G A;  2POJ A;  1PWW A;  5B5O A;  2FV5 A;  3L0T A;  2JT5 A;  1A86 A;  4GR8 A;  3S6L A;  2HU6 A;  1D5J A;  4J4M A;  3DTI A;  1PWU A;  4WF6 A;  4I35 A;  4WKI A;  3RTT A;  1Y8J A;  1G9K A;  2FV9 A;  3TT4 A;  1XFY A;  3LJT A;  2WOA A;  3LIL A;  1S4B P;  3VTG A;  3WV1 A;  4PKW A;  4DT5 A;  1HFC A;  1D8M A;  2N8R A;  3B2Z A;  4GWM A;  2D1N A;  3KHI A;  3TSK A;  1KUK A;  2RJP A;  2ZJ7 A;  3LMC A;  1J7N A;  3EHY A;  4H82 A;  2I47 A;  1CK7 A;  2USN A;  1AKL A;  1ZTQ A;  4XM7 A;  1IAC A;  3LEA A;  1SU3 A;  1AF0 A;  1GKD A;  2MZI A;  1A85 A;  4PKU A;  2O3E A;  1FLS A;  4AXQ A;  1OZ9 A;  3LUN A;  3WP8 A;  1ND1 A;  3KEK A;  2MZE A;  2ZJ6 A;  1JK3 A;  1EUB A;  1IAB A;  1EAK A;  3AYK A;  2JSD A;  3F18 A;  1HY7 A;  3LQ0 A;  2YO0 A;  1GE5 A;  1MMB A;  2X3C A;  1OM8 A;  1QJJ A;  2XQH A;  1XFU A;  4AIG A;  1ZP5 A;  4Q1L A;  2QUB A;  3LQB A;  3LUM A;  2ERO A;  2OY2 A;  1BQO A;  4A7B A;  4A3W A;  1IAG A;  2CKI A;  4FXY P;  1BUV M;  3DL1 A;  2XS3 A;  3K7L A;  5D1T A;  2KRJ A;  4DPE A;  4GQL A;  5I2Z A;  3G5C A;  3HB2 P;  3ZXH A;  4ON1 A;  2W13 A;  1JKY A;  1Z3J A;  1CGF A;  1Q3A A;  3EWJ A;  3TS4 A;  2YO1 A;  1MMR A;  3ZUK A;  4H30 A;  2WO8 A;  1G12 A;  1YQY A;  2CLT A;  1B8Y A;  3N2V A;  1WNI A;  1BM6 A;  1CIZ A;  1C3I A;  5L79 A;  3LJZ A;  2V4B A;  2W15 A;  4IUW A;  5CZM A;  4H2E A;  1CGE A;  3G42 A;  4H3X A;  1QJI A;  1SLM A;  4G9L A;  3HDB A;  2L0R A;  1BZS A;  1XFV A;  1D8F A;  3LE9 A;  1OS2 A;  5BOT A;  2W12 A;  1XUC A;  4L7A A;  1FBL A;  1SMP A;  1XFX A;  1K7G A;  2DDF A;  2E3X A;  4H1Q A;  3A6Z A;  1RMZ A;  1OS9 A;  3O2X A; 
#chains in the Genus database with same CATH homology
 1C7K A;  2RJQ A;  1JAN A;  2AYK A;  2X3B A;  1BUD A;  2OXZ A;  2YB9 A;  456C A;  3F15 A;  1JAP A;  5I4O A;  2QUA A;  1CQR A;  2DDY A;  1G49 A;  1GO7 P;  1GE6 A;  1YCM A;  4GUY A;  4PKV A;  3B8Z A;  1OM7 A;  2JT6 A;  2E2D A;  4GF1 A;  4IN9 A;  1KUI A;  1I73 A;  2Y6C A;  2W0D A;  5BPA A;  3DNG A;  1O0T A;  1ZXC A;  1GO8 P;  2A8H A;  1JAO A;  1P9H A;  4JA1 A;  1RM8 A;  1QIB A;  3F19 A;  4AYK A;  4WZV A;  3E8R A;  3ELM A;  3LKA A;  3P24 A;  4PKQ A;  1Y93 A;  2DW0 A;  3WV2 A;  5D7W A;  1HV5 A;  1HTD A;  2AIG P;  5CVW A;  2TCL A;  1R1J A;  1MMQ A;  5D1U A;  1B3D A;  4H76 A;  2X3A A;  2K2G A;  3A70 A;  1BIW A;  1OO9 A;  2OY4 A;  1QUA A;  2X7M A;  3OHL A;  2OW2 A;  3HBU P;  1CAQ A;  3EDZ A;  5CUH A;  3I7I A;  1KUH A;  4JQG A;  1MMP A;  1KAP P;  1K7I A;  2MLR A;  2OVX A;  4FU4 A;  1XUR A;  2OW1 A;  1Y0V A;  4PKT A;  3TVC A;  1JIZ A;  1O0Q A;  1QIA A;  1PWQ A;  3HY7 A;  1R55 A;  4XCT A;  4GR0 A;  1G05 A;  1QIC A;  1UTZ A;  4L19 A;  3I7G A;  3KEC A;  2MZH A;  4IJO A;  3BA0 A;  2OVZ A;  1I1I P;  3DTK A;  1YOU A;  1UMS A;  1R1I A;  4L6T A;  1K7Q A;  1ROS A;  2JNP A;  2JIH A;  3KMC A;  4I03 A;  1DMT A;  3LGP A;  4XM8 A;  1IAE A;  1UTT A;  1BKC E;  1FM1 A;  3DPF A;  3K7N A;  3U1R A;  2OW9 A;  3GBO A;  4AUO A;  3UVC A;  5D2B A;  2WO9 A;  4HMA A;  3CKI A;  1JAQ A;  5D1S A;  5BOY A;  1CGL A;  5JMY A;  3EDI A;  3DSL A;  5LAB A;  3HBV P;  2Z2D A;  3ULT A;  1GKC A;  3O64 A;  4DF9 A;  3N2U A;  830C A;  2O36 A;  1BSW A;  2XS4 A;  1BKC A;  4DV8 A;  5I0L A;  2OI0 A;  2W14 A;  2PJT A;  4JP4 A;  3V96 B;  3L0V A;  4ILW D;  4R3V A;  4XBH A;  966C A;  3F16 A;  4JPA A;  1OM6 A;  4PKR A;  3NTN A;  5I43 A;  1KUG A;  1UEA A;  1JH1 A;  3DTE A;  4ZR5 A;  1SRP A;  4CTH A;  1IAA A;  1H71 P;  1ZS0 A;  3KEJ A;  1UMT A;  3KME A;  1CXV A;  5I12 A;  4PKS A;  5CXA A;  1EB6 A;  1JJ9 A;  2D1O A;  4EFS A;  1DTH A;  2ERP A;  3DPE A;  1XUD A;  2YUF A;  3AIG A;  3EDH A;  3Q2H A;  5I3M A;  1R1H A;  1BQQ M;  4H84 A;  4XM6 A;  1IAD A;  4GR3 A;  2QPJ A;  4QKZ A;  3B92 A;  3WV3 A;  3AYU A;  1GE7 A;  3VI1 A;  2ML2 A;  1XFW A;  4FXQ A;  3OHO A;  1AYK A;  1JIW P;  3EHX A;  1ZVX A;  1ZXV A;  4GWN A;  1SLN A;  3SHI A;  1HFS A;  1SAT A;  3LIK A;  1C8T A;  2ERQ A;  3HY9 A;  2Y6D A;  3KRY A;  1KBC A;  1HOV A;  5L7F A;  3KWV C;  2ZVD A;  2K9C A;  2SRT A;  1KUF A;  3ZVS A;  3F17 A;  1MNC A;  1PWP A;  2Z8Z A;  3F1A A;  5CXL A;  1ATL A;  3DWB A;  2OZR A;  5H8X A;  3EDG A;  2AGM A;  1AST A;  1R54 A;  3USN A;  2MLS A;  3LIR A;  4G0D A;  4H49 A;  1XFZ A;  1USN A;  1I76 A;  2YIG A;  2DW1 A;  5D3C A;  5B5P A;  3RTS A;  4WKE A;  1YP1 A;  1OMJ A;  4DD8 A;  1BKC I;  4JIJ A;  1G4K A;  4FVL A;  3HYG A;  3LK8 A;  3NX7 A;  2Z8X A;  3LAA A;  1PWV A;  4HX3 A;  3MA2 A;  4L63 A;  4WK7 A;  3LA9 A;  3LJG A;  3HDA P;  2J83 A;  2OXU A;  1L6J A;  1GXD A;  2DW2 A;  2OW0 A;  2J0T A;  1D7X A;  2OXW A;  3P1V A;  3Q2G A;  2POJ A;  1PWW A;  5B5O A;  2FV5 A;  3L0T A;  2JT5 A;  1A86 A;  4GR8 A;  3S6L A;  2HU6 A;  1D5J A;  4J4M A;  3DTI A;  1PWU A;  4WF6 A;  4I35 A;  4WKI A;  3RTT A;  1Y8J A;  1G9K A;  2FV9 A;  3TT4 A;  1XFY A;  3LJT A;  2WOA A;  3LIL A;  1S4B P;  3VTG A;  3WV1 A;  4PKW A;  1HFC A;  1D8M A;  2N8R A;  3B2Z A;  4GWM A;  2D1N A;  3KHI A;  3TSK A;  1KUK A;  2RJP A;  2ZJ7 A;  3LMC A;  1J7N A;  3EHY A;  4H82 A;  2I47 A;  1CK7 A;  2USN A;  1AKL A;  1ZTQ A;  4XM7 A;  1IAC A;  3LEA A;  1SU3 A;  1AF0 A;  1GKD A;  2MZI A;  1A85 A;  4PKU A;  2O3E A;  1FLS A;  4AXQ A;  3LUN A;  3WP8 A;  1ND1 A;  3KEK A;  2MZE A;  2ZJ6 A;  1JK3 A;  1EUB A;  1IAB A;  1EAK A;  3AYK A;  2JSD A;  3F18 A;  1HY7 A;  3LQ0 A;  2YO0 A;  1GE5 A;  1MMB A;  2X3C A;  1OM8 A;  1QJJ A;  2XQH A;  1XFU A;  4AIG A;  1ZP5 A;  4Q1L A;  2QUB A;  3LQB A;  3LUM A;  2ERO A;  2OY2 A;  1BQO A;  4A7B A;  4A3W A;  1IAG A;  2CKI A;  4FXY P;  1BUV M;  3DL1 A;  2XS3 A;  3K7L A;  5D1T A;  2KRJ A;  4DPE A;  4GQL A;  5I2Z A;  3G5C A;  3HB2 P;  3ZXH A;  4ON1 A;  2W13 A;  1JKY A;  1Z3J A;  1CGF A;  1Q3A A;  3EWJ A;  3TS4 A;  2YO1 A;  1MMR A;  3ZUK A;  4H30 A;  2WO8 A;  1G12 A;  1YQY A;  2CLT A;  1B8Y A;  3N2V A;  1WNI A;  1BM6 A;  1CIZ A;  1C3I A;  5L79 A;  3LJZ A;  2V4B A;  2W15 A;  4IUW A;  5CZM A;  4H2E A;  1CGE A;  3G42 A;  4H3X A;  1QJI A;  1SLM A;  4G9L A;  3HDB A;  2L0R A;  1BZS A;  1XFV A;  1D8F A;  3LE9 A;  1OS2 A;  5BOT A;  2W12 A;  1XUC A;  4L7A A;  1FBL A;  1SMP A;  1XFX A;  1K7G A;  2DDF A;  2E3X A;  4H1Q A;  3A6Z A;  1RMZ A;  1OS9 A;  3O2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...