1K7QA

Prtc from erwinia chrysanthemi: e189a mutant
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
462
structure length
462
Chain Sequence
b'ANTSSAYNSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPGSEEYGRQTFTHAIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSIMSYWGENETGADYNGHYGGAPMIDDIAAIQRLYGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHGVTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLSAFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDIIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SECRETED PROTEASE C
publication title Protease C of Erwinia chrysanthemi: The Crystal Structure and Role of Amino Acids Y228 and E189
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 162
structure length 462
sequence length 462
ec nomenclature ec 3.4.24.40: Serralysin.
pdb deposition date 2001-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
A PF00413 Peptidase_M10 Matrixin
A PF08548 Peptidase_M10_C Peptidase M10 serralysin C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 1k7qA01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1k7qA02
1FBLA 2ERQA 3K7LA 2ZJ7A 3KMEA 3DSLA 4L6TA 2Y6DA 1PWWA 1IAGA 3A70A 2W13A 3EHYA 3LQ0A 3EDZA 3O64A 1JANA 3LEAA 3A6ZA 1SMPA 1ZXCA 1QIBA 3LQBA 1XURA 2O3EA 1SATA 1AYKA 3MA2A 1Q3AA 3VTGA 3TS4A 4GWMA 2DDYA 1GKCA 3I7GA 1R55A 5I43A 3F15A 1HFSA 1WNIA 1I73A 3KRYA 3LAAA 2OY2A 4AXQA 1J7NA 3Q2GA 1GE6A 1D8MA 3LK8A 4A7BA 1C7KA 5CXLA 1QJIA 4FVLA 3HB2P 4AUOA 1XFXA 2W15A 1G12A 2SRTA 4JA1A 4CTHA 2OW9A 4H49A 2MLSA 3B8ZA 4IJOA 1RM8A 2WO9A 830CA 2CLTA 3ZXHA 5D2BA 2D1OA 1R54A 3WV3A 1AKLA 1B8YA 3LIRA 2K2GA 3O2XA 2XS3A 3LUNA 1BQOA 3KHIA 1HFCA 5CUHA 1IADA 4A3WA 5D1UA 5I4OA 3HDAP 1IAEA 4L19A 1D7XA 1A85A 3B92A 3LJTA 2K9CA 3N2VA 2TCLA 5H8XA 3OHOA 4H30A 3ZVSA 1OM6A 3AIGA 1QUAA 5BOTA 4FXYP 1RMZA 1SLNA 3EHXA 1OS2A 1SRPA 1CGLA 3HBVP 4G9LA 1UMSA 1YP1A 1K7IA 5L7FA 5I12A 3B2ZA 2WOAA 3Q2HA 1BSWA 4XM6A 1XFYA 1PWQA 3KECA 1CAQA 1UEAA 1Y93A 3LE9A 1KUHA 2V4BA 3LMCA 1BUDA 2I47A 4WK7A 1I1IP 2OW0A 3E8RA 4WKEA 1JIWP 3K7NA 2W12A 1ZP5A 1ZXVA 2OI0A 3LJZA 3BA0A 5CVWA 1C8TA 3LJGA 1GO8P 2E2DA 2N8RA 1KUKA 2J83A 4AYKA 1Y0VA 2OVXA 4FXQA 2X3AA 2JT6A 4H76A 1HV5A 4PKSA 3GBOA 1Z3JA 3WV2A 2MZIA 1MMPA 1USNA 2WO8A 1KBCA 1K7GA 5JMYA 3LUMA 2ZJ6A 1QJJA 1MMRA 4JQGA 4L63A 4Q1LA 5D3CA 2XQHA 1CK7A 1PWUA 1R1IA 3P1VA 1GO7P 1UTTA 4EFSA 3LKAA 3HDBA 2MLRA 4H3XA 4HMAA 2JSDA 2W14A 1UMTA 2DW2A 2JNPA 4XBHA 2Y6CA 1O0QA 2AIGP 1O0TA 5BOYA 4DV8A 1G49A 3WP8A 1BKCA 2ZVDA 2AYKA 2YO1A 1Y8JA 4AIGA 5I3MA 1I76A 1HY7A 3HY9A 4GR3A 1GE5A 2OW2A 3EDHA 3LA9A 3USNA 2ML2A 1B3DA 4GR8A 3U1RA 1EB6A 1XFVA 4JIJA 4G0DA 3CKIA 5I0LA 1ZVXA 2JT5A 3TVCA 1GE7A 4ILWD 1KAPP 3EDGA 4IN9A 1OM8A 4PKUA 4QKZA 2O36A 2FV9A 1D8FA 4GR0A 3AYUA 4I35A 1PWVA 3G42A 1ASTA 4ZR5A 3RTSA 1MMQA 2L0RA 2OXZA 1BKCI 2MZEA 5L79A 1FLSA 4IUWA 1XFUA 2OXWA 1IABA 1G9KA 3ELMA 1R1JA 3VI1A 1HTDA 3KMCA 1JK3A 3ZUKA 1JAOA 2DDFA 1MNCA 4WZVA 2YIGA 3TSKA 1JAQA 1CGFA 1KUGA 3DL1A 4ON1A 1XFWA 4JPAA 2PJTA 1UTZA 4PKRA 3P24A 5CXAA 3L0VA 1ZS0A 2OY4A 1ROSA 3OHLA 2OXUA 2MZHA 1BZSA 2KRJA 3UVCA 2YB9A 1JAPA 5D1SA 1KUFA 4I03A 1JH1A 5D7WA 2RJQA 1CGEA 2X7MA 3DPEA 1BUVM 3ULTA 1PWPA 3S6LA 1DTHA 2QPJA 1CIZA 2QUBA 3F19A 2Z8XA 4PKVA 4XM8A 1D5JA 4R3VA 1QIAA 2AGMA 2YO0A 3RTTA 5CZMA 4DPEA 1L6JA 2CKIA 4JP4A 3TT4A 1OM7A 3LGPA 4XM7A 3EWJA 3DNGA 3KEKA 2ERPA 1CQRA 4XCTA 1FM1A 5D1TA 3N2UA 3KWVC 1JJ9A 1SU3A 1BQQM 1C3IA 4DF9A 3SHIA 4H84A 4PKTA 4GUYA 3HBUP 4HX3A 1YOUA 3AYKA 2RJPA 2W0DA 5I2ZA 2X3CA 2JIHA 4GQLA 3EDIA 2OW1A 4WF6A 1CXVA 3F18A 1YQYA 3DPFA 2QUAA 3HYGA 2Z8ZA 1XFZA 1H71P 1P9HA 1A86A 2A8HA 1EAKA 1SLMA 1HOVA 2DW0A 3NTNA 1GXDA 2X3BA 2EROA 2DW1A 1OMJA 4H1QA 1S4BP 1IAAA 5B5OA 3G5CA 1K7QA 5BPAA 3HY7A 2HU6A 4WKIA 1DMTA 2XS4A 3WV1A 1BKCE 2E3XA 3LILA 1EUBA 4PKQA 1XUCA 1YCMA 4DD8A 1R1HA 1GKDA 2J0TA 2OZRA 1KUIA 1ZTQA 2Z2DA 1AF0A 2USNA 3V96B 3I7IA 4GWNA 1BM6A 3F17A 1OS9A 966CA 3DWBA 3NX7A 4J4MA 1IACA 2FV5A 3LIKA 4PKWA 3F16A 3F1AA 1ATLA 1G05A 456CA 1OO9A 4H82A 3L0TA 1JKYA 1QICA 1BIWA 1G4KA 3KEJA 1ND1A 1XUDA 5B5PA 4H2EA 4GF1A 1MMBA 2D1NA 2POJA 2OVZA 1JIZA 5LABA 4FU4A
chains in the Genus database with same CATH superfamily
1FBLA 2ERQA 3K7LA 2ZJ7A 3KMEA 3DSLA 4L6TA 2Y6DA 1PWWA 1IAGA 3A70A 2W13A 3DTKA 1OZ9A 3EHYA 3LQ0A 3EDZA 3O64A 1JANA 3LEAA 3A6ZA 1SMPA 1ZXCA 1QIBA 3LQBA 1XURA 2O3EA 1SATA 1AYKA 3MA2A 1Q3AA 3VTGA 3TS4A 4GWMA 2DDYA 1GKCA 3I7GA 1R55A 5I43A 3F15A 1HFSA 1WNIA 1I73A 3KRYA 3LAAA 2OY2A 4AXQA 1J7NA 3Q2GA 1GE6A 1D8MA 3LK8A 4A7BA 1C7KA 5CXLA 1QJIA 4FVLA 3HB2P 4AUOA 1XFXA 2W15A 1G12A 2SRTA 4JA1A 4CTHA 2OW9A 4H49A 2MLSA 3B8ZA 4IJOA 1RM8A 2WO9A 830CA 4DT5A 2CLTA 3ZXHA 5D2BA 2D1OA 1R54A 3WV3A 1AKLA 1B8YA 3LIRA 2K2GA 3O2XA 2XS3A 3LUNA 1BQOA 3KHIA 1HFCA 5CUHA 1IADA 4A3WA 5D1UA 5I4OA 3HDAP 1IAEA 4L19A 1D7XA 1A85A 3B92A 3LJTA 2K9CA 3N2VA 2TCLA 5H8XA 3OHOA 4H30A 3ZVSA 1OM6A 3AIGA 1QUAA 5BOTA 4FXYP 1RMZA 1SLNA 3EHXA 1OS2A 1SRPA 1CGLA 3HBVP 4G9LA 1UMSA 1YP1A 1K7IA 5L7FA 5I12A 3B2ZA 2WOAA 3Q2HA 1BSWA 4XM6A 1XM5A 1XFYA 1PWQA 3KECA 1CAQA 1UEAA 1Y93A 3LE9A 1KUHA 2V4BA 3LMCA 1BUDA 2I47A 4WK7A 1I1IP 2OW0A 3E8RA 4WKEA 1JIWP 3K7NA 2W12A 1ZP5A 1ZXVA 2OI0A 3LJZA 3BA0A 5CVWA 1C8TA 3LJGA 1GO8P 2E2DA 2N8RA 1KUKA 2J83A 4AYKA 1Y0VA 2OVXA 4FXQA 2X3AA 2JT6A 4H76A 1HV5A 4PKSA 3GBOA 1Z3JA 3WV2A 2MZIA 1MMPA 1USNA 2WO8A 1KBCA 1K7GA 5JMYA 3LUMA 2ZJ6A 1QJJA 1MMRA 4JQGA 4L63A 4Q1LA 5D3CA 2XQHA 1CK7A 1PWUA 1R1IA 3P1VA 1GO7P 1UTTA 4EFSA 3LKAA 3HDBA 2MLRA 4H3XA 4HMAA 2JSDA 2W14A 1UMTA 2DW2A 2JNPA 4XBHA 2Y6CA 1O0QA 2AIGP 1O0TA 5BOYA 4DV8A 1G49A 3WP8A 1BKCA 2ZVDA 2AYKA 2YO1A 1Y8JA 4AIGA 5I3MA 1I76A 1HY7A 3HY9A 4GR3A 1GE5A 2OW2A 3EDHA 3LA9A 3USNA 2ML2A 1XAXA 1B3DA 4GR8A 3U1RA 1EB6A 1XFVA 4JIJA 4G0DA 3CKIA 5I0LA 1ZVXA 2JT5A 3TVCA 1GE7A 4ILWD 1KAPP 3EDGA 4IN9A 1OM8A 4PKUA 4QKZA 2O36A 2FV9A 1D8FA 4GR0A 3AYUA 4I35A 1PWVA 3G42A 1ASTA 4ZR5A 3RTSA 1MMQA 2L0RA 2OXZA 1BKCI 2MZEA 5L79A 1FLSA 4IUWA 1XFUA 2OXWA 1IABA 1G9KA 3ELMA 1R1JA 3VI1A 1HTDA 3KMCA 1JK3A 3ZUKA 1JAOA 3DTIA 2DDFA 1MNCA 4WZVA 2YIGA 3TSKA 1JAQA 1CGFA 1KUGA 3DL1A 4ON1A 1XFWA 4JPAA 2PJTA 1UTZA 4PKRA 3P24A 5CXAA 3L0VA 1ZS0A 2OY4A 1ROSA 3OHLA 2OXUA 2MZHA 1BZSA 2KRJA 3UVCA 2YB9A 1JAPA 5D1SA 1KUFA 4I03A 1JH1A 5D7WA 2RJQA 1CGEA 2X7MA 3DPEA 1BUVM 3ULTA 1PWPA 1TVIA 3S6LA 1DTHA 2QPJA 1CIZA 2QUBA 3F19A 2Z8XA 4PKVA 4XM8A 1D5JA 4R3VA 1QIAA 2AGMA 2YO0A 3RTTA 5CZMA 4DPEA 1L6JA 2CKIA 4JP4A 3TT4A 1OM7A 3LGPA 4XM7A 3EWJA 3DNGA 3KEKA 2ERPA 1CQRA 4XCTA 1FM1A 5D1TA 3N2UA 3KWVC 1JJ9A 1SU3A 1BQQM 1C3IA 4DF9A 3SHIA 4H84A 4PKTA 4GUYA 3HBUP 4HX3A 1YOUA 3AYKA 2RJPA 2W0DA 4L7AA 5I2ZA 2X3CA 2JIHA 4GQLA 3EDIA 2YUFA 2OW1A 4WF6A 1CXVA 3F18A 1YQYA 3DPFA 2QUAA 3DTEA 3HYGA 2Z8ZA 1XFZA 1H71P 1P9HA 1A86A 2A8HA 1EAKA 1SLMA 1HOVA 2DW0A 3NTNA 1GXDA 2X3BA 2EROA 2DW1A 1OMJA 4H1QA 1S4BP 1IAAA 5B5OA 3G5CA 1K7QA 5BPAA 3HY7A 2HU6A 4WKIA 1DMTA 2XS4A 3WV1A 1BKCE 2E3XA 3LILA 1EUBA 4PKQA 1XUCA 1YCMA 4DD8A 1R1HA 1GKDA 2J0TA 2OZRA 1KUIA 1ZTQA 2Z2DA 1AF0A 2USNA 3V96B 3I7IA 4GWNA 1BM6A 3F17A 1OS9A 966CA 3DWBA 3NX7A 4J4MA 1IACA 2FV5A 3LIKA 4PKWA 3F16A 3F1AA 1ATLA 1G05A 456CA 1OO9A 4H82A 3L0TA 1JKYA 1QICA 1BIWA 1G4KA 3KEJA 1ND1A 1XUDA 5B5PA 4H2EA 4GF1A 1MMBA 2D1NA 2POJA 2OVZA 1JIZA 5LABA 4FU4A
chains in the Genus database with same CATH topology
1FBLA 2ERQA 3K7LA 2ZJ7A 3KMEA 3DSLA 4L6TA 2Y6DA 1PWWA 1IAGA 3A70A 2W13A 3DTKA 3EHYA 3LQ0A 3EDZA 3O64A 1JANA 3LEAA 3A6ZA 1SMPA 1ZXCA 1QIBA 3LQBA 1XURA 2O3EA 1SATA 1AYKA 3MA2A 1Q3AA 3VTGA 3TS4A 4GWMA 2DDYA 1GKCA 3I7GA 1R55A 5I43A 3F15A 1HFSA 1WNIA 1I73A 3KRYA 3LAAA 2OY2A 4AXQA 1J7NA 3Q2GA 1GE6A 1D8MA 3LK8A 4A7BA 1C7KA 5CXLA 1QJIA 4FVLA 3HB2P 4AUOA 1XFXA 2W15A 1G12A 2SRTA 4JA1A 4CTHA 2OW9A 4H49A 2MLSA 3B8ZA 4IJOA 1RM8A 2WO9A 830CA 2CLTA 3ZXHA 5D2BA 2D1OA 1R54A 3WV3A 1AKLA 1B8YA 3LIRA 2K2GA 3O2XA 2XS3A 3LUNA 1BQOA 3KHIA 1HFCA 5CUHA 1IADA 4A3WA 5D1UA 5I4OA 3HDAP 1IAEA 4L19A 1D7XA 1A85A 3B92A 3LJTA 2K9CA 3N2VA 2TCLA 5H8XA 3OHOA 4H30A 3ZVSA 1OM6A 3AIGA 1QUAA 5BOTA 4FXYP 1RMZA 1SLNA 3EHXA 1OS2A 1SRPA 1CGLA 3HBVP 4G9LA 1UMSA 1YP1A 1K7IA 5L7FA 5I12A 3B2ZA 2WOAA 3Q2HA 1BSWA 4XM6A 1XFYA 1PWQA 3KECA 1CAQA 1UEAA 1Y93A 3LE9A 1KUHA 2V4BA 3LMCA 1BUDA 2I47A 4WK7A 1I1IP 2OW0A 3E8RA 4WKEA 1JIWP 3K7NA 2W12A 1ZP5A 1ZXVA 2OI0A 3LJZA 3BA0A 5CVWA 1C8TA 3LJGA 1GO8P 2E2DA 2N8RA 1KUKA 2J83A 4AYKA 1Y0VA 2OVXA 4FXQA 2X3AA 2JT6A 4H76A 1HV5A 4PKSA 3GBOA 1Z3JA 3WV2A 2MZIA 1MMPA 1USNA 2WO8A 1KBCA 1K7GA 5JMYA 3LUMA 2ZJ6A 1QJJA 1MMRA 4JQGA 4L63A 4Q1LA 5D3CA 2XQHA 1CK7A 1PWUA 1R1IA 3P1VA 1GO7P 1UTTA 4EFSA 3LKAA 3HDBA 2MLRA 4H3XA 4HMAA 2JSDA 2W14A 1UMTA 2DW2A 2JNPA 4XBHA 2Y6CA 1O0QA 2AIGP 1O0TA 5BOYA 4DV8A 1G49A 3WP8A 1BKCA 2ZVDA 2AYKA 2YO1A 1Y8JA 4AIGA 5I3MA 1I76A 1HY7A 3HY9A 4GR3A 1GE5A 2OW2A 3EDHA 3LA9A 3USNA 2ML2A 1B3DA 4GR8A 3U1RA 1EB6A 1XFVA 4JIJA 4G0DA 3CKIA 5I0LA 1ZVXA 2JT5A 3TVCA 1GE7A 4ILWD 1KAPP 3EDGA 4IN9A 1OM8A 4PKUA 4QKZA 2O36A 2FV9A 1D8FA 4GR0A 3AYUA 4I35A 1PWVA 3G42A 1ASTA 4ZR5A 3RTSA 1MMQA 2L0RA 2OXZA 1BKCI 2MZEA 5L79A 1FLSA 4IUWA 1XFUA 2OXWA 1IABA 1G9KA 3ELMA 1R1JA 3VI1A 1HTDA 3KMCA 1JK3A 3ZUKA 1JAOA 3DTIA 2DDFA 1MNCA 4WZVA 2YIGA 3TSKA 1JAQA 1CGFA 1KUGA 3DL1A 4ON1A 1XFWA 4JPAA 2PJTA 1UTZA 4PKRA 3P24A 5CXAA 3L0VA 1ZS0A 2OY4A 1ROSA 3OHLA 2OXUA 2MZHA 1BZSA 2KRJA 3UVCA 2YB9A 1JAPA 5D1SA 1KUFA 4I03A 1JH1A 5D7WA 2RJQA 1CGEA 2X7MA 3DPEA 1BUVM 3ULTA 1PWPA 3S6LA 1DTHA 2QPJA 1CIZA 2QUBA 3F19A 2Z8XA 4PKVA 4XM8A 1D5JA 4R3VA 1QIAA 2AGMA 2YO0A 3RTTA 5CZMA 4DPEA 1L6JA 2CKIA 4JP4A 3TT4A 1OM7A 3LGPA 4XM7A 3EWJA 3DNGA 3KEKA 2ERPA 1CQRA 4XCTA 1FM1A 5D1TA 3N2UA 3KWVC 1JJ9A 1SU3A 1BQQM 1C3IA 4DF9A 3SHIA 4H84A 4PKTA 4GUYA 3HBUP 4HX3A 1YOUA 3AYKA 2RJPA 2W0DA 4L7AA 5I2ZA 2X3CA 2JIHA 4GQLA 3EDIA 2YUFA 2OW1A 4WF6A 1CXVA 3F18A 1YQYA 3DPFA 2QUAA 3DTEA 3HYGA 2Z8ZA 1XFZA 1H71P 1P9HA 1A86A 2A8HA 1EAKA 1SLMA 1HOVA 2DW0A 3NTNA 1GXDA 2X3BA 2EROA 2DW1A 1OMJA 4H1QA 1S4BP 1IAAA 5B5OA 3G5CA 1K7QA 5BPAA 3HY7A 2HU6A 4WKIA 1DMTA 2XS4A 3WV1A 1BKCE 2E3XA 3LILA 1EUBA 4PKQA 1XUCA 1YCMA 4DD8A 1R1HA 1GKDA 2J0TA 2OZRA 1KUIA 1ZTQA 2Z2DA 1AF0A 2USNA 3V96B 3I7IA 4GWNA 1BM6A 3F17A 1OS9A 966CA 3DWBA 3NX7A 4J4MA 1IACA 2FV5A 3LIKA 4PKWA 3F16A 3F1AA 1ATLA 1G05A 456CA 1OO9A 4H82A 3L0TA 1JKYA 1QICA 1BIWA 1G4KA 3KEJA 1ND1A 1XUDA 5B5PA 4H2EA 4GF1A 1MMBA 2D1NA 2POJA 2OVZA 1JIZA 5LABA 4FU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FBL A;  2ERQ A;  3K7L A;  2ZJ7 A;  3KME A;  3DSL A;  4L6T A;  2Y6D A;  1PWW A;  1IAG A;  3A70 A;  2W13 A;  3EHY A;  3LQ0 A;  3EDZ A;  3O64 A;  1JAN A;  3LEA A;  3A6Z A;  1SMP A;  1ZXC A;  1QIB A;  3LQB A;  1XUR A;  2O3E A;  1SAT A;  1AYK A;  3MA2 A;  1Q3A A;  3VTG A;  3TS4 A;  4GWM A;  2DDY A;  1GKC A;  3I7G A;  1R55 A;  5I43 A;  3F15 A;  1HFS A;  1WNI A;  1I73 A;  3KRY A;  3LAA A;  2OY2 A;  4AXQ A;  1J7N A;  3Q2G A;  1GE6 A;  1D8M A;  3LK8 A;  4A7B A;  1C7K A;  5CXL A;  1QJI A;  4FVL A;  3HB2 P;  4AUO A;  1XFX A;  2W15 A;  1G12 A;  2SRT A;  4JA1 A;  4CTH A;  2OW9 A;  4H49 A;  2MLS A;  3B8Z A;  4IJO A;  1RM8 A;  2WO9 A;  830C A;  2CLT A;  3ZXH A;  5D2B A;  2D1O A;  1R54 A;  3WV3 A;  1AKL A;  1B8Y A;  3LIR A;  2K2G A;  3O2X A;  2XS3 A;  3LUN A;  1BQO A;  3KHI A;  1HFC A;  5CUH A;  1IAD A;  4A3W A;  5D1U A;  5I4O A;  3HDA P;  1IAE A;  4L19 A;  1D7X A;  1A85 A;  3B92 A;  3LJT A;  2K9C A;  3N2V A;  2TCL A;  5H8X A;  3OHO A;  4H30 A;  3ZVS A;  1OM6 A;  3AIG A;  1QUA A;  5BOT A;  4FXY P;  1RMZ A;  1SLN A;  3EHX A;  1OS2 A;  1SRP A;  1CGL A;  3HBV P;  4G9L A;  1UMS A;  1YP1 A;  1K7I A;  5L7F A;  5I12 A;  3B2Z A;  2WOA A;  3Q2H A;  1BSW A;  4XM6 A;  1XFY A;  1PWQ A;  3KEC A;  1CAQ A;  1UEA A;  1Y93 A;  3LE9 A;  1KUH A;  2V4B A;  3LMC A;  1BUD A;  2I47 A;  4WK7 A;  1I1I P;  2OW0 A;  3E8R A;  4WKE A;  1JIW P;  3K7N A;  2W12 A;  1ZP5 A;  1ZXV A;  2OI0 A;  3LJZ A;  3BA0 A;  5CVW A;  1C8T A;  3LJG A;  1GO8 P;  2E2D A;  2N8R A;  1KUK A;  2J83 A;  4AYK A;  1Y0V A;  2OVX A;  4FXQ A;  2X3A A;  2JT6 A;  4H76 A;  1HV5 A;  4PKS A;  3GBO A;  1Z3J A;  3WV2 A;  2MZI A;  1MMP A;  1USN A;  2WO8 A;  1KBC A;  1K7G A;  5JMY A;  3LUM A;  2ZJ6 A;  1QJJ A;  1MMR A;  4JQG A;  4L63 A;  4Q1L A;  5D3C A;  2XQH A;  1CK7 A;  1PWU A;  1R1I A;  3P1V A;  1GO7 P;  1UTT A;  4EFS A;  3LKA A;  3HDB A;  2MLR A;  4H3X A;  4HMA A;  2JSD A;  2W14 A;  1UMT A;  2DW2 A;  2JNP A;  4XBH A;  2Y6C A;  1O0Q A;  2AIG P;  1O0T A;  5BOY A;  4DV8 A;  1G49 A;  3WP8 A;  1BKC A;  2ZVD A;  2AYK A;  2YO1 A;  1Y8J A;  4AIG A;  5I3M A;  1I76 A;  1HY7 A;  3HY9 A;  4GR3 A;  1GE5 A;  2OW2 A;  3EDH A;  3LA9 A;  3USN A;  2ML2 A;  1B3D A;  4GR8 A;  3U1R A;  1EB6 A;  1XFV A;  4JIJ A;  4G0D A;  3CKI A;  5I0L A;  1ZVX A;  2JT5 A;  3TVC A;  1GE7 A;  4ILW D;  1KAP P;  3EDG A;  4IN9 A;  1OM8 A;  4PKU A;  4QKZ A;  2O36 A;  2FV9 A;  1D8F A;  4GR0 A;  3AYU A;  4I35 A;  1PWV A;  3G42 A;  1AST A;  4ZR5 A;  3RTS A;  1MMQ A;  2L0R A;  2OXZ A;  1BKC I;  2MZE A;  5L79 A;  1FLS A;  4IUW A;  1XFU A;  2OXW A;  1IAB A;  1G9K A;  3ELM A;  1R1J A;  3VI1 A;  1HTD A;  3KMC A;  1JK3 A;  3ZUK A;  1JAO A;  2DDF A;  1MNC A;  4WZV A;  2YIG A;  3TSK A;  1JAQ A;  1CGF A;  1KUG A;  3DL1 A;  4ON1 A;  1XFW A;  4JPA A;  2PJT A;  1UTZ A;  4PKR A;  3P24 A;  5CXA A;  3L0V A;  1ZS0 A;  2OY4 A;  1ROS A;  3OHL A;  2OXU A;  2MZH A;  1BZS A;  2KRJ A;  3UVC A;  2YB9 A;  1JAP A;  5D1S A;  1KUF A;  4I03 A;  1JH1 A;  5D7W A;  2RJQ A;  1CGE A;  2X7M A;  3DPE A;  1BUV M;  3ULT A;  1PWP A;  3S6L A;  1DTH A;  2QPJ A;  1CIZ A;  2QUB A;  3F19 A;  2Z8X A;  4PKV A;  4XM8 A;  1D5J A;  4R3V A;  1QIA A;  2AGM A;  2YO0 A;  3RTT A;  5CZM A;  4DPE A;  1L6J A;  2CKI A;  4JP4 A;  3TT4 A;  1OM7 A;  3LGP A;  4XM7 A;  3EWJ A;  3DNG A;  3KEK A;  2ERP A;  1CQR A;  4XCT A;  1FM1 A;  5D1T A;  3N2U A;  3KWV C;  1JJ9 A;  1SU3 A;  1BQQ M;  1C3I A;  4DF9 A;  3SHI A;  4H84 A;  4PKT A;  4GUY A;  3HBU P;  4HX3 A;  1YOU A;  3AYK A;  2RJP A;  2W0D A;  5I2Z A;  2X3C A;  2JIH A;  4GQL A;  3EDI A;  2OW1 A;  4WF6 A;  1CXV A;  3F18 A;  1YQY A;  3DPF A;  2QUA A;  3HYG A;  2Z8Z A;  1XFZ A;  1H71 P;  1P9H A;  1A86 A;  2A8H A;  1EAK A;  1SLM A;  1HOV A;  2DW0 A;  3NTN A;  1GXD A;  2X3B A;  2ERO A;  2DW1 A;  1OMJ A;  4H1Q A;  1S4B P;  1IAA A;  5B5O A;  3G5C A;  1K7Q A;  5BPA A;  3HY7 A;  2HU6 A;  4WKI A;  1DMT A;  2XS4 A;  3WV1 A;  1BKC E;  2E3X A;  3LIL A;  1EUB A;  4PKQ A;  1XUC A;  1YCM A;  4DD8 A;  1R1H A;  1GKD A;  2J0T A;  2OZR A;  1KUI A;  1ZTQ A;  2Z2D A;  1AF0 A;  2USN A;  3V96 B;  3I7I A;  4GWN A;  1BM6 A;  3F17 A;  1OS9 A;  966C A;  3DWB A;  3NX7 A;  4J4M A;  1IAC A;  2FV5 A;  3LIK A;  4PKW A;  3F16 A;  3F1A A;  1ATL A;  1G05 A;  456C A;  1OO9 A;  4H82 A;  3L0T A;  1JKY A;  1QIC A;  1BIW A;  1G4K A;  3KEJ A;  1ND1 A;  1XUD A;  5B5P A;  4H2E A;  4GF1 A;  1MMB A;  2D1N A;  2POJ A;  2OVZ A;  1JIZ A;  5LAB A;  4FU4 A; 
#chains in the Genus database with same CATH topology
 1FBL A;  2ERQ A;  3K7L A;  2ZJ7 A;  3KME A;  3DSL A;  4L6T A;  2Y6D A;  1PWW A;  1IAG A;  3A70 A;  2W13 A;  3DTK A;  1OZ9 A;  3EHY A;  3LQ0 A;  3EDZ A;  3O64 A;  1JAN A;  3LEA A;  3A6Z A;  1SMP A;  1ZXC A;  1QIB A;  3LQB A;  1XUR A;  2O3E A;  1SAT A;  1AYK A;  3MA2 A;  1Q3A A;  3VTG A;  3TS4 A;  4GWM A;  2DDY A;  1GKC A;  3I7G A;  1R55 A;  5I43 A;  3F15 A;  1HFS A;  1WNI A;  1I73 A;  3KRY A;  3LAA A;  2OY2 A;  4AXQ A;  1J7N A;  3Q2G A;  1GE6 A;  1D8M A;  3LK8 A;  4A7B A;  1C7K A;  5CXL A;  1QJI A;  4FVL A;  3HB2 P;  4AUO A;  1XFX A;  2W15 A;  1G12 A;  2SRT A;  4JA1 A;  4CTH A;  2OW9 A;  4H49 A;  2MLS A;  3B8Z A;  4IJO A;  1RM8 A;  2WO9 A;  830C A;  4DT5 A;  2CLT A;  3ZXH A;  5D2B A;  2D1O A;  1R54 A;  3WV3 A;  1AKL A;  1B8Y A;  3LIR A;  2K2G A;  3O2X A;  2XS3 A;  3LUN A;  1BQO A;  3KHI A;  1HFC A;  5CUH A;  1IAD A;  4A3W A;  5D1U A;  5I4O A;  3HDA P;  1IAE A;  4L19 A;  1D7X A;  1A85 A;  3B92 A;  3LJT A;  2K9C A;  3N2V A;  2TCL A;  5H8X A;  3OHO A;  4H30 A;  3ZVS A;  1OM6 A;  3AIG A;  1QUA A;  5BOT A;  4FXY P;  1RMZ A;  1SLN A;  3EHX A;  1OS2 A;  1SRP A;  1CGL A;  3HBV P;  4G9L A;  1UMS A;  1YP1 A;  1K7I A;  5L7F A;  5I12 A;  3B2Z A;  2WOA A;  3Q2H A;  1BSW A;  4XM6 A;  1XM5 A;  1XFY A;  1PWQ A;  3KEC A;  1CAQ A;  1UEA A;  1Y93 A;  3LE9 A;  1KUH A;  2V4B A;  3LMC A;  1BUD A;  2I47 A;  4WK7 A;  1I1I P;  2OW0 A;  3E8R A;  4WKE A;  1JIW P;  3K7N A;  2W12 A;  1ZP5 A;  1ZXV A;  2OI0 A;  3LJZ A;  3BA0 A;  5CVW A;  1C8T A;  3LJG A;  1GO8 P;  2E2D A;  2N8R A;  1KUK A;  2J83 A;  4AYK A;  1Y0V A;  2OVX A;  4FXQ A;  2X3A A;  2JT6 A;  4H76 A;  1HV5 A;  4PKS A;  3GBO A;  1Z3J A;  3WV2 A;  2MZI A;  1MMP A;  1USN A;  2WO8 A;  1KBC A;  1K7G A;  5JMY A;  3LUM A;  2ZJ6 A;  1QJJ A;  1MMR A;  4JQG A;  4L63 A;  4Q1L A;  5D3C A;  2XQH A;  1CK7 A;  1PWU A;  1R1I A;  3P1V A;  1GO7 P;  1UTT A;  4EFS A;  3LKA A;  3HDB A;  2MLR A;  4H3X A;  4HMA A;  2JSD A;  2W14 A;  1UMT A;  2DW2 A;  2JNP A;  4XBH A;  2Y6C A;  1O0Q A;  2AIG P;  1O0T A;  5BOY A;  4DV8 A;  1G49 A;  3WP8 A;  1BKC A;  2ZVD A;  2AYK A;  2YO1 A;  1Y8J A;  4AIG A;  5I3M A;  1I76 A;  1HY7 A;  3HY9 A;  4GR3 A;  1GE5 A;  2OW2 A;  3EDH A;  3LA9 A;  3USN A;  2ML2 A;  1XAX A;  1B3D A;  4GR8 A;  3U1R A;  1EB6 A;  1XFV A;  4JIJ A;  4G0D A;  3CKI A;  5I0L A;  1ZVX A;  2JT5 A;  3TVC A;  1GE7 A;  4ILW D;  1KAP P;  3EDG A;  4IN9 A;  1OM8 A;  4PKU A;  4QKZ A;  2O36 A;  2FV9 A;  1D8F A;  4GR0 A;  3AYU A;  4I35 A;  1PWV A;  3G42 A;  1AST A;  4ZR5 A;  3RTS A;  1MMQ A;  2L0R A;  2OXZ A;  1BKC I;  2MZE A;  5L79 A;  1FLS A;  4IUW A;  1XFU A;  2OXW A;  1IAB A;  1G9K A;  3ELM A;  1R1J A;  3VI1 A;  1HTD A;  3KMC A;  1JK3 A;  3ZUK A;  1JAO A;  3DTI A;  2DDF A;  1MNC A;  4WZV A;  2YIG A;  3TSK A;  1JAQ A;  1CGF A;  1KUG A;  3DL1 A;  4ON1 A;  1XFW A;  4JPA A;  2PJT A;  1UTZ A;  4PKR A;  3P24 A;  5CXA A;  3L0V A;  1ZS0 A;  2OY4 A;  1ROS A;  3OHL A;  2OXU A;  2MZH A;  1BZS A;  2KRJ A;  3UVC A;  2YB9 A;  1JAP A;  5D1S A;  1KUF A;  4I03 A;  1JH1 A;  5D7W A;  2RJQ A;  1CGE A;  2X7M A;  3DPE A;  1BUV M;  3ULT A;  1PWP A;  1TVI A;  3S6L A;  1DTH A;  2QPJ A;  1CIZ A;  2QUB A;  3F19 A;  2Z8X A;  4PKV A;  4XM8 A;  1D5J A;  4R3V A;  1QIA A;  2AGM A;  2YO0 A;  3RTT A;  5CZM A;  4DPE A;  1L6J A;  2CKI A;  4JP4 A;  3TT4 A;  1OM7 A;  3LGP A;  4XM7 A;  3EWJ A;  3DNG A;  3KEK A;  2ERP A;  1CQR A;  4XCT A;  1FM1 A;  5D1T A;  3N2U A;  3KWV C;  1JJ9 A;  1SU3 A;  1BQQ M;  1C3I A;  4DF9 A;  3SHI A;  4H84 A;  4PKT A;  4GUY A;  3HBU P;  4HX3 A;  1YOU A;  3AYK A;  2RJP A;  2W0D A;  4L7A A;  5I2Z A;  2X3C A;  2JIH A;  4GQL A;  3EDI A;  2YUF A;  2OW1 A;  4WF6 A;  1CXV A;  3F18 A;  1YQY A;  3DPF A;  2QUA A;  3DTE A;  3HYG A;  2Z8Z A;  1XFZ A;  1H71 P;  1P9H A;  1A86 A;  2A8H A;  1EAK A;  1SLM A;  1HOV A;  2DW0 A;  3NTN A;  1GXD A;  2X3B A;  2ERO A;  2DW1 A;  1OMJ A;  4H1Q A;  1S4B P;  1IAA A;  5B5O A;  3G5C A;  1K7Q A;  5BPA A;  3HY7 A;  2HU6 A;  4WKI A;  1DMT A;  2XS4 A;  3WV1 A;  1BKC E;  2E3X A;  3LIL A;  1EUB A;  4PKQ A;  1XUC A;  1YCM A;  4DD8 A;  1R1H A;  1GKD A;  2J0T A;  2OZR A;  1KUI A;  1ZTQ A;  2Z2D A;  1AF0 A;  2USN A;  3V96 B;  3I7I A;  4GWN A;  1BM6 A;  3F17 A;  1OS9 A;  966C A;  3DWB A;  3NX7 A;  4J4M A;  1IAC A;  2FV5 A;  3LIK A;  4PKW A;  3F16 A;  3F1A A;  1ATL A;  1G05 A;  456C A;  1OO9 A;  4H82 A;  3L0T A;  1JKY A;  1QIC A;  1BIW A;  1G4K A;  3KEJ A;  1ND1 A;  1XUD A;  5B5P A;  4H2E A;  4GF1 A;  1MMB A;  2D1N A;  2POJ A;  2OVZ A;  1JIZ A;  5LAB A;  4FU4 A; 
#chains in the Genus database with same CATH homology
 1FBL A;  2ERQ A;  3K7L A;  2ZJ7 A;  3KME A;  3DSL A;  4L6T A;  2Y6D A;  1PWW A;  1IAG A;  3A70 A;  2W13 A;  3DTK A;  3EHY A;  3LQ0 A;  3EDZ A;  3O64 A;  1JAN A;  3LEA A;  3A6Z A;  1SMP A;  1ZXC A;  1QIB A;  3LQB A;  1XUR A;  2O3E A;  1SAT A;  1AYK A;  3MA2 A;  1Q3A A;  3VTG A;  3TS4 A;  4GWM A;  2DDY A;  1GKC A;  3I7G A;  1R55 A;  5I43 A;  3F15 A;  1HFS A;  1WNI A;  1I73 A;  3KRY A;  3LAA A;  2OY2 A;  4AXQ A;  1J7N A;  3Q2G A;  1GE6 A;  1D8M A;  3LK8 A;  4A7B A;  1C7K A;  5CXL A;  1QJI A;  4FVL A;  3HB2 P;  4AUO A;  1XFX A;  2W15 A;  1G12 A;  2SRT A;  4JA1 A;  4CTH A;  2OW9 A;  4H49 A;  2MLS A;  3B8Z A;  4IJO A;  1RM8 A;  2WO9 A;  830C A;  2CLT A;  3ZXH A;  5D2B A;  2D1O A;  1R54 A;  3WV3 A;  1AKL A;  1B8Y A;  3LIR A;  2K2G A;  3O2X A;  2XS3 A;  3LUN A;  1BQO A;  3KHI A;  1HFC A;  5CUH A;  1IAD A;  4A3W A;  5D1U A;  5I4O A;  3HDA P;  1IAE A;  4L19 A;  1D7X A;  1A85 A;  3B92 A;  3LJT A;  2K9C A;  3N2V A;  2TCL A;  5H8X A;  3OHO A;  4H30 A;  3ZVS A;  1OM6 A;  3AIG A;  1QUA A;  5BOT A;  4FXY P;  1RMZ A;  1SLN A;  3EHX A;  1OS2 A;  1SRP A;  1CGL A;  3HBV P;  4G9L A;  1UMS A;  1YP1 A;  1K7I A;  5L7F A;  5I12 A;  3B2Z A;  2WOA A;  3Q2H A;  1BSW A;  4XM6 A;  1XFY A;  1PWQ A;  3KEC A;  1CAQ A;  1UEA A;  1Y93 A;  3LE9 A;  1KUH A;  2V4B A;  3LMC A;  1BUD A;  2I47 A;  4WK7 A;  1I1I P;  2OW0 A;  3E8R A;  4WKE A;  1JIW P;  3K7N A;  2W12 A;  1ZP5 A;  1ZXV A;  2OI0 A;  3LJZ A;  3BA0 A;  5CVW A;  1C8T A;  3LJG A;  1GO8 P;  2E2D A;  2N8R A;  1KUK A;  2J83 A;  4AYK A;  1Y0V A;  2OVX A;  4FXQ A;  2X3A A;  2JT6 A;  4H76 A;  1HV5 A;  4PKS A;  3GBO A;  1Z3J A;  3WV2 A;  2MZI A;  1MMP A;  1USN A;  2WO8 A;  1KBC A;  1K7G A;  5JMY A;  3LUM A;  2ZJ6 A;  1QJJ A;  1MMR A;  4JQG A;  4L63 A;  4Q1L A;  5D3C A;  2XQH A;  1CK7 A;  1PWU A;  1R1I A;  3P1V A;  1GO7 P;  1UTT A;  4EFS A;  3LKA A;  3HDB A;  2MLR A;  4H3X A;  4HMA A;  2JSD A;  2W14 A;  1UMT A;  2DW2 A;  2JNP A;  4XBH A;  2Y6C A;  1O0Q A;  2AIG P;  1O0T A;  5BOY A;  4DV8 A;  1G49 A;  3WP8 A;  1BKC A;  2ZVD A;  2AYK A;  2YO1 A;  1Y8J A;  4AIG A;  5I3M A;  1I76 A;  1HY7 A;  3HY9 A;  4GR3 A;  1GE5 A;  2OW2 A;  3EDH A;  3LA9 A;  3USN A;  2ML2 A;  1B3D A;  4GR8 A;  3U1R A;  1EB6 A;  1XFV A;  4JIJ A;  4G0D A;  3CKI A;  5I0L A;  1ZVX A;  2JT5 A;  3TVC A;  1GE7 A;  4ILW D;  1KAP P;  3EDG A;  4IN9 A;  1OM8 A;  4PKU A;  4QKZ A;  2O36 A;  2FV9 A;  1D8F A;  4GR0 A;  3AYU A;  4I35 A;  1PWV A;  3G42 A;  1AST A;  4ZR5 A;  3RTS A;  1MMQ A;  2L0R A;  2OXZ A;  1BKC I;  2MZE A;  5L79 A;  1FLS A;  4IUW A;  1XFU A;  2OXW A;  1IAB A;  1G9K A;  3ELM A;  1R1J A;  3VI1 A;  1HTD A;  3KMC A;  1JK3 A;  3ZUK A;  1JAO A;  3DTI A;  2DDF A;  1MNC A;  4WZV A;  2YIG A;  3TSK A;  1JAQ A;  1CGF A;  1KUG A;  3DL1 A;  4ON1 A;  1XFW A;  4JPA A;  2PJT A;  1UTZ A;  4PKR A;  3P24 A;  5CXA A;  3L0V A;  1ZS0 A;  2OY4 A;  1ROS A;  3OHL A;  2OXU A;  2MZH A;  1BZS A;  2KRJ A;  3UVC A;  2YB9 A;  1JAP A;  5D1S A;  1KUF A;  4I03 A;  1JH1 A;  5D7W A;  2RJQ A;  1CGE A;  2X7M A;  3DPE A;  1BUV M;  3ULT A;  1PWP A;  3S6L A;  1DTH A;  2QPJ A;  1CIZ A;  2QUB A;  3F19 A;  2Z8X A;  4PKV A;  4XM8 A;  1D5J A;  4R3V A;  1QIA A;  2AGM A;  2YO0 A;  3RTT A;  5CZM A;  4DPE A;  1L6J A;  2CKI A;  4JP4 A;  3TT4 A;  1OM7 A;  3LGP A;  4XM7 A;  3EWJ A;  3DNG A;  3KEK A;  2ERP A;  1CQR A;  4XCT A;  1FM1 A;  5D1T A;  3N2U A;  3KWV C;  1JJ9 A;  1SU3 A;  1BQQ M;  1C3I A;  4DF9 A;  3SHI A;  4H84 A;  4PKT A;  4GUY A;  3HBU P;  4HX3 A;  1YOU A;  3AYK A;  2RJP A;  2W0D A;  4L7A A;  5I2Z A;  2X3C A;  2JIH A;  4GQL A;  3EDI A;  2YUF A;  2OW1 A;  4WF6 A;  1CXV A;  3F18 A;  1YQY A;  3DPF A;  2QUA A;  3DTE A;  3HYG A;  2Z8Z A;  1XFZ A;  1H71 P;  1P9H A;  1A86 A;  2A8H A;  1EAK A;  1SLM A;  1HOV A;  2DW0 A;  3NTN A;  1GXD A;  2X3B A;  2ERO A;  2DW1 A;  1OMJ A;  4H1Q A;  1S4B P;  1IAA A;  5B5O A;  3G5C A;  1K7Q A;  5BPA A;  3HY7 A;  2HU6 A;  4WKI A;  1DMT A;  2XS4 A;  3WV1 A;  1BKC E;  2E3X A;  3LIL A;  1EUB A;  4PKQ A;  1XUC A;  1YCM A;  4DD8 A;  1R1H A;  1GKD A;  2J0T A;  2OZR A;  1KUI A;  1ZTQ A;  2Z2D A;  1AF0 A;  2USN A;  3V96 B;  3I7I A;  4GWN A;  1BM6 A;  3F17 A;  1OS9 A;  966C A;  3DWB A;  3NX7 A;  4J4M A;  1IAC A;  2FV5 A;  3LIK A;  4PKW A;  3F16 A;  3F1A A;  1ATL A;  1G05 A;  456C A;  1OO9 A;  4H82 A;  3L0T A;  1JKY A;  1QIC A;  1BIW A;  1G4K A;  3KEJ A;  1ND1 A;  1XUD A;  5B5P A;  4H2E A;  4GF1 A;  1MMB A;  2D1N A;  2POJ A;  2OVZ A;  1JIZ A;  5LAB A;  4FU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...