1K7QA

Prtc from erwinia chrysanthemi: e189a mutant
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
462
structure length
462
Chain Sequence
ANTSSAYNSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPGSEEYGRQTFTHAIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSIMSYWGENETGADYNGHYGGAPMIDDIAAIQRLYGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHGVTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLSAFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDIIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SECRETED PROTEASE C
publication title Protease C of Erwinia chrysanthemi: The Crystal Structure and Role of Amino Acids Y228 and E189
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 162
structure length 462
sequence length 462
ec nomenclature ec 3.4.24.40: Serralysin.
pdb deposition date 2001-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
A PF00413 Peptidase_M10 Matrixin
A PF08548 Peptidase_M10_C Peptidase M10 serralysin C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 1k7qA01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1k7qA02
4XBHA 2OW2A 3AIGA 1GO7P 2WO9A 4GF1A 5D2BA 5H8XA 4G9LA 1JJ9A 1R55A 1DMTA 1JKYA 3ZUKA 2K9CA 2RJQA 2CLTA 1EB6A 2YO0A 1ZS0A 3KRYA 2AGMA 1CGFA 1PWQA 1WNIA 5JMYA 2YB9A 4JA1A 2AYKA 1KUKA 1CGLA 1G4KA 1HV5A 3USNA 1QJIA 1UMSA 2OXZA 1ZXCA 1GO8P 4DPEA 4H49A 1BQQM 1R54A 1FBLA 2RJPA 1CIZA 2X3CA 1XUDA 3HB2P 1MMQA 1OS2A 3LAAA 1L6JA 1PWVA 3E8RA 1D8MA 2I47A 1Y8JA 4Q1LA 4L6TA 2OZRA 2Y6CA 1CXVA 3LK8A 1K7GA 1RM8A 1KBCA 2DDFA 4L63A 1C8TA 2AIGP 3HYGA 2DW1A 1JK3A 4H2EA 4A3WA 1GE7A 2YIGA 3LJTA 1EAKA 1HTDA 1R1HA 2K2GA 1SLMA 2OW1A 3LUMA 2J83A 1PWPA 2JIHA 4H1QA 2OVZA 1OM8A 1QIAA 2HU6A 4XM8A 1RMZA 3KMCA 3P1VA 3L0VA 1EUBA 1QJJA 4XM7A 5BOYA 2MZHA 3K7LA 4PKUA 2X3BA 1XFVA 1XFXA 3LQBA 1UMTA 3ZVSA 3GBOA 4PKWA 2XS4A 2Z2DA 5I2ZA 2POJA 1I1IP 1G05A 4AYKA 3HDBA 4ZR5A 1XFZA 2DW0A 4J4MA 5B5PA 1BUVM 2OXUA 3AYKA 1D5JA 2JT5A 2CKIA 1ND1A 4FXQA 4WKIA 3I7IA 3LA9A 1FLSA 5L7FA 1XFWA 1BKCE 2JSDA 3A6ZA 3DWBA 1D7XA 1PWUA 3ZXHA 3K7NA 3KEKA 3WV2A 2PJTA 2E2DA 5LABA 4H3XA 4WKEA 3LMCA 3B8ZA 1ATLA 3LE9A 4ILWD 1BZSA 1D8FA 1Z3JA 2SRTA 1XFUA 1CK7A 3Q2GA 2DW2A 3DPFA 4WK7A 1JAOA 5I0LA 1OS9A 2ZVDA 3F1AA 3RTSA 4GWNA 1H71P 1HOVA 830CA 2W0DA 4JP4A 2OY4A 1MMRA 3EWJA 4PKSA 1O0TA 3G5CA 5I12A 2ML2A 3KHIA 3WP8A 4PKVA 1BIWA 4PKRA 3MA2A 2MLSA 2L0RA 1IACA 2W13A 4IN9A 2X3AA 4R3VA 3HDAP 3OHOA 3LKAA 1I76A 1MNCA 3RTTA 2TCLA 1IAEA 4L19A 1ZTQA 5I43A 1ZXVA 1Y0VA 5CUHA 5D3CA 3TS4A 4CTHA 4AXQA 2QPJA 3F18A 4AIGA 3EDHA 1B3DA 4A7BA 3HBVP 2O36A 1YP1A 3EDGA 2O3EA 5L79A 1K7IA 2USNA 3KMEA 2W12A 1MMBA 3NX7A 2QUBA 3KWVC 1KUGA 1R1JA 1YCMA 1BM6A 3LIKA 2MZEA 4GQLA 2ERQA 3DL1A 1ZP5A 1G9KA 1BKCA 4FVLA 2JNPA 3TT4A 1PWWA 1JANA 4GWMA 1XURA 1AKLA 3LJZA 1BQOA 1GE5A 3O2XA 3S6LA 4FU4A 1C3IA 4DV8A 1R1IA 4WZVA 3VTGA 3F16A 3DNGA 1KUHA 2OY2A 3LGPA 2WOAA 5I3MA 1G49A 3NTNA 1QIBA 3O64A 3B2ZA 3ELMA 1IABA 3DPEA 4G0DA 3UVCA 1KUFA 1IAAA 1OM6A 3I7GA 4HMAA 2JT6A 2MLRA 1UTTA 1Q3AA 3HY9A 1HY7A 1SRPA 456CA 1SATA 3LJGA 1BKCI 1JAQA 2EROA 966CA 2MZIA 2XQHA 4FXYP 3HY7A 2OVXA 2J0TA 4AUOA 4I35A 2Y6DA 1A86A 2FV9A 3V96B 1I73A 3N2UA 4GR8A 1CQRA 1ZVXA 1SLNA 3LILA 4XM6A 1J7NA 1UTZA 1AYKA 4I03A 3L0TA 1S4BP 3EHXA 1K7QA 5B5OA 2ZJ6A 3CKIA 1YQYA 1MMPA 4DD8A 1GE6A 2D1OA 1G12A 1OO9A 1IAGA 1HFCA 1JIZA 1AF0A 2XS3A 4JQGA 5D1SA 4GR3A 5CVWA 2ZJ7A 1ROSA 4JIJA 1A85A 1UEAA 1USNA 3ULTA 1BUDA 2X7MA 5D1TA 2A8HA 4H76A 1JAPA 2KRJA 3WV1A 1C7KA 1QUAA 2OW9A 2YO1A 2QUAA 4IUWA 1BSWA 3KECA 1XFYA 3VI1A 3EHYA 1YOUA 5I4OA 1GKDA 2V4BA 3F19A 2E3XA 1Y93A 2DDYA 1SU3A 2D1NA 4WF6A 1OM7A 1IADA 1O0QA 4PKQA 3U1RA 2Z8ZA 4DF9A 3BA0A 4ON1A 1GKCA 1FM1A 1CGEA 4IJOA 2ERPA 4QKZA 3TVCA 2FV5A 2Z8XA 4GR0A 1KUIA 3LUNA 4XCTA 3AYUA 3EDZA 3TSKA 2OI0A 4HX3A 1B8YA 3P24A 4H84A 5BPAA 3KEJA 3G42A 5CZMA 3LEAA 1JH1A 1GXDA 5D1UA 1KAPP 2OXWA 1XUCA 1ASTA 3F15A 4H30A 1HFSA 3A70A 5CXLA 2WO8A 3F17A 3OHLA 4PKTA 5CXAA 1DTHA 5D7WA 3LIRA 3Q2HA 1JIWP 3SHIA 4H82A 2W14A 3LQ0A 3HBUP 1QICA 1SMPA 2N8RA 1CAQA 3N2VA 5BOTA 2OW0A 4GUYA 4EFSA 4JPAA 1OMJA 3B92A 3WV3A 1P9HA 3DSLA 3EDIA 2W15A
chains in the Genus database with same CATH superfamily
4XBHA 2OW2A 3AIGA 1GO7P 2WO9A 4GF1A 5D2BA 5H8XA 4G9LA 1JJ9A 1R55A 1DMTA 1JKYA 3ZUKA 2K9CA 2RJQA 2CLTA 1EB6A 2YO0A 1ZS0A 3KRYA 2AGMA 1CGFA 1PWQA 1WNIA 5JMYA 2YB9A 4JA1A 2AYKA 1KUKA 1CGLA 1G4KA 1HV5A 3USNA 1QJIA 1UMSA 2OXZA 1ZXCA 1GO8P 4DPEA 4H49A 1BQQM 1R54A 1FBLA 2RJPA 1CIZA 2X3CA 1XUDA 3HB2P 1MMQA 4DT5A 1OS2A 3LAAA 1L6JA 1PWVA 3E8RA 1D8MA 2I47A 1Y8JA 4Q1LA 4L6TA 2OZRA 2Y6CA 1CXVA 3LK8A 1K7GA 1RM8A 1KBCA 2DDFA 4L63A 1C8TA 2AIGP 3HYGA 2DW1A 1JK3A 4H2EA 4A3WA 1GE7A 2YIGA 3LJTA 1EAKA 1HTDA 1R1HA 2K2GA 1SLMA 2OW1A 3LUMA 2J83A 1PWPA 2JIHA 4H1QA 2OVZA 1OM8A 1QIAA 2HU6A 4XM8A 1RMZA 3KMCA 3P1VA 3L0VA 1EUBA 1QJJA 4XM7A 5BOYA 2MZHA 4L7AA 3K7LA 4PKUA 2X3BA 1XFVA 1XFXA 3LQBA 1UMTA 3ZVSA 3GBOA 4PKWA 2XS4A 2Z2DA 5I2ZA 2POJA 1I1IP 1G05A 4AYKA 3HDBA 4ZR5A 1XFZA 2DW0A 4J4MA 5B5PA 1BUVM 2OXUA 3AYKA 1D5JA 2JT5A 2CKIA 1ND1A 4FXQA 4WKIA 3I7IA 3LA9A 1FLSA 5L7FA 1XFWA 1BKCE 2JSDA 3A6ZA 3DWBA 1D7XA 1PWUA 3ZXHA 3K7NA 3KEKA 3WV2A 2PJTA 2E2DA 5LABA 4H3XA 4WKEA 3LMCA 3B8ZA 1ATLA 3LE9A 4ILWD 1BZSA 1D8FA 1Z3JA 2SRTA 1XFUA 1CK7A 3Q2GA 2DW2A 3DPFA 4WK7A 1JAOA 5I0LA 1OS9A 2ZVDA 3F1AA 3RTSA 4GWNA 1H71P 1HOVA 830CA 2W0DA 4JP4A 2OY4A 1MMRA 3EWJA 4PKSA 1O0TA 3G5CA 5I12A 2ML2A 3KHIA 3WP8A 4PKVA 1BIWA 4PKRA 3MA2A 2MLSA 2L0RA 1IACA 2W13A 4IN9A 2X3AA 4R3VA 3HDAP 3OHOA 3LKAA 1I76A 1MNCA 3RTTA 2TCLA 1IAEA 4L19A 1ZTQA 5I43A 1ZXVA 1Y0VA 5CUHA 5D3CA 3TS4A 4CTHA 4AXQA 2QPJA 3F18A 4AIGA 3EDHA 1B3DA 4A7BA 3HBVP 2O36A 1YP1A 3EDGA 2O3EA 5L79A 1K7IA 2USNA 3KMEA 2W12A 1MMBA 3NX7A 2QUBA 3KWVC 1KUGA 1R1JA 1YCMA 1BM6A 3LIKA 2MZEA 4GQLA 2ERQA 3DL1A 1ZP5A 1G9KA 1BKCA 4FVLA 2JNPA 3TT4A 1PWWA 1JANA 4GWMA 1XURA 1AKLA 3LJZA 1BQOA 1GE5A 3O2XA 3S6LA 4FU4A 1C3IA 4DV8A 1R1IA 4WZVA 3VTGA 3F16A 3DNGA 1KUHA 2OY2A 3LGPA 2WOAA 5I3MA 1G49A 3NTNA 1QIBA 3O64A 3B2ZA 3ELMA 1IABA 3DPEA 4G0DA 3UVCA 1KUFA 1IAAA 1OM6A 3I7GA 4HMAA 2JT6A 2MLRA 1UTTA 1Q3AA 3HY9A 1HY7A 1SRPA 456CA 1SATA 3LJGA 1BKCI 1JAQA 2EROA 966CA 2MZIA 2XQHA 3DTIA 3HY7A 4FXYP 2OVXA 2J0TA 4AUOA 4I35A 2Y6DA 1A86A 2FV9A 3V96B 1I73A 3N2UA 4GR8A 1CQRA 1ZVXA 1SLNA 3LILA 4XM6A 1J7NA 1UTZA 1AYKA 4I03A 3L0TA 1S4BP 3EHXA 1K7QA 5B5OA 2ZJ6A 3CKIA 1YQYA 3DTEA 1MMPA 4DD8A 1GE6A 1XAXA 2D1OA 1G12A 1OO9A 1IAGA 1HFCA 1JIZA 1AF0A 2XS3A 4JQGA 5D1SA 4GR3A 5CVWA 2ZJ7A 1ROSA 4JIJA 1A85A 1UEAA 1USNA 3ULTA 1BUDA 2X7MA 5D1TA 2A8HA 4H76A 1JAPA 1TVIA 2KRJA 3WV1A 1C7KA 1QUAA 2OW9A 2YO1A 2QUAA 4IUWA 1BSWA 3KECA 1XFYA 3VI1A 3EHYA 1YOUA 5I4OA 1GKDA 2V4BA 3F19A 2E3XA 1Y93A 2DDYA 1SU3A 2D1NA 4WF6A 1OM7A 1IADA 1O0QA 4PKQA 3U1RA 2Z8ZA 4DF9A 3BA0A 4ON1A 1GKCA 1FM1A 1CGEA 4IJOA 2ERPA 4QKZA 3TVCA 2FV5A 2Z8XA 4GR0A 1KUIA 3LUNA 1XM5A 4XCTA 3AYUA 3EDZA 3TSKA 2OI0A 4HX3A 1B8YA 3P24A 4H84A 5BPAA 3KEJA 3G42A 5CZMA 3LEAA 1JH1A 2YUFA 1GXDA 5D1UA 1KAPP 2OXWA 1XUCA 1ASTA 3F15A 4H30A 1HFSA 3A70A 5CXLA 2WO8A 3F17A 3OHLA 4PKTA 5CXAA 1DTHA 5D7WA 3LIRA 3Q2HA 1JIWP 3SHIA 4H82A 2W14A 3LQ0A 3HBUP 1QICA 1SMPA 2N8RA 1CAQA 1OZ9A 3DTKA 3N2VA 5BOTA 2OW0A 4GUYA 4EFSA 4JPAA 1OMJA 3B92A 3WV3A 1P9HA 3DSLA 3EDIA 2W15A
chains in the Genus database with same CATH topology
4XBHA 2OW2A 3AIGA 1GO7P 2WO9A 4GF1A 5D2BA 5H8XA 4G9LA 1JJ9A 1R55A 1DMTA 1JKYA 3ZUKA 2K9CA 2RJQA 2CLTA 1EB6A 2YO0A 1ZS0A 3KRYA 2AGMA 1CGFA 1PWQA 1WNIA 5JMYA 2YB9A 4JA1A 2AYKA 1KUKA 1CGLA 1G4KA 1HV5A 3USNA 1QJIA 1UMSA 2OXZA 1ZXCA 1GO8P 4DPEA 4H49A 1BQQM 1R54A 1FBLA 2RJPA 1CIZA 2X3CA 1XUDA 3HB2P 1MMQA 1OS2A 3LAAA 1L6JA 1PWVA 3E8RA 1D8MA 2I47A 1Y8JA 4Q1LA 4L6TA 2OZRA 2Y6CA 1CXVA 3LK8A 1K7GA 1RM8A 1KBCA 2DDFA 4L63A 1C8TA 2AIGP 3HYGA 2DW1A 1JK3A 4H2EA 4A3WA 1GE7A 2YIGA 3LJTA 1EAKA 1HTDA 1R1HA 2K2GA 1SLMA 2OW1A 3LUMA 2J83A 1PWPA 2JIHA 4H1QA 2OVZA 1OM8A 1QIAA 2HU6A 4XM8A 1RMZA 3KMCA 3P1VA 3L0VA 1EUBA 1QJJA 4XM7A 5BOYA 2MZHA 4L7AA 3K7LA 4PKUA 2X3BA 1XFVA 1XFXA 3LQBA 1UMTA 3ZVSA 3GBOA 4PKWA 2XS4A 2Z2DA 5I2ZA 2POJA 1I1IP 1G05A 4AYKA 3HDBA 4ZR5A 1XFZA 2DW0A 4J4MA 5B5PA 1BUVM 2OXUA 3AYKA 1D5JA 2JT5A 2CKIA 1ND1A 4FXQA 4WKIA 3I7IA 3LA9A 1FLSA 5L7FA 1XFWA 1BKCE 2JSDA 3A6ZA 3DWBA 1D7XA 1PWUA 3ZXHA 3K7NA 3KEKA 3WV2A 2PJTA 2E2DA 5LABA 4H3XA 4WKEA 3LMCA 3B8ZA 1ATLA 3LE9A 4ILWD 1BZSA 1D8FA 1Z3JA 2SRTA 1XFUA 1CK7A 3Q2GA 2DW2A 3DPFA 4WK7A 1JAOA 5I0LA 1OS9A 2ZVDA 3F1AA 3RTSA 4GWNA 1H71P 1HOVA 830CA 2W0DA 4JP4A 2OY4A 1MMRA 3EWJA 4PKSA 1O0TA 3G5CA 5I12A 2ML2A 3KHIA 3WP8A 4PKVA 1BIWA 4PKRA 3MA2A 2MLSA 2L0RA 1IACA 2W13A 4IN9A 2X3AA 4R3VA 3HDAP 3OHOA 3LKAA 1I76A 1MNCA 3RTTA 2TCLA 1IAEA 4L19A 1ZTQA 5I43A 1ZXVA 1Y0VA 5CUHA 5D3CA 3TS4A 4CTHA 4AXQA 2QPJA 3F18A 4AIGA 3EDHA 1B3DA 4A7BA 3HBVP 2O36A 1YP1A 3EDGA 2O3EA 5L79A 1K7IA 2USNA 3KMEA 2W12A 1MMBA 3NX7A 2QUBA 3KWVC 1KUGA 1R1JA 1YCMA 1BM6A 3LIKA 2MZEA 4GQLA 2ERQA 3DL1A 1ZP5A 1G9KA 1BKCA 4FVLA 2JNPA 3TT4A 1PWWA 1JANA 4GWMA 1XURA 1AKLA 3LJZA 1BQOA 1GE5A 3O2XA 3S6LA 4FU4A 1C3IA 4DV8A 1R1IA 4WZVA 3VTGA 3F16A 3DNGA 1KUHA 2OY2A 3LGPA 2WOAA 5I3MA 1G49A 3NTNA 1QIBA 3O64A 3B2ZA 3ELMA 1IABA 3DPEA 4G0DA 3UVCA 1KUFA 1IAAA 1OM6A 3I7GA 4HMAA 2JT6A 2MLRA 1UTTA 1Q3AA 3HY9A 1HY7A 1SRPA 456CA 1SATA 3LJGA 1BKCI 1JAQA 2EROA 966CA 2MZIA 2XQHA 3DTIA 3HY7A 4FXYP 2OVXA 2J0TA 4AUOA 4I35A 2Y6DA 1A86A 2FV9A 3V96B 1I73A 3N2UA 4GR8A 1CQRA 1ZVXA 1SLNA 3LILA 4XM6A 1J7NA 1UTZA 1AYKA 4I03A 3L0TA 1S4BP 3EHXA 1K7QA 5B5OA 2ZJ6A 3CKIA 1YQYA 3DTEA 1MMPA 4DD8A 1GE6A 2D1OA 1G12A 1OO9A 1IAGA 1HFCA 1JIZA 1AF0A 2XS3A 4JQGA 5D1SA 4GR3A 5CVWA 2ZJ7A 1ROSA 4JIJA 1A85A 1UEAA 1USNA 3ULTA 1BUDA 2X7MA 5D1TA 2A8HA 4H76A 1JAPA 2KRJA 3WV1A 1C7KA 1QUAA 2OW9A 2YO1A 2QUAA 4IUWA 1BSWA 3KECA 1XFYA 3VI1A 3EHYA 1YOUA 5I4OA 1GKDA 2V4BA 3F19A 2E3XA 1Y93A 2DDYA 1SU3A 2D1NA 4WF6A 1OM7A 1IADA 1O0QA 4PKQA 3U1RA 2Z8ZA 4DF9A 3BA0A 4ON1A 1GKCA 1FM1A 1CGEA 4IJOA 2ERPA 4QKZA 3TVCA 2FV5A 2Z8XA 4GR0A 1KUIA 3LUNA 4XCTA 3AYUA 3EDZA 3TSKA 2OI0A 4HX3A 1B8YA 3P24A 4H84A 5BPAA 3KEJA 3G42A 5CZMA 3LEAA 1JH1A 2YUFA 1GXDA 5D1UA 1KAPP 2OXWA 1XUCA 1ASTA 3F15A 4H30A 1HFSA 3A70A 5CXLA 2WO8A 3F17A 3OHLA 4PKTA 5CXAA 1DTHA 5D7WA 3LIRA 3Q2HA 1JIWP 3SHIA 4H82A 2W14A 3LQ0A 3HBUP 1QICA 1SMPA 2N8RA 1CAQA 3DTKA 3N2VA 5BOTA 2OW0A 4GUYA 4EFSA 4JPAA 1OMJA 3B92A 3WV3A 1P9HA 3DSLA 3EDIA 2W15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XBH A;  2OW2 A;  3AIG A;  1GO7 P;  2WO9 A;  4GF1 A;  5D2B A;  5H8X A;  4G9L A;  1JJ9 A;  1R55 A;  1DMT A;  1JKY A;  3ZUK A;  2K9C A;  2RJQ A;  2CLT A;  1EB6 A;  2YO0 A;  1ZS0 A;  3KRY A;  2AGM A;  1CGF A;  1PWQ A;  1WNI A;  5JMY A;  2YB9 A;  4JA1 A;  2AYK A;  1KUK A;  1CGL A;  1G4K A;  1HV5 A;  3USN A;  1QJI A;  1UMS A;  2OXZ A;  1ZXC A;  1GO8 P;  4DPE A;  4H49 A;  1BQQ M;  1R54 A;  1FBL A;  2RJP A;  1CIZ A;  2X3C A;  1XUD A;  3HB2 P;  1MMQ A;  1OS2 A;  3LAA A;  1L6J A;  1PWV A;  3E8R A;  1D8M A;  2I47 A;  1Y8J A;  4Q1L A;  4L6T A;  2OZR A;  2Y6C A;  1CXV A;  3LK8 A;  1K7G A;  1RM8 A;  1KBC A;  2DDF A;  4L63 A;  1C8T A;  2AIG P;  3HYG A;  2DW1 A;  1JK3 A;  4H2E A;  4A3W A;  1GE7 A;  2YIG A;  3LJT A;  1EAK A;  1HTD A;  1R1H A;  2K2G A;  1SLM A;  2OW1 A;  3LUM A;  2J83 A;  1PWP A;  2JIH A;  4H1Q A;  2OVZ A;  1OM8 A;  1QIA A;  2HU6 A;  4XM8 A;  1RMZ A;  3KMC A;  3P1V A;  3L0V A;  1EUB A;  1QJJ A;  4XM7 A;  5BOY A;  2MZH A;  3K7L A;  4PKU A;  2X3B A;  1XFV A;  1XFX A;  3LQB A;  1UMT A;  3ZVS A;  3GBO A;  4PKW A;  2XS4 A;  2Z2D A;  5I2Z A;  2POJ A;  1I1I P;  1G05 A;  4AYK A;  3HDB A;  4ZR5 A;  1XFZ A;  2DW0 A;  4J4M A;  5B5P A;  1BUV M;  2OXU A;  3AYK A;  1D5J A;  2JT5 A;  2CKI A;  1ND1 A;  4FXQ A;  4WKI A;  3I7I A;  3LA9 A;  1FLS A;  5L7F A;  1XFW A;  1BKC E;  2JSD A;  3A6Z A;  3DWB A;  1D7X A;  1PWU A;  3ZXH A;  3K7N A;  3KEK A;  3WV2 A;  2PJT A;  2E2D A;  5LAB A;  4H3X A;  4WKE A;  3LMC A;  3B8Z A;  1ATL A;  3LE9 A;  4ILW D;  1BZS A;  1D8F A;  1Z3J A;  2SRT A;  1XFU A;  1CK7 A;  3Q2G A;  2DW2 A;  3DPF A;  4WK7 A;  1JAO A;  5I0L A;  1OS9 A;  2ZVD A;  3F1A A;  3RTS A;  4GWN A;  1H71 P;  1HOV A;  830C A;  2W0D A;  4JP4 A;  2OY4 A;  1MMR A;  3EWJ A;  4PKS A;  1O0T A;  3G5C A;  5I12 A;  2ML2 A;  3KHI A;  3WP8 A;  4PKV A;  1BIW A;  4PKR A;  3MA2 A;  2MLS A;  2L0R A;  1IAC A;  2W13 A;  4IN9 A;  2X3A A;  4R3V A;  3HDA P;  3OHO A;  3LKA A;  1I76 A;  1MNC A;  3RTT A;  2TCL A;  1IAE A;  4L19 A;  1ZTQ A;  5I43 A;  1ZXV A;  1Y0V A;  5CUH A;  5D3C A;  3TS4 A;  4CTH A;  4AXQ A;  2QPJ A;  3F18 A;  4AIG A;  3EDH A;  1B3D A;  4A7B A;  3HBV P;  2O36 A;  1YP1 A;  3EDG A;  2O3E A;  5L79 A;  1K7I A;  2USN A;  3KME A;  2W12 A;  1MMB A;  3NX7 A;  2QUB A;  3KWV C;  1KUG A;  1R1J A;  1YCM A;  1BM6 A;  3LIK A;  2MZE A;  4GQL A;  2ERQ A;  3DL1 A;  1ZP5 A;  1G9K A;  1BKC A;  4FVL A;  2JNP A;  3TT4 A;  1PWW A;  1JAN A;  4GWM A;  1XUR A;  1AKL A;  3LJZ A;  1BQO A;  1GE5 A;  3O2X A;  3S6L A;  4FU4 A;  1C3I A;  4DV8 A;  1R1I A;  4WZV A;  3VTG A;  3F16 A;  3DNG A;  1KUH A;  2OY2 A;  3LGP A;  2WOA A;  5I3M A;  1G49 A;  3NTN A;  1QIB A;  3O64 A;  3B2Z A;  3ELM A;  1IAB A;  3DPE A;  4G0D A;  3UVC A;  1KUF A;  1IAA A;  1OM6 A;  3I7G A;  4HMA A;  2JT6 A;  2MLR A;  1UTT A;  1Q3A A;  3HY9 A;  1HY7 A;  1SRP A;  456C A;  1SAT A;  3LJG A;  1BKC I;  1JAQ A;  2ERO A;  966C A;  2MZI A;  2XQH A;  4FXY P;  3HY7 A;  2OVX A;  2J0T A;  4AUO A;  4I35 A;  2Y6D A;  1A86 A;  2FV9 A;  3V96 B;  1I73 A;  3N2U A;  4GR8 A;  1CQR A;  1ZVX A;  1SLN A;  3LIL A;  4XM6 A;  1J7N A;  1UTZ A;  1AYK A;  4I03 A;  3L0T A;  1S4B P;  3EHX A;  1K7Q A;  5B5O A;  2ZJ6 A;  3CKI A;  1YQY A;  1MMP A;  4DD8 A;  1GE6 A;  2D1O A;  1G12 A;  1OO9 A;  1IAG A;  1HFC A;  1JIZ A;  1AF0 A;  2XS3 A;  4JQG A;  5D1S A;  4GR3 A;  5CVW A;  2ZJ7 A;  1ROS A;  4JIJ A;  1A85 A;  1UEA A;  1USN A;  3ULT A;  1BUD A;  2X7M A;  5D1T A;  2A8H A;  4H76 A;  1JAP A;  2KRJ A;  3WV1 A;  1C7K A;  1QUA A;  2OW9 A;  2YO1 A;  2QUA A;  4IUW A;  1BSW A;  3KEC A;  1XFY A;  3VI1 A;  3EHY A;  1YOU A;  5I4O A;  1GKD A;  2V4B A;  3F19 A;  2E3X A;  1Y93 A;  2DDY A;  1SU3 A;  2D1N A;  4WF6 A;  1OM7 A;  1IAD A;  1O0Q A;  4PKQ A;  3U1R A;  2Z8Z A;  4DF9 A;  3BA0 A;  4ON1 A;  1GKC A;  1FM1 A;  1CGE A;  4IJO A;  2ERP A;  4QKZ A;  3TVC A;  2FV5 A;  2Z8X A;  4GR0 A;  1KUI A;  3LUN A;  4XCT A;  3AYU A;  3EDZ A;  3TSK A;  2OI0 A;  4HX3 A;  1B8Y A;  3P24 A;  4H84 A;  5BPA A;  3KEJ A;  3G42 A;  5CZM A;  3LEA A;  1JH1 A;  1GXD A;  5D1U A;  1KAP P;  2OXW A;  1XUC A;  1AST A;  3F15 A;  4H30 A;  1HFS A;  3A70 A;  5CXL A;  2WO8 A;  3F17 A;  3OHL A;  4PKT A;  5CXA A;  1DTH A;  5D7W A;  3LIR A;  3Q2H A;  1JIW P;  3SHI A;  4H82 A;  2W14 A;  3LQ0 A;  3HBU P;  1QIC A;  1SMP A;  2N8R A;  1CAQ A;  3N2V A;  5BOT A;  2OW0 A;  4GUY A;  4EFS A;  4JPA A;  1OMJ A;  3B92 A;  3WV3 A;  1P9H A;  3DSL A;  3EDI A;  2W15 A; 
#chains in the Genus database with same CATH topology
 4XBH A;  2OW2 A;  3AIG A;  1GO7 P;  2WO9 A;  4GF1 A;  5D2B A;  5H8X A;  4G9L A;  1JJ9 A;  1R55 A;  1DMT A;  1JKY A;  3ZUK A;  2K9C A;  2RJQ A;  2CLT A;  1EB6 A;  2YO0 A;  1ZS0 A;  3KRY A;  2AGM A;  1CGF A;  1PWQ A;  1WNI A;  5JMY A;  2YB9 A;  4JA1 A;  2AYK A;  1KUK A;  1CGL A;  1G4K A;  1HV5 A;  3USN A;  1QJI A;  1UMS A;  2OXZ A;  1ZXC A;  1GO8 P;  4DPE A;  4H49 A;  1BQQ M;  1R54 A;  1FBL A;  2RJP A;  1CIZ A;  2X3C A;  1XUD A;  3HB2 P;  1MMQ A;  4DT5 A;  1OS2 A;  3LAA A;  1L6J A;  1PWV A;  3E8R A;  1D8M A;  2I47 A;  1Y8J A;  4Q1L A;  4L6T A;  2OZR A;  2Y6C A;  1CXV A;  3LK8 A;  1K7G A;  1RM8 A;  1KBC A;  2DDF A;  4L63 A;  1C8T A;  2AIG P;  3HYG A;  2DW1 A;  1JK3 A;  4H2E A;  4A3W A;  1GE7 A;  2YIG A;  3LJT A;  1EAK A;  1HTD A;  1R1H A;  2K2G A;  1SLM A;  2OW1 A;  3LUM A;  2J83 A;  1PWP A;  2JIH A;  4H1Q A;  2OVZ A;  1OM8 A;  1QIA A;  2HU6 A;  4XM8 A;  1RMZ A;  3KMC A;  3P1V A;  3L0V A;  1EUB A;  1QJJ A;  4XM7 A;  5BOY A;  2MZH A;  4L7A A;  3K7L A;  4PKU A;  2X3B A;  1XFV A;  1XFX A;  3LQB A;  1UMT A;  3ZVS A;  3GBO A;  4PKW A;  2XS4 A;  2Z2D A;  5I2Z A;  2POJ A;  1I1I P;  1G05 A;  4AYK A;  3HDB A;  4ZR5 A;  1XFZ A;  2DW0 A;  4J4M A;  5B5P A;  1BUV M;  2OXU A;  3AYK A;  1D5J A;  2JT5 A;  2CKI A;  1ND1 A;  4FXQ A;  4WKI A;  3I7I A;  3LA9 A;  1FLS A;  5L7F A;  1XFW A;  1BKC E;  2JSD A;  3A6Z A;  3DWB A;  1D7X A;  1PWU A;  3ZXH A;  3K7N A;  3KEK A;  3WV2 A;  2PJT A;  2E2D A;  5LAB A;  4H3X A;  4WKE A;  3LMC A;  3B8Z A;  1ATL A;  3LE9 A;  4ILW D;  1BZS A;  1D8F A;  1Z3J A;  2SRT A;  1XFU A;  1CK7 A;  3Q2G A;  2DW2 A;  3DPF A;  4WK7 A;  1JAO A;  5I0L A;  1OS9 A;  2ZVD A;  3F1A A;  3RTS A;  4GWN A;  1H71 P;  1HOV A;  830C A;  2W0D A;  4JP4 A;  2OY4 A;  1MMR A;  3EWJ A;  4PKS A;  1O0T A;  3G5C A;  5I12 A;  2ML2 A;  3KHI A;  3WP8 A;  4PKV A;  1BIW A;  4PKR A;  3MA2 A;  2MLS A;  2L0R A;  1IAC A;  2W13 A;  4IN9 A;  2X3A A;  4R3V A;  3HDA P;  3OHO A;  3LKA A;  1I76 A;  1MNC A;  3RTT A;  2TCL A;  1IAE A;  4L19 A;  1ZTQ A;  5I43 A;  1ZXV A;  1Y0V A;  5CUH A;  5D3C A;  3TS4 A;  4CTH A;  4AXQ A;  2QPJ A;  3F18 A;  4AIG A;  3EDH A;  1B3D A;  4A7B A;  3HBV P;  2O36 A;  1YP1 A;  3EDG A;  2O3E A;  5L79 A;  1K7I A;  2USN A;  3KME A;  2W12 A;  1MMB A;  3NX7 A;  2QUB A;  3KWV C;  1KUG A;  1R1J A;  1YCM A;  1BM6 A;  3LIK A;  2MZE A;  4GQL A;  2ERQ A;  3DL1 A;  1ZP5 A;  1G9K A;  1BKC A;  4FVL A;  2JNP A;  3TT4 A;  1PWW A;  1JAN A;  4GWM A;  1XUR A;  1AKL A;  3LJZ A;  1BQO A;  1GE5 A;  3O2X A;  3S6L A;  4FU4 A;  1C3I A;  4DV8 A;  1R1I A;  4WZV A;  3VTG A;  3F16 A;  3DNG A;  1KUH A;  2OY2 A;  3LGP A;  2WOA A;  5I3M A;  1G49 A;  3NTN A;  1QIB A;  3O64 A;  3B2Z A;  3ELM A;  1IAB A;  3DPE A;  4G0D A;  3UVC A;  1KUF A;  1IAA A;  1OM6 A;  3I7G A;  4HMA A;  2JT6 A;  2MLR A;  1UTT A;  1Q3A A;  3HY9 A;  1HY7 A;  1SRP A;  456C A;  1SAT A;  3LJG A;  1BKC I;  1JAQ A;  2ERO A;  966C A;  2MZI A;  2XQH A;  3DTI A;  3HY7 A;  4FXY P;  2OVX A;  2J0T A;  4AUO A;  4I35 A;  2Y6D A;  1A86 A;  2FV9 A;  3V96 B;  1I73 A;  3N2U A;  4GR8 A;  1CQR A;  1ZVX A;  1SLN A;  3LIL A;  4XM6 A;  1J7N A;  1UTZ A;  1AYK A;  4I03 A;  3L0T A;  1S4B P;  3EHX A;  1K7Q A;  5B5O A;  2ZJ6 A;  3CKI A;  1YQY A;  3DTE A;  1MMP A;  4DD8 A;  1GE6 A;  1XAX A;  2D1O A;  1G12 A;  1OO9 A;  1IAG A;  1HFC A;  1JIZ A;  1AF0 A;  2XS3 A;  4JQG A;  5D1S A;  4GR3 A;  5CVW A;  2ZJ7 A;  1ROS A;  4JIJ A;  1A85 A;  1UEA A;  1USN A;  3ULT A;  1BUD A;  2X7M A;  5D1T A;  2A8H A;  4H76 A;  1JAP A;  1TVI A;  2KRJ A;  3WV1 A;  1C7K A;  1QUA A;  2OW9 A;  2YO1 A;  2QUA A;  4IUW A;  1BSW A;  3KEC A;  1XFY A;  3VI1 A;  3EHY A;  1YOU A;  5I4O A;  1GKD A;  2V4B A;  3F19 A;  2E3X A;  1Y93 A;  2DDY A;  1SU3 A;  2D1N A;  4WF6 A;  1OM7 A;  1IAD A;  1O0Q A;  4PKQ A;  3U1R A;  2Z8Z A;  4DF9 A;  3BA0 A;  4ON1 A;  1GKC A;  1FM1 A;  1CGE A;  4IJO A;  2ERP A;  4QKZ A;  3TVC A;  2FV5 A;  2Z8X A;  4GR0 A;  1KUI A;  3LUN A;  1XM5 A;  4XCT A;  3AYU A;  3EDZ A;  3TSK A;  2OI0 A;  4HX3 A;  1B8Y A;  3P24 A;  4H84 A;  5BPA A;  3KEJ A;  3G42 A;  5CZM A;  3LEA A;  1JH1 A;  2YUF A;  1GXD A;  5D1U A;  1KAP P;  2OXW A;  1XUC A;  1AST A;  3F15 A;  4H30 A;  1HFS A;  3A70 A;  5CXL A;  2WO8 A;  3F17 A;  3OHL A;  4PKT A;  5CXA A;  1DTH A;  5D7W A;  3LIR A;  3Q2H A;  1JIW P;  3SHI A;  4H82 A;  2W14 A;  3LQ0 A;  3HBU P;  1QIC A;  1SMP A;  2N8R A;  1CAQ A;  1OZ9 A;  3DTK A;  3N2V A;  5BOT A;  2OW0 A;  4GUY A;  4EFS A;  4JPA A;  1OMJ A;  3B92 A;  3WV3 A;  1P9H A;  3DSL A;  3EDI A;  2W15 A; 
#chains in the Genus database with same CATH homology
 4XBH A;  2OW2 A;  3AIG A;  1GO7 P;  2WO9 A;  4GF1 A;  5D2B A;  5H8X A;  4G9L A;  1JJ9 A;  1R55 A;  1DMT A;  1JKY A;  3ZUK A;  2K9C A;  2RJQ A;  2CLT A;  1EB6 A;  2YO0 A;  1ZS0 A;  3KRY A;  2AGM A;  1CGF A;  1PWQ A;  1WNI A;  5JMY A;  2YB9 A;  4JA1 A;  2AYK A;  1KUK A;  1CGL A;  1G4K A;  1HV5 A;  3USN A;  1QJI A;  1UMS A;  2OXZ A;  1ZXC A;  1GO8 P;  4DPE A;  4H49 A;  1BQQ M;  1R54 A;  1FBL A;  2RJP A;  1CIZ A;  2X3C A;  1XUD A;  3HB2 P;  1MMQ A;  1OS2 A;  3LAA A;  1L6J A;  1PWV A;  3E8R A;  1D8M A;  2I47 A;  1Y8J A;  4Q1L A;  4L6T A;  2OZR A;  2Y6C A;  1CXV A;  3LK8 A;  1K7G A;  1RM8 A;  1KBC A;  2DDF A;  4L63 A;  1C8T A;  2AIG P;  3HYG A;  2DW1 A;  1JK3 A;  4H2E A;  4A3W A;  1GE7 A;  2YIG A;  3LJT A;  1EAK A;  1HTD A;  1R1H A;  2K2G A;  1SLM A;  2OW1 A;  3LUM A;  2J83 A;  1PWP A;  2JIH A;  4H1Q A;  2OVZ A;  1OM8 A;  1QIA A;  2HU6 A;  4XM8 A;  1RMZ A;  3KMC A;  3P1V A;  3L0V A;  1EUB A;  1QJJ A;  4XM7 A;  5BOY A;  2MZH A;  4L7A A;  3K7L A;  4PKU A;  2X3B A;  1XFV A;  1XFX A;  3LQB A;  1UMT A;  3ZVS A;  3GBO A;  4PKW A;  2XS4 A;  2Z2D A;  5I2Z A;  2POJ A;  1I1I P;  1G05 A;  4AYK A;  3HDB A;  4ZR5 A;  1XFZ A;  2DW0 A;  4J4M A;  5B5P A;  1BUV M;  2OXU A;  3AYK A;  1D5J A;  2JT5 A;  2CKI A;  1ND1 A;  4FXQ A;  4WKI A;  3I7I A;  3LA9 A;  1FLS A;  5L7F A;  1XFW A;  1BKC E;  2JSD A;  3A6Z A;  3DWB A;  1D7X A;  1PWU A;  3ZXH A;  3K7N A;  3KEK A;  3WV2 A;  2PJT A;  2E2D A;  5LAB A;  4H3X A;  4WKE A;  3LMC A;  3B8Z A;  1ATL A;  3LE9 A;  4ILW D;  1BZS A;  1D8F A;  1Z3J A;  2SRT A;  1XFU A;  1CK7 A;  3Q2G A;  2DW2 A;  3DPF A;  4WK7 A;  1JAO A;  5I0L A;  1OS9 A;  2ZVD A;  3F1A A;  3RTS A;  4GWN A;  1H71 P;  1HOV A;  830C A;  2W0D A;  4JP4 A;  2OY4 A;  1MMR A;  3EWJ A;  4PKS A;  1O0T A;  3G5C A;  5I12 A;  2ML2 A;  3KHI A;  3WP8 A;  4PKV A;  1BIW A;  4PKR A;  3MA2 A;  2MLS A;  2L0R A;  1IAC A;  2W13 A;  4IN9 A;  2X3A A;  4R3V A;  3HDA P;  3OHO A;  3LKA A;  1I76 A;  1MNC A;  3RTT A;  2TCL A;  1IAE A;  4L19 A;  1ZTQ A;  5I43 A;  1ZXV A;  1Y0V A;  5CUH A;  5D3C A;  3TS4 A;  4CTH A;  4AXQ A;  2QPJ A;  3F18 A;  4AIG A;  3EDH A;  1B3D A;  4A7B A;  3HBV P;  2O36 A;  1YP1 A;  3EDG A;  2O3E A;  5L79 A;  1K7I A;  2USN A;  3KME A;  2W12 A;  1MMB A;  3NX7 A;  2QUB A;  3KWV C;  1KUG A;  1R1J A;  1YCM A;  1BM6 A;  3LIK A;  2MZE A;  4GQL A;  2ERQ A;  3DL1 A;  1ZP5 A;  1G9K A;  1BKC A;  4FVL A;  2JNP A;  3TT4 A;  1PWW A;  1JAN A;  4GWM A;  1XUR A;  1AKL A;  3LJZ A;  1BQO A;  1GE5 A;  3O2X A;  3S6L A;  4FU4 A;  1C3I A;  4DV8 A;  1R1I A;  4WZV A;  3VTG A;  3F16 A;  3DNG A;  1KUH A;  2OY2 A;  3LGP A;  2WOA A;  5I3M A;  1G49 A;  3NTN A;  1QIB A;  3O64 A;  3B2Z A;  3ELM A;  1IAB A;  3DPE A;  4G0D A;  3UVC A;  1KUF A;  1IAA A;  1OM6 A;  3I7G A;  4HMA A;  2JT6 A;  2MLR A;  1UTT A;  1Q3A A;  3HY9 A;  1HY7 A;  1SRP A;  456C A;  1SAT A;  3LJG A;  1BKC I;  1JAQ A;  2ERO A;  966C A;  2MZI A;  2XQH A;  3DTI A;  3HY7 A;  4FXY P;  2OVX A;  2J0T A;  4AUO A;  4I35 A;  2Y6D A;  1A86 A;  2FV9 A;  3V96 B;  1I73 A;  3N2U A;  4GR8 A;  1CQR A;  1ZVX A;  1SLN A;  3LIL A;  4XM6 A;  1J7N A;  1UTZ A;  1AYK A;  4I03 A;  3L0T A;  1S4B P;  3EHX A;  1K7Q A;  5B5O A;  2ZJ6 A;  3CKI A;  1YQY A;  3DTE A;  1MMP A;  4DD8 A;  1GE6 A;  2D1O A;  1G12 A;  1OO9 A;  1IAG A;  1HFC A;  1JIZ A;  1AF0 A;  2XS3 A;  4JQG A;  5D1S A;  4GR3 A;  5CVW A;  2ZJ7 A;  1ROS A;  4JIJ A;  1A85 A;  1UEA A;  1USN A;  3ULT A;  1BUD A;  2X7M A;  5D1T A;  2A8H A;  4H76 A;  1JAP A;  2KRJ A;  3WV1 A;  1C7K A;  1QUA A;  2OW9 A;  2YO1 A;  2QUA A;  4IUW A;  1BSW A;  3KEC A;  1XFY A;  3VI1 A;  3EHY A;  1YOU A;  5I4O A;  1GKD A;  2V4B A;  3F19 A;  2E3X A;  1Y93 A;  2DDY A;  1SU3 A;  2D1N A;  4WF6 A;  1OM7 A;  1IAD A;  1O0Q A;  4PKQ A;  3U1R A;  2Z8Z A;  4DF9 A;  3BA0 A;  4ON1 A;  1GKC A;  1FM1 A;  1CGE A;  4IJO A;  2ERP A;  4QKZ A;  3TVC A;  2FV5 A;  2Z8X A;  4GR0 A;  1KUI A;  3LUN A;  4XCT A;  3AYU A;  3EDZ A;  3TSK A;  2OI0 A;  4HX3 A;  1B8Y A;  3P24 A;  4H84 A;  5BPA A;  3KEJ A;  3G42 A;  5CZM A;  3LEA A;  1JH1 A;  2YUF A;  1GXD A;  5D1U A;  1KAP P;  2OXW A;  1XUC A;  1AST A;  3F15 A;  4H30 A;  1HFS A;  3A70 A;  5CXL A;  2WO8 A;  3F17 A;  3OHL A;  4PKT A;  5CXA A;  1DTH A;  5D7W A;  3LIR A;  3Q2H A;  1JIW P;  3SHI A;  4H82 A;  2W14 A;  3LQ0 A;  3HBU P;  1QIC A;  1SMP A;  2N8R A;  1CAQ A;  3DTK A;  3N2V A;  5BOT A;  2OW0 A;  4GUY A;  4EFS A;  4JPA A;  1OMJ A;  3B92 A;  3WV3 A;  1P9H A;  3DSL A;  3EDI A;  2W15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...