1K7SN

Fhud complexed with albomycin-delta 2
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
262
structure length
262
Chain Sequence
GIDPNRIVALEWLPVELLLALGIVPYGVADTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSAGYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIRSMKPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAVSIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSAMHFVRVLDNAIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic structures of the Escherichia coli periplasmic protein FhuD bound to hydroxamate-type siderophores and the antibiotic albomycin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Ferrichrome-binding periplasmic protein
total genus 75
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2001-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1k7sN02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1k7sN01
5KOHB 3BE5A 5FLYA 1M1YB 3U7QA 3AEKA 4WZBB 1G20B 4HN9A 2XDQB 4NNOA 2ETVA 3PDIB 5HX7A 1M34A 1QGUB 4K3VA 3LI2A 5CX1A 3HXPA 4OVKA 3EIXA 3AEKB 4WZBA 3ZTTA 2PRSA 3BE6A 3HJTA 1L5HA 3AEUA 5GGXA 1QGUA 3MWGA 5CX1B 4NNPA 4OXRA 2M6KA 4BBPA 2QI9F 2PHZA 2OV1A 1QH1A 5JJ5A 1H1LA 2PS0A 1KARA 2XY4A 2Q8PA 4CL2A 3GI1A 3MD9A 3CX3A 1K0FA 2M6LA 1H1LB 4H0FA 5KOJA 1N2CA 2XV1A 1G20A 3EIWA 1QH8A 4LS3A 4WN9B 1K7SN 4G07A 2PS9A 2WI8A 3K1AB 5I4KA 3AERB 4OXQA 3PSHA 5BVHA 5M3BA 3TEFA 1M1YA 1KAEA 3AESA 5JG7A 1MIOB 5CR9A 2XUZA 4PM4A 4UTPA 3TLKA 5KOJB 2O1EA 2WHYA 4DBLE 4WESB 3AEUB 4TKUA 3LHSA 4MX8A 5GGYA 1N4AA 4WESA 1M1NA 1N2ZA 1N2CB 4ND8A 2MINB 3G9QA 4LJSA 1G21A 1QH8B 1FP4A 4WZAB 2PS3A 4ND8B 2YNMC 5B58T 5JPDA 2MINA 4B8YA 3K1AA 5M2QA 3AEQB 2R7AA 3AERA 4H59A 4IRMA 5KHLB 5BVHB 3ZK7A 4UTOA 2YNMD 2OSVA 2AFHB 3AESB 2AFIB 4HMOA 1M1NB 4UDNA 4WNAA 4MLZA 1N4DA 4FI3F 1K75A 4TKVA 4M7OA 2AFIA 3MFQA 5HDQA 4TKUB 4XPIA 5M34A 1K2VN 3AETB 4G09A 3R5SA 2XQVA 3AEQA 4MO9A 1MIOA 3TNYA 1EFDN 4XPIB 3MINB 4MDYA 1G21B 1L5HB 4HMQA 5AFSA 4FNAA 4WZAA 4PAGA 1TOAA 1KAHA 3MWFA 4GICA 3NU1A 1M34B 1QH1B 3UJPA 4FKMA 1PSZA 1FP4B 3HH8A 5BVGA 1PQ4A 4WNAB 2XH8A 3MINA 3U7QB 2OGWA 4TKVB 5M29A 2RG7A 4INOA 1ESZA 4FILA 1XVLA 2Q8QA 3AETA 3ZK9A 2AFHA 3R5TA 3PSAA 4HMPA 2R79A 4INPA 4UDOA 4WN9A 2X4LA 5JOQA 5KOHA 3ZKAA 2OV3A 3ZK8A 2XDQA 3PDIA 5BVGB 4N01A
chains in the Genus database with same CATH superfamily
4YCDA 4C3ZA 2HT1A 2FG6C 5L40A 3ADKA 2BAGA 3ZQ6A 1WY5A 1QV7A 2I3ZA 2HMAA 5HF5A 4BNGA 4PQEA 2CJXA 3JQGA 2VKQA 3WY9A 1LSSA 2B99A 5A4AA 1NQAO 5IDWA 4KPEC 3A26A 3NEYA 5H7XA 2QI9F 1YFZA 3KDSE 3DPIA 2J5QA 2ZU0C 1OAAA 4AAYA 1SVSA 1QH1A 3AB7A 2PXXA 1I3KA 5EWMA 1ABFA 4Z4GA 1VZ2A 2JRCA 3KDAA 3B1WA 3UUGA 4YYZA 5C80A 4RMNA 3BPSA 5TQ0A 1RIFA 2YICA 3ZDDA 2RE8A 4QSMA 1QU2A 3WNVA 2NP6A 2WZQA 1I13A 1MAVA 2KHZA 3L0SA 3L6DA 4PEVA 3MXOA 1RJ9B 1MAWA 2OXFA 5AOAA 2DKFA 2QUIA 2YC4C 3BGOS 5TARA 3WLHA 3P27A 3OZFA 3U44A 5C52B 2WHQA 1M2VB 1XB2A 4A1OA 3FDIA 1WW2A 3JSXA 1OFTA 2ZSDA 1WSDA 2Q5FA 4TTJA 4FR2A 4G3XA 2VS1A 3G49A 3VR3A 2CNOA 4X6LA 3VYRB 1MHTA 3L41A 1LQTA 3WI7A 1T9ZA 2DOKA 1VSQA 4ZALA 4KQ1A 3RLFA 1ISIA 5AVZA 4LF4B 4UE6A 1JEDA 4U7HA 3DE1X 1T8WA 3KCQA 3TUJC 4U3JB 1G2OA 2O4CA 1GPLA 4ZQEA 4KPUA 3R9KA 4NPHA 2NVWA 2QRVA 3ROMA 3ZVMA 4H6VA 3RF6A 4WXMA 1LDGA 2C1EA 2RONA 3GJSA 4KO3S 2VH2A 5CVDA 4DG5A 4EGFA 5KNDH 1UJ4A 1IQRA 3QVWA 4LYYA 3PPYA 1O7JA 1JHVA 2ID9A 2VJMA 2GD1O 4ND8B 5G02A 3VR2A 2Y27A 2CLCX 4JB8A 3GJ5A 4OSEA 2GZHA 4TKLA 5IT5A 4UXHA 3DLPX 4BO6A 2O3TA 2OV2A 3L8GA 2EX4A 3BN3A 1JTVA 4IINA 4ARAA 4DRYA 1AHPA 1TVKB 1ADCA 3DM5A 4HDSA 3PHGA 4YMUA 4D96A 1YCHA 1C3OA 1NDHA 2Q4RA 2XUGA 4DR5B 3LKZA 3IAFA 3K9GA 3G1UA 4FZJA 2JAXA 4NIMA 4QG3A 4RZIA 1X1CA 3OJEA 2F43A 3OZTA 4IDPA 4M1EA 1U8CB 1W2GA 5T5QA 1SIBE 5BORA 4QBTA 4G5YA 5J1TB 2R5NA 4AIIA 2WVGA 2C59A 2ZUTA 5KYXA 4C4XA 1MOPA 1Z12A 3A14A 5AFSA 5BPHA 1Z39A 4FNAA 4BZZA 2QWXA 2FE1A 2PR2A 2V6JA 1ZHOA 4N3GA 1UMBA 1ZICA 4QT0A 5D3MB 3I2KA 3OWHA 2CGEA 2GS9A 1DARA 1ENPA 2L42A 3WJ2A 1VIDA 1SZCA 4DILA 3X1YA 3HV2A 3K53A 1UP7A 2KLBA 1SG9A 1I7SB 3TL2A 4BIIA 3GJYA 4PZ9A 5C4GB 4BXOB 3GPIA 1H6DA 4IJQA 1TEXA 4ZAZA 1O6BA 2O5EA 2JD2A 3OZ7A 1SRQA 2C2ZA 3DAGA 3GEDA 3JYHA 5HE9A 4BO4A 5DIFA 4YAIA 2D8MA 4HP8A 3UWPA 3VJLA 4YB8A 4OK6A 2C82A 2HOQA 4P4SA 1AKRA 2XDQA 1VGVA 2V54A 8ADHA 4NL4H 3D7LA 1S96A 2R66A 4E46A 1L8QA 1NUPA 3PG5A 1BDIA 2JFXA 2NUTB 2VPIA 1YQQA 2P65A 1P9NA 2VTEA 2ZE8A 2PUGA 4KPFC 2QNRA 3ZWKA 1HLFA 3VC7A 3DULA 2IZ6A 4EG6A 5FNVA 2F4VB 5EVJA 2CVQA 1P33A 3BJIC 4KDEA 5KVAA 5CJPA 4RJJA 2OOKA 3M1YA 3II6X 4UARA 3WIEA 4HDNB 5A5GA 1KKUA 1TKAA 1AHHA 4KBFA 4DNOA 3O90A 4EI7A 1PV4A 2YIJA 3LFUA 5LYYA 4D1YA 1MT3A 5LBIA 1TI7A 4NZZA 4HNAB 3VA7A 1XHFA 1TMOA 3ZWVA 3SQXA 5EIBC 3DXFA 4NFYA 2BOVA 3QE0A 4FC6A 3KOOA 3DJFA 1DAEA 1QVVA 2PZAA 3PE6A 1R8QA 1NHWA 1PLLA 2ZB7A 3K71B 1AK1A 3CWZA 5FBKA 3O7MA 4XD2A 4ZICA 3LGSA 1NXQA 4CGZA 2BP7A 2XITA 4GD3Q 4EKIA 1T6YA 2BMWA 1U0EA 3OLXA 3ZW7A 2XQKA 3N0XA 1HDXA 3T06B 4DC9A 4XYLA 1AZSC 1AQNA 1DCTA 3R3VA 1KZYC 4IGAA 4KQEA 2VJPA 4YQZA 1P4HA 1BHO1 2RKOA 4MARA 3MTIA 4ZQBA 4J0GA 3AF1A 1P80A 2I1VB 4M21A 5FAXA 1BCSA 3BZUA 3GWZA 3A1WA 1L7QA 3G9QA 1BXRA 3BEDA 5AYVA 4BU1A 3QX3A 2J9FA 2QXYA 3VO1A 3QE3A 4O02B 2K5UA 1J0CA 3KEGA 1CQJB 2E4WA 3BXFA 3GDHA 2J6HA 3Q3IA 3KUUA 4QUDA 3GPCA 1G5TA 2VK2A 1HMYA 4KQJA 5M2QA 2CFCA 3D5QA 4JGBA 1R5OA 3O84A 4PG7A 4F4DA 4R31A 1YE5A 1MO2A 1TUGA 4JS0A 5B7PA 2CFOA 3ABSB 3SC6A 1DPGA 2Q62A 1R10A 4OLFA 1Z6QA 5KZMB 3DOJA 5ABPA 1BRTA 2EX0A 2QL7A 5TJHA 3HRKA 3EIOA 3PNQA 4JBWA 2XBMA 1XDDA 1U2TA 2Y77A 3WYNA 4NU8X 4CBVA 3CN9A 3PNSA 4CTNA 5A04A 3R9WA 3T34A 1WHSA 1RW4A 4FHFA 1H2XA 2BIFA 2NO6A 3DTTA 1M8KA 4L73A 4A2PA 3RKRA 3GGPA 5SV2A 4MVJM 3QPDA 1HDYA 4PLCA 5FKJA 5I9SA 1A76A 3FHLA 3OOJA 2A9FA 5LA6F 4I08A 3OM8A 4L7QA 5LZ7A 2TRSB 2WKWA 4F06A 1GNSA 3IE2A 4LDZA 3M4NA 3NQ41 4LJYA 2GM5A 2Y68A 4GMDA 5M29A 2O2XA 1GAJA 1DXOA 4G1EB 4L6AA 1Y80A 3VX3A 1JDSA 1QONA 2W2MA 4TLDA 5HCUA 2O1SA 2H52A 3CEMA 3ZK9A 5JAIA 3ANSA 5C18A 1ZX1A 3KZXA 1VRCA 1X0XA 3RIMA 5JQGF 1NKSA 3CTMA 5L53A 3OFSA 4LZZA 4ERNA 2I7TA 2WKPA 1I5RA 1ULSA 1XQYA 3DS8A 2V6GA 4YYEA 4JEUA 4CM1A 4HNVA 2YXEA 3BRQA 3W5HA 1IEVA 1PEDA 1JUDA 1XP5A 2WFMA 3U3MA 4YAGA 2UVPA 5KHAA 1XTIA 3OJWA 3R76A 1IK6A 3O94A 3QMMA 3VH4A 1DXYA 4M49A 1Z3IX 1A8SA 1SVIA 1ECPA 1YRQA 2UKDA 2EVWX 3KYDA 2VATA 3NATA 3QVUA 2JLQA 4BCBA 5C35A 2VA9A 3GFGA 2IXAA 2BYTA 4ENVA 3MLBA 1LFDB 2VR1A 3MMXA 4XOIA 2QL9A 3E5RA 5C4IA 4YV7A 2A59A 3GVPA 4ZV7A 3JQBC 1MRNA 3T3DA 5KTRA 2FEPA 3FI0A 5CDGA 5IMSA 4Q9LA 1LQ2A 3OAAD 2Q5HA 2W6QA 3A05A 4CDNA 1IWOA 5TMPA 2J8ZA 5EWLA 5IT4A 3EVNA 3L5OA 5C1IA 1RC1A 2BBTA 4WA8A 1X3LA 3CYFA 3LA6A 4JJAA 2OFWA 1VIMA 3G2HA 3KKLA 4Q93A 5I7FA 2XA9A 2IZOA 4KSYA 2HHJA 4TMXA 3WLLA 3RWOA 4H2DA 1Z4LA 2NLOA 1Y9DA 2OV6A 2XAAA 3OHPA 3H9UA 2FA9A 4KMMA 1QK3A 1YDHA 2FQXA 3ACBA 3Q3HA 4HXGA 4QVGA 3WGJA 4YLGA 1XMQB 4E88A 1TCCA 1RI3A 3L8CA 1T43A 5K3FB 4KTTE 1TLTA 2UZ1A 3B7GA 3N6XA 5E38A 3R41A 4PQYA 2NAFA 4F56A 3KKZA 1XDWA 2WU8A 3ETDA 4RA9A 3V1NA 4EKNB 1CR4A 1Q3HA 2XSZA 1UOEA 1CRLA 2VF7A 1PR3A 3GDGA 3H11A 5FBQB 1G5IA 3LT4A 4AZ3B 4ADSG 1JH8A 3ZV7A 4D8YA 1GPKA 2UUCB 1ZIOA 1MKYA 2ZFUA 4D6XA 4M55A 4J6EA 2PL3A 3DE5X 4C76A 2DUMA 5BSKA 4TLCA 5IDYA 1LJ8A 5K1ZA 3AUYA 4FYMA 4GI5A 4HAVA 3QP9A 4MUXA 5FLEX 1OWLA 2HYDA 1M67A 1PP4A 3ZN2A 4TWJA 2CLEB 1RE1A 4JD5A 3HYLA 3BHNA 3DV0B 4FIZA 4LKOA 2GPSA 2VUIB 3KOUA 1T1EA 2IX3A 1KJZA 4BLQA 5F2NA 4REOA 2IS6A 1BS2A 3CISA 4PAWA 1NUSA 3X2EA 1FE8A 1XL0A 4DRZA 3V3TA 1KZ7B 4ZOEA 2VT3A 4RAQA 3ZWNA 1KH3A 1F0YA 4OX9Y 5IW8A 2OK7A 5IKXA 3H42B 1C7JA 1F1JA 1H4VB 2OD9A 1JA1A 2WUVA 3H2IA 3ISVA 2EP8A 3PGXA 4UVIA 2WWRA 5IF9A 1BNCA 4KRGA 5CLHA 2YL2A 2V7TA 3JS5A 4JC8A 3MCZA 4U7PB 4FFSA 5HG0A 3VJKA 3ZKAA 3FVVA 1XZQA 1SHTX 3V97A 1EJ6A 4X8MA 2NO5A 5BMVB 4W5OA 3WLIA 1ZOPA 2I2DA 4DF3A 1P0MA 3ECSA 5EMMA 3THSA 2JJ2D 1PWXA 3GAAA 5LP6B 1VE6A 5JUWA 2ANCA 1NM5C 1OGYA 3WB1A 2CV0A 2OHOA 2QJRA 3SHTA 4KAJA 2Q3CA 5K0EA 5HGXA 1VXRA 3MLEA 3CJQA 5JDCC 4H7FA 3Q7RA 1L7XA 1P91A 1HE8B 2A0YA 2ZYHA 3N2EA 1UUFA 1UXJA 1E0KA 2VOEA 2B61A 1QDUA 2MSDB 2QJOA 3DD5A 2E55A 3BCUA 3QHAA 1TA0A 4TRNA 3QX8A 4IDCA 5ALHA 1VJCA 2OXTA 4E5PA 3O9ZA 3ITKA 2PEYA 2Q1UA 3H9GA 4K86A 1P1BA 4XJTA 4CLXA 4A1FA 2BH9A 5CG2A 4LK2A 5HA5A 2QVLA 3KJZA 1N5IA 2DC1A 4MS4B 1UC5B 2DYKA 4GZMA 2C5LA 5HKLA 3O3CA 1G8HA 4BN0A 1BMTA 5A5EA 1ZHHA 4WRRA 3KOWA 3EPKA 2IY9A 4HAYA 1U1EA 4IDNA 1L5KA 3RWBA 5DV9A 2PIDA 3HB4X 2WG0A 3CPJB 3IBFA 1MIOB 2HF8A 1QBKC 1RPJA 2NO9A 1MVOA 4G4SP 1W1WA 4JI6B 5G3YA 3TW8B 4JK3A 1EP2B 1N5MA 2G80A 1T26A 4J94A 5IEJA 5EC8A 5K0ZA 2X8LA 5TGZA 1WD7A 4AF7A 4M0PA 3UA4A 1ORTA 3R7DA 4BMXA 1TW3A 2ATXA 3CWCA 2JFQA 1TYCA 1PK7A 1U3UA 1ZJJA 2BW0A 4R1PA 4CTKA 2CXPA 4EB6B 1YR3A 4JZYA 3WHKA 3LUFA 4NABA 1E4YA 1ODKA 1QCDA 1Y5LA 3SZGA 1QDLB 4LYFA 3LOUA 5GONB 1JBEA 3CNHA 1KIMA 5SZHB 2G67A 4HX2A 3I2GA 5FPKA 3H4TA 1TKBA 3QKSA 4W5RA 5BT8A 2V3WA 5AXBA 2HA5A 1LSUA 2ODBA 4FE7A 1PFKA 4JWKA 2P5UA 1FS6A 4KSCA 4RIFA 5A0FA 3U4CA 3ZNQA 4A3SA 5DNUA 4B87A 4IQ0A 4LMRA 3PC6A 4PZAA 4YA6A 3KDPA 1DGQA 5AVTA 2I3BA 4OF4A 1LI7A 4OQFA 1U94A 2QJTA 3C7CB 1ORVA 2QI9C 5I5GA 1E6WA 1P2SA 3ZY4A 3ZJVA 1D8TA 3AONB 2RH8A 5J2TA 3L7KA 1CUJA 1XZDA 5EKDA 3ENKA 4F9GA 2RIRA 5JZOA 1OCEA 1GIAA 4QELA 3AEXA 3IBSA 4HLUA 3DNFA 2F9MA 3ICPA 1QYWA 3L02A 1DZ3A 1D2HA 2H2FA 2IF2A 2XUIA 1J2UA 4IIEA 5FTJA 5ILQA 3EEQA 1ZIPA 1YZGA 3N7AA 1UK7A 1RVDA 2BFEA 2HRQA 2MT9A 2OO5A 3KEQA 4GZLA 2VJMB 16PKA 4OGLA 5KYUA 4DLAA 4XAQA 2BE9A 1E3WA 4JYAB 5FBLB 4P5DA 2C20A 4INOA 4DADA 3ZDBA 4MGKR 1FUIA 3M49A 3D4PA 1B8NA 4R40A 4DYVA 1VKJA 3D4OA 2Q49A 4AT1A 4X66B 3OT4A 5M5BA 1EWQA 1JI3A 1SURA 2BMDA 2FSPA 3K9WA 4UXIA 1YC2A 2PXAA 3TLZA 1O94C 5E6UB 4RFSA 4HWPA 2PUCA 3RRBA 1WTAA 4D74A 3RV4A 4EYKA 2H9YA 5IC5A 3UUWA 1Z6AA 1TZ2A 1NJ2A 3F8WA 5FUBA 2FR8C 2WJYA 3AEKB 1EIWA 4YWHA 4B31A 3GA5A 5C8XA 3LCRA 2HLDA 2YFKA 3OMLA 1F0PA 2YIMA 4NKRA 2AUTA 2PT7A 1SULA 2VPTA 4TYQA 4YS6A 5EP4A 1REQB 4PCUA 3OLZA 1A5SB 3I23A 4EF5A 2NMVA 1VHQA 5SY6A 1E2DA 1JHZA 1L4YA 4M0CA 4Y1GA 1JW9B 1SUCA 3MD9A 2D7JA 5DP2A 2A84A 4YASA 3ZXIA 1F2TA 5DASA 5FNZA 1HSZA 5HSGA 3S2YA 2AD1A 2W2TA 4B4VA 3E9YA 4R5MA 2FQ1A 3GZJA 1SQSA 4MVWA 3RSZA 4CL0A 4KRFA 2YOHA 1KE1A 2B4AA 2MSNA 1SXHA 2QTNA 3VISA 1GDDA 2PWBA 2UV8A 4JSRA 4L0CA 3HNOA 3W2EA 3NUGA 3QVOA 3W5AA 1T5IA 3DB2A 1DOHA 5B57C 2GKGA 2Q0QA 2VEDA 1K08A 2Z4TA 3EUFA 5COAA 3VHLB 3W5IA 5KDOA 3VZSA 2NTNA 1MNAA 5FWYB 1FU7A 5CH5A 4OG2A 2IZ1A 4TKUA 1JDPA 4M2LA 1QK5A 1M5UA 2A35A 2GM9A 1GT6A 3AY3A 3N76A 3UB2A 4YREA 2OQIA 1HE2A 3D6HA 3P9YA 1Z35A 5MDHA 3HR8A 4LXIA 1JAXA 4WADA 3AVVA 5K3SA 4D5GA 1SC4A 3MMNA 4KLNA 1AXEA 1XXHE 4IXMA 1NVAA 4AJ4A 3ABOB 3VGPA 3HCRA 4CZ2A 2WPDD 2X2OA 1YGYA 2VEOA 3E7WA 3PA8A 1PFGA 4RETA 4N5DA 4C7BA 1Z88A 4PO9A 7AT1A 4LXQA 2V8OA 3TQTA 4DQXA 3PHJA 1WQ4A 2HRRA 3EMDA 4KR6A 2ZPAA 1G5QA 1B2RA 2FP3A 2Z57A 3AYZB 3HKDA 2PU5A 1Q15A 3JD2A 3NVAA 4ZYWA 1GL7A 2WJHA 3V1UA 5T7BA 4E5DA 5CDUA 4E1VA 1E64A 4PVDA 5KWSA 1SCNE 1NVVQ 3R5HA 1RBYA 3FNGA 1YF3A 5ARDA 1W36D 4TV9A 3DCNA 3PUKA 5B64A 3BICA 5EIFA 2A57A 1M8PA 2W0SA 3DAYA 1A98A 1EB9A 1ILWA 1RRCA 5LZ9A 1HL3A 5IS2A 1QG0A 4FFDA 1NW3A 3G82C 2R751 4BNWA 3RIXA 1JXQA 4LBWA 3BG5A 4J0JA 1LPMA 4E6EA 2XGMA 4NCBA 3L1VA 2QDXA 3LUBA 1GL9B 2VDOB 2VFAA 3HM2A 4FOSA 1CQXA 4UM9D 4Y2HA 4I50B 3LXXA 1G66A 3FB4A 1WBBA 3K72B 4GH5A 4GQIA 4WXRA 1G98A 1LDMA 4HUTA 1ACMA 3EBLA 1EGVB 1PSZA 3CEAA 4IPTA 3WWCA 4DA8A 1KO5A 2VSNA 3F71A 4EZIA 1KY5A 5B6IA 4PRYA 2C9ZA 4TGLA 1UXIA 2FJ0A 2IUFA 1PV2A 2OM2A 2EARA 1WQ3A 4JB2A 2IYEA 3ZE1B 4RIIA 4NU5A 3H5WA 3I4FA 3IRUA 4FFPA 1PFUA 1YI1A 2WHPB 4JLUA 2HQRA 5IVDA 2F67A 5LQSA 3AF5A 4JVMA 4IKPA 2OQ2A 3A4NA 4GM0A 3LO8A 5CLJA 4A8JB 1H5QA 5FBRB 1N92A 4BQOA 2GYVA 3UUEA 1L5FA 2J07A 3VVBA 4UBNA 3PEWA 1WA5A 5JPCA 3R3SA 2P1DA 2ONCA 4LVUA 3B1JA 3OZBA 2QRZA 4RANA 3VUFA 4MPDA 5G4KB 5J63A 4UCQA 2IH4A 4FYXA 1NOIA 2PAAA 3AF2A 3ZEIA 3K6SB 2B2NA 3PZBA 4IIGA 1MRZA 1XKTA 1WCWA 2GBCA 4P34A 5GAJA 4EJ2A 1QS0A 4YONB 3U17A 5ED4A 3WKBA 1BXZA 1YBHA 5IN4A 5ECWA 1EFUA 3LBAA 2AS0A 1U6JA 3L1UA 1E3TA 4Q4JA 3OTOB 5EMNA 4PE5B 3FETA 5T3YA 2PPVA 1TCBA 3OT5A 3DC7A 2IX9A 2XUJA 4HEJA 1N7HA 4EEXA 1WXHA 3IV7A 2XE7A 1DCMA 3IOYA 3TKAA 1MJGM 4CKEB 4OBBA 1J1UA 1QJCA 1R37A 3HUDA 4W8HA 1U0BB 2X7HA 4IH9A 2VBFA 3MA0A 3TOZA 2XUFA 5B1IA 1E60A 4PZ0A 2ERCA 5FPQA 4OLAA 4G8BA 1VRVA 1KY2A 1EVZA 1KJYA 2O1EA 3E61A 3KE8A 3E0QA 4RDHA 2F3PA 2OZVA 1JLHA 3VRHA 3EGEA 3UHPA 5BRAA 2YHBA 3CZPA 3MRVA 1V3QE 1OI7A 5AM5A 3FFAA 5FBVB 1F12A 4KX5A 3G2NA 3SKYA 1P5RA 3DWGA 1SUAA 3OQ1A 4KB5A 3LV8A 1VRWA 4C4PA 4R8LA 2VP0A 3VDNB 2BM8A 3TSYA 5FOSA 1KO7A 2CDRA 3NOXA 2JBHA 4JX9A 4JYMA 4TS9A 5F1KA 1FDOA 3EFEA 4KBGA 4KGVA 3EN0A 4NU6A 3Q5DA 1DC5A 3ORQA 4OXIA 5L3QB 3DF9A 4WLUA 3V4RA 1EFVA 1UBTS 3PUIA 5HE8A 3KPJA 1WVGA 4M0MA 4JJFA 3KVYA 3SVLA 1N7JA 3A10A 5BOVA 1P75A 4UOZA 3FSGD 3W5BA 4EA9A 2FOLA 1K2VN 2AJCA 1PSWA 2JFHA 3GA0A 1VI5A 4CCWA 1IFXA 3CZ5A 5KKNB 4TXMA 4PYJA 1VPTA 2XQVA 2FXIA 3KQKA 1IN6A 2GPWA 1J25A 5JYDA 2Y1GA 3C6XA 2PZMA 3G9TA 2H3HA 3IVGA 4JL8A 3REGA 3ZZMA 3KU4A 3OHMA 1E0DA 1Z7BA 2LVBA 3FMGA 3N8IA 1EGHA 4EY5A 2B36A 3LXUX 5CVTA 1U3FA 4WNYA 2HMTA 1ISPA 1Q20A 2UZ1B 4M1QA 5E7JA 1MRSA 4OBXA 5ES4B 3BGVA 4G36A 3ROQA 1GR1A 2NOAA 1S2IA 1EXDA 1PQWA 5IXJA 4PWYA 1QE3A 1PL8A 3LL7A 3IVXA 4A0SA 2I2WA 3GLKA 3NHAA 3EFOA 1K7YA 1X0VA 7ABPA 2RGNA 5E1MA 2ZIWB 4WW0A 1NUTA 1KDOA 3CE9A 3X1KA 3KM0A 4EVSA 1ZESA 3BIFA 4ZYLA 2H92A 1B00A 4C07A 2NU7A 1UIRA 1AF7A 1CDDA 5AK5A 3B3GA 3KCNA 4CEIA 3FE2A 4OHYA 1GJRA 2X15A 4PGHA 5G53C 2CLSA 2FLKA 2DTXA 3VHQA 7YASA 2Z6AA 4EJ0A 1R50A 3ZCSA 3SDSA 3CKKA 5FUXA 2NZ2A 4PFSA 5JO9A 5A06A 4Z0NA 1JDBB 5BXYA 2QPLA 2C5AA 4LDQA 4A10A 4Q0MA 3K20A 4HOYA 4R54A 3ZCXA 4DXHA 4BP9A 4ERXA 5DN6A 4OP2A 5EXEA 4FGZA 2DUNA 1S8FA 2F8MA 2VDPB 4XSVA 4E03A 3OCWA 2ODEA 3RRXA 4QHSA 1V8OA 3KVRA 3U16A 4BVBA 3GP8A 3GFSA 1DQNA 4IFBA 4L0MA 4LOKA 1KERA 3CGGA 3NBYC 4C06A 1DJMA 4G5QA 4OHBA 4G63A 1HQKA 1A8QA 3V3KA 2BHSA 1O97D 4HVTA 4KQWA 3UWDA 4B3HA 5A7FA 5CD9A 4WT7A 1DO2A 3QWFA 4OGGA 3FMVA 3GROA 5IJ9A 5HBGA 1DKMA 3Q3VA 1TUEA 1K8YB 2FZKA 3AR7A 4G0NA 4KSBA 2VK1A 4PLYA 5DPMA 2WT8A 5BSVA 3V46A 1J5EB 4IUBS 2ZAMA 3S81A 4BAGA 4Z49A 3IEPA 4UFOA 1EBUA 4D4KA 3OKAA 2NU9A 3IR5A 2OCDA 4G86A 2D4AA 4LOAA 3L06A 4HFRA 5E3HA 3DMTC 3GF4A 1TCUA 1QHXA 3C5HA 4L72A 3ZU5A 1HLPA 4BEWA 3K9FC 2NNWB 3GVHA 1A7UA 4WFKA 1CUXA 3E81A 3WV4A 3J7TA 5BQXA 3VKWA 4LZNA 4GRDA 3G2IA 4L1KA 4PPGA 3P9KA 5FFMA 3T9BA 1RQLA 4AUEA 1JN0A 3AXTA 3C6QA 4KGXA 4MK4A 1D09A 3IBGA 2PS3A 1NC1A 2HV8A 2GUGA 1E8DA 3ON5A 3P2OA 1O95A 5B4VA 3PEUA 2IIVA 2OO3A 1BA2A 3FI9A 5ALYA 5H0IA 4RK4A 3T99A 3QELA 3W8EA 3DAHA 6PFKA 4YAUA 4F4UA 4Z4QA 2O59A 1E2BA 2QD4A 2QR5A 1OJ7A 2IOFA 3B3AA 3H97A 4Y1RA 3VC2A 1BGWA 1RM4A 3TM5A 1E6LA 4Q9KA 4DCOA 1QHIA 4TV8F 2QP9X 3PD0A 5EMJA 3QFCA 3E84A 3I5UA 4F11A 3PVZA 5BOSB 3UMGA 3SHFA 3FR8A 1MIOA 4AZWA 4C87A 2G36A 2VF4X 1GFWA 4YP0A 3ROZA 1SRRA 4BNYA 4DLSA 5ALVA 5G0SA 1QTQA 1ORDA 3E53A 2HWYA 4BNXA 2WRZA 4BFTA 2XDAA 3ESDA 1H4QA 1WIWA 3G13A 4MKIA 4J7AA 4EF4A 4DRXB 3LT0A 4HC4A 3LUDA 2HPZA 4MR8B 1EX1A 3G2PA 1N3YA 4BE4A 4DT1B 2JD1A 1IB0A 4NBNA 1FF9A 1MC1A 1XCMA 3K2BA 5LXTF 3B8HA 2CKMA 3AZPA 5C4MA 1RYYA 4E2FA 1Z2NX 4CMHA 3HVRA 1BX3A 1DQSA 1E9BA 1JVSA 3QKSB 2F3UA 1NFFA 3EXEB 3PSAA 2ZS9A 2FFAA 4S05A 2PMBA 4CW7A 1Z6PA 3CG0A 1TFRA 4AJIA 1E7RA 2F1OA 3KB6A 3PDIA 4H1HA 1L5ZA 4NAUA 2VXOA 1ZAKA 3AF6A 2J46A 2Q2OA 5T6MA 2FG7C 5BYJA 1F48A 3ZLUA 1TW2A 2DBYA 4QX6A 4MVJP 1EBBA 1GSIA 3IOBA 3QJGA 5E7IA 1T5SA 4CHTA 4L9SA 3HXPA 3UV6A 2OAGA 2CXXA 4YQEA 4CL8A 1AKWA 4C5BA 1VKNA 1CDEA 5B1DA 6REQA 4PGFA 1QXSA 1QGUA 3QYJA 1FQWA 3DJYA 4JP8A 5TB5A 1YS1X 5TGTA 4PAOA 1RFGE 1QVZA 3KSMA 3V5NA 3WFJA 1EK6A 2B78A 2JAPA 5B2ZA 4DABA 3WRXC 1DL5A 5ALIA 3OM0A 1KQOA 5C3MA 1VYVA 3M5CA 1P2FA 1QOQB 1RXIA 4FFLA 1FXSA 4IICA 5CFZA 3QEBZ 3IOCA 3PC8A 2GA9A 1GCUA 2WNHA 3B20A 1UOOA 1XEXA 1P7ZA 1A5AB 2GUWA 1HE4A 4JP3A 1L6IA 1JPNA 2RHTA 1JSXA 1M8GA 3ANYB 3E03A 1V1MA 2ZYSA 2J85A 4QQ8A 5F5XA 4WL0A 3IYLW 2BR3A 1R4MB 3ND9A 4WA7A 3IDOA 1T1SA 4E3WA 5CITA 2KMLA 2BEJA 1PUIA 1UM9A 3OCUA 1JNYA 1NBOA 1JU3A 2K2QB 3OIDA 3RT1A 4A73A 4BVJA 3HYRA 4NMLA 4DB2A 2P67A 2CVZA 3L0IB 3LQ1A 3IIKA 2BHLA 4LAFA 4PBTA 4WEQA 421PA 4DEVA 2OXEA 2ORWA 5CB4B 2GBGA 1KXZA 4X91A 3T0FA 3ZDFA 4NZNA 2YQ5A 1CY8A 2C88A 2XOKD 3Q0IA 3OSUA 3T5CA 2O2SA 4RSGA 1CUZA 2OHIA 2IOYA 3C4VA 1I3NA 2JIDA 1VKHA 2BKEA 5BN4B 1QWOA 3GPBA 3T7RA 1RMTA 3VDXA 3WQSB 3S27A 3ZU3A 2G17A 3KOYA 3SPXA 3IUYA 3O8NA 2PQMA 2O14A 1WDLA 3OBBA 3RJZA 3RYIB 3UXEA 3LX8A 5HQ3A 1ZXLA 3LT5A 4GVPA 1PZXA 1E3JA 4DLKA 4DS3A 4HAUA 1HH4A 4MYRA 4MYCA 4RJTA 4OQZA 5EJ8A 3S6JA 3SBXA 1K7EB 4YH1A 3JQAB 3LDUA 3QNMA 4D9JA 2H9AA 2I4OA 1I7DA 1W52X 4IDQA 3CNOA 3JQ8A 3MIIA 1W75A 3GEPA 4ALIA 2O8CA 1EX6A 1W1UA 1T2FA 3C3MA 4HAXA 2IEYA 3O8QB 1W25A 3BXPA 3QLTA 3P52A 4JUDX 5E4FA 5FWYA 4AECA 1ZNQO 1RRGA 2D2EA 3N59A 4UQPA 4EF6A 3RIYA 3PICA 5EHXA 4RGBA 4AN0A 2ZTMA 5JSKA 1U0NA 2ZAYA 4AYXA 5A5FA 4UOQA 4G8DA 2AE2A 1XF9A 4LVOA 3VTZA 1EVIA 4N8SA 4EARA 1SXJC 1L7RA 3P97A 2I6GA 3PQ7A 1D6SA 1LKZA 4TZKA 4F04A 5JEDA 3MGAA 2GWRA 2N0SA 5KVQA 1NXVA 4IOJA 3WYEA 4ZDKA 1NR5A 4G01B 3HG7A 3C1AA 1HFJA 1E4EA 2LZ0A 2MHCA 4P2BA 4JGGA 3CCBA 2Q8QA 3GHHA 3EEBA 5DTQA 1CE8B 3TL6A 1BKDR 3QKIA 4QRDA 4RVDA 5B3JA 3V7FA 2ILTA 2G08A 3C1OA 4S0XA 1JKJB 3C45A 1ACLA 2C7GA 3FDZA 4RZXA 3LT2A 3NHKA 1Z25A 2L0XA 4ME6A 3QXSA 1XXLA 3FZQA 1J49A 1W0JA 3BE5A 5SYMA 4MUGA 4R2XA 4LRYA 5J4YA 5JQWA 1HPLA 1YJ8A 4E21A 1D2RA 4XJVA 1J42A 4ZTBA 4X7RA 5F4BA 1B3BA 2AA3A 2CBZA 2BPOA 1D5CA 3C6ZA 3CO5A 1X7XB 1A9RA 2OP0A 5FWXA 3P19A 2ZVJA 3AHJA 2C7QA 3NWOA 1ODFA 3I2FA 4LWPA 2W6JA 4KAXA 4PQRA 1RI5A 2AOTB 1ECJA 2AJBA 3PQ5A 1XVAA 3DTVB 2G6BA 3DVRX 3MSXA 3R74A 1QCCA 1S2DA 3QBJA 5I4IA 1CERA 5KIAA 2WTMA 2LCQA 5DWVA 1GN8A 4URXR 1RJDA 4N48A 3SSAA 2WTNA 4CEJA 3ONDA 4FCVA 5DHAA 4ETNA 1MN6A 2JI7A 3K2QA 1KI6B 7REQA 4RK5A 2QTZA 2A7XA 5JAPA 3ZXUB 3EX7C 4ZV9A 3CQ9A 2XUKA 5LIRA 1P7CA 4JKOA 1H0RA 2WMYA 3OLWA 3WJ1A 2FPGB 4Z54A 5BY2A 4WCDA 2YBDA 1Y81A 3D7NA 5FADA 4MGHA 3N2ZB 1SK9A 4Y2GA 4IUCS 3K1YA 4BQFA 3ZKWB 3UMCA 2VL7A 2XUZA 5GY7A 3BIWA 4D8VA 2QUJA 4EEZA 5FDFA 5AVOA 1L7DA 1WB4A 3FFWA 4U3JA 4KPUB 2IELA 2YXNA 4WFIA 3KTAB 1FX0A 3A2MA 5AQEA 1FNMA 2IEDA 5BQOA 2W4MA 5DM1A 2W2PA 4JJ6A 5K0JA 3TECE 1MX9A 1YJCA 5IP5A 1QLJA 1F6DA 8GPBA 3RVBA 1L8LA 3N0TA 3EGXA 1JH9A 3P2MA 1TNDA 4FEGA 3GDWA 4H15A 3W78A 3R9IA 3ZLVA 4W5QA 1C9EA 1FCJA 4NBRA 3U9LA 1VDMA 2P8JA 2WQZA 1XROA 1B0UA 1Q7RA 1SFRA 3IMKA 1W85B 2GN8A 3PGLA 3U48A 2W11A 1GZHB 3IO5A 2CDAA 1H8HA 3OEWA 1ENOA 1ADGA 2XMDA 2Z9BA 3IEIA 5CIQA 5E4JA 2DERA 1GOTA 3BTSA 3R1IA 4LEIA 3IPXA 4MQ5A 4OHRA 4MI1A 3E22A 1G63A 4POAA 4QYSA 3OZIA 2XXAA 4CIVA 2CFSA 3AUXA 4DQLA 1E9SA 3E15A 3KS9A 4MIEA 2WF5A 3ZDAA 2XRFA 3JVVA 2GCIA 2PDAA 2OUIA 3UY4A 2ZE5A 4TPKA 4BJ6A 5DK6A 1IAQA 3OQJA 1CPYA 2FOXA 3C8MA 4G41A 4V0QA 4C0QC 3GLIE 4Q15A 1XJ0A 2YWHA 3MC1A 3K0AB 3VAZA 5JV5A 2J48A 1UOQA 3DMFA 2OCBA 1R0XA 2HIHA 1X7ZA 2ARKA 4Z7JA 1WABA 1BMQA 4ZT6A 5EJ7A 2RAPA 1J7JA 2GCEA 2VDJA 2BFFB 4DMRA 2C07A 5DCLA 4ZCLA 4G5GA 4EFDA 1QIIA 2MSEB 1R00A 2O8DA 3ORSA 4PXSA 2NVBA 3U49A 8MHTA 1G2QA 2R79A 3W5CA 4LGVA 2E0IA 4DIBA 1Q16A 3ULKA 3VR6D 4UZSA 2YWRA 1L4EA 1TUBA 4IF4A 4GHWA 4EH1A 5K0TA 5CM2Z 3DLHA 3QM1A 1OILA 3GK3A 3IQXA 5ESWA 1LCIA 1VA5A 3H0EA 1IVNA 3SCZA 5JD5A 1VB5A 5JARA 3GFFA 3I9V6 4BEJA 3PQ2A 4XQEA 1DKPA 4UTNA 2IYUA 1HFWA 3K3PA 3ZU6A 1BROA 2MSLA 2XF8A 3GEHA 4JP1A 4W82A 4R2IA 1ZNWA 4CEJB 1JG3A 2I2CA 2Q1YA 4KU4A 4EKGA 1AQ6A 5DBHX 2G4CA 1EE2A 2PY6A 5TDHA 1DAKA 1RLTA 1SZJG 5ELXA 2GCOA 4XASA 3HB0A 1ZISA 2B0JA 5CXXA 2H1LA 5JVDB 1TA4A 3SQWA 3AEYA 2W71A 3O8OB 2PH7A 4X65B 2WUGA 4JOQA 3O91A 4MRNA 4PGGA 4DA0A 2GDJA 1EK1A 1BCRB 2JHCA 3ENZA 2XEXA 4DSZA 3LVRE 4LV5B 1I7NA 1Y8QB 3N6RA 4HHEA 3WKEA 3UJ6A 2JFVA 3K0FB 5SZKB 1VJ0A 4X1OA 3KV1A 1O94A 4Q3CA 4TXJA 2E37A 1ZVQA 5D3QA 1OF1A 3TX2A 5ADWA 4D0NA 1OXXK 2GYWA 4R9RA 5AM0A 2DH5A 5LYJA 3K5HA 1CZHA 4H3HB 4LY0A 2ZCVA 3I72A 4PN7A 3CMMA 2P6NA 3CO0S 4N76A 1PL6A 1GSOA 1WS6A 1MO3A 4N6OA 3D31A 4IHJF 2NGRA 1ZD2P 3QVGB 4MI3A 1DS6A 2VI5A 2Q6IA 1C1DB 3O2JA 2EBWA 1E79D 5FF9A 2W70A 1X94A 5SY9A 4EBFA 3RABA 4BMDA 4RTNA 1P31A 4PS0A 4RK7A 2B5WA 1SELA 3NEAA 4S24A 2DWOA 1PFQA 2BTQB 3E7DA 1WV0A 4X45A 2FETA 2AQKA 5JY1A 1FRQA 4O4IF 4TSRA 1KK3A 1NYRA 2FP4A 3WS7A 1X2EA 2QR2A 4QDZA 4X9XA 5AKLA 4DCJA 4ND3A 4EOGA 1NMEA 1ZM2A 3F6EX 1RE0A 1U11A 3EEIA 4M3NA 4R81A 4EUEA 2II6A 1ZPDA 1N2OA 3ITEA 5FOWA 4PZZA 4HDRB 3VH3A 1X9HA 3KTFA 3A6DA 4B7CA 5I51A 4BX2A 1ZKMA 1WUYA 3SYKA 3Q5EA 1DIAA 2O7SA 1Z0FA 3FCOA 4LX0A 2UYHA 2P27A 5BW6B 3LQRA 1V95A 3IX7A 4LA4A 1GUYA 3WLMA 3ZWAA 1MABB 1ZN7A 3C7AA 4X41A 4RA6B 4C30A 1GG9A 1MBZA 2K4MA 1YZYA 3KPYA 3T9EA 3TB4A 1ZO8A 4N7JA 4C7MA 3VZBA 5AIAA 2GEVA 1PWYE 1LS1A 3L1HA 3NHFA 2PMCA 2GTPA 1K6XA 3I05A 4L9WA 3H84A 3E9ZA 1T0IA 3HMKA 1UPXA 5D8DA 3SC3A 4IJ5A 2RKWA 4R2JA 1J9EA 1Z13A 2PD3A 2IWRA 3WBKA 1ULBA 2I1LA 3WWOA 1QNFA 3WK9A 4EKDA 4B2IA 2E4VA 1C9MA 1N6IA 1W0KD 3BCRA 5CDHA 4EHLA 1AKEA 1NSFA 3L84A 4XQCA 2ZM6B 2CVHA 3ZJUA 2EBHX 3UBMA 3RG8A 3GT4A 2R8RA 3FVQA 3FR7A 4O0LA 4YX9A 5CEEA 1OJLA 2CHUA 3INTA 2XYQA 5A4KA 4CT0A 1JIQA 2HHAA 1D1TA 1EE1A 1E7SA 2QLNA 4ZKDA 3S7TA 5B5SA 3WYFA 2MJLA 1M2OB 4PFKA 5A3QA 3W7VA 5JAOA 1O89A 1BOOA 1T3TA 2W2XA 3UC9A 1Z0DA 2OCLA 3PC3A 4FT4A 4NBVA 1JSLA 1MH1A 1UFKA 1IN7A 1C9NA 2ZIGA 2ZTHA 3FNEA 3H2BA 1KDTA 2DLNA 4LWQA 5KNCD 1SXPA 3JASA 4DPMA 4NH4A 2FN9A 2YZKA 2I6XA 1YS2X 2HA3A 2XT6A 4DT1A 1N5KA 1WXIA 1IHDA 1K5PA 2NIPA 2O0LA 4TL8A 4AP5A 2VP4A 4GMGA 3IHLA 5ALWA 4R2LA 4M0EA 5CM8B 2OLEA 2B1IA 3OJLA 2XB8A 4LZOA 1MIHA 2GRJA 3EYWA 2P9BA 2EHDA 2WJPA 4G4GA 2IYAA 3PPWA 4XLLA 4YRNA 4ZTZB 1MOQA 2HSDA 1ZFNA 2XMRA 4P4SB 2PS9A 5EESA 4BRWA 1YSCA 1SD2A 5BUCA 3L4BA 1PWEA 2RHDA 1BSVA 3CGWA 4U00A 4U1RA 3WGQA 3WQHA 4GLJA 5DRTA 4DBVO 1ONOA 3O3OB 2MU1A 2CXHA 4PVCA 2JIZD 1MW9X 5GV8A 3GG2A 4IJWA 1K5HA 2HQOA 4PM4A 2RBGA 3CNQS 2JCXA 4PTYA 3UJHA 4BVAA 4B0PA 2WUWE 4RD2A 5K3FA 3T3PB 1OBFO 3LZ6A 3SEFA 1MJFA 1PD1A 4NDZA 1I2AA 3LT1A 1PJRA 3VI4B 2Z30A 1PVVA 1QVRA 2WHEA 2FWAA 3G5LA 2YUTA 3BJMA 3HB1A 3H11B 3ML1A 3ORHA 4MKFA 1KS9A 4XQ0A 3IALA 5T57A 2MCFA 1YO6A 5IVPA 5KOYA 1BX1A 2EIHA 2H1HA 4NJMA 4WZAB 2XB2A 2O2YA 3UAOA 5C81A 2D0OB 2A78A 3CEJA 1E1YA 2IXTA 2VT6A 3HDYA 1IVYA 3ZH9B 2AFIE 4ZXPA 1V41E 3I9KA 4LXUA 2PWAA 1MJHA 4C3VA 3PXEA 5A62A 4PLWA 2KX7A 1W4BA 1UAGA 2GZMA 3PHHA 1JFTA 3QA9A 2EW1A 1LBIA 4JT9A 4PLVA 1R4MA 2BUCA 1LPAB 1C3VA 1E2NA 2QX7A 3PF9A 3NYQA 5I01A 1DAGA 3HP4A 1QQ6A 1A8HA 5K2MA 2ZKIA 5CLQA 1OZHA 2JLAA 2VTKA 3DDWA 4CL3A 1Y7HA 3QWBA 1KMCA 2BTOA 3DHVA 3DUFA 1ZUNA 4RHFA 4IIUA 4UEQA 1Q7TA 4IJKA 2WYHA 2QXUA 4XGRA 3VV3A 5B4TA 4R7TA 5IUJC 1WMBA 3BTVA 4K9SA 5TMDA 2DR3A 2C3YA 4ZQFA 5IVIA 3DKIA 4C0JA 2WTEA 2IZZA 1AS2A 4RD4A 1PQUA 1KJWA 4RXMA 4YALA 5AJZA 5CYFA 1U8AA 4X5OA 2YX1A 2PRKA 1OYOA 4AJ9A 2AZTA 2Y1OA 1B6RA 2REQA 4EFKA 5GVSA 2PSJA 2HEIA 1MOSA 4GGPA 1AK9A 4RO0A 3PDWA 4BFSA 3A3OA 5HQ3B 1IH8A 1N3BA 5ALLA 5L8VA 3DF7A 5KOHA 4OUDA 3DLBA 1F3OA 2JA1A 4JX8A 2F3QA 1MH9A 5H4HA 2GCGA 1FUEA 3L8MA 4AJEA 2DHDA 4LQCA 3VKFA 4FOLA 2IYWA 1H65A 3BC1A 3RKSA 3I2YX 2HA2A 5ES3A 2ZWMA 4E32A 3RADC 4ZDIA 1X80A 5HF9A 5CUQA 3L5KA 1KVTA 1ZIYA 1UEJA 2AC2A 2KS6A 3EZ7A 1NU6A 2DFPA 1Q91A 4B6QA 4X8OA 2WYIA 1SC1A 2NX2A 2GCNA 3NAGA 4TT3A 3RS7A 3VU0A 1U1DA 2EAUA 1LTQA 2PKXA 2QMOA 1QRDA 3GYGA 3RARA 3WYGA 4PO1A 5B1YA 4RSHA 3H2ZA 5HGJA 2M6LA 1SIUA 4J1TA 4RY9A 1E99A 1ID1A 2QLTA 2VH1A 3E3LA 4CWAA 5KWVA 1FJHA 2ASVA 1R2QA 3GLRA 1ZCBA 1YJAA 4JYCA 3HUFA 1Y4ZA 1CX9B 3M3DA 1NGSA 3DBVO 4BMSA 3ZE6A 1FP6A 2OGZA 3LFHA 3SZUA 3FDZB 5KJ6A 1NUHA 4RVGA 2WBLC 3ZJ4A 1JR3D 3LCCA 3V7NA 1G7RA 5BWLA 4O5AA 4MPPA 4O2BB 1RI1A 4LV8B 3OJXA 4WY5A 3A4VA 1ZJ5A 4E1BA 3ZZUA 2ATVA 3U6BA 2UVPB 4BVHA 5FWXB 4Y1EA 3DT9A 3CBQA 1IY1A 3M8KA 4D7AA 4CLRB 2C2GA 4H35A 2BGMA 4MX8A 4B2LA 2RHWA 2I67A 4OQEA 3U4AA 3B2QA 2CHFA 3IDZA 3H1TA 1KWKA 3GLUA 1KVUA 2OD2A 4UHBA 3JZMA 5DF1A 4JYBA 4Q6WA 1NVTA 2CXTA 4IMJB 1GT91 3RFTA 4DLYA 2Z4SA 3W0LB 3CLTD 3DCJA 4X1KA 2TS1A 3U5ZB 2AFHB 4TVBA 3TBFA 5KBYA 3ZDQA 4Q1CA 1JP7A 1OIVA 4MQEA 1MHPA 4FOOA 3UTCA 4F0JA 4AKHA 2VKTA 3FM9A 5H9VA 3U62A 1CEQA 2X9LA 4NLLA 1NBME 4G26A 3O73A 2J0UA 4RVFA 4O2AB 4Y0NA 3PBKA 3SSOA 5ICMA 3IIMA 4L51A 1YULA 4KK3A 4FKZA 4CQLA 5AUNB 4CKZA 1TM3E 1SPBS 1RHJA 2C2KA 1O1YA 1XA3A 2D1YA 2NTYC 3AR8A 4RACA 1SD1A 4KO8A 2ZSJA 5EGNA 2XRZA 2JAOA 4CM7A 4OMDA 1P2BA 4PX3A 5JS7A 4OHUA 1NP6A 1JYFA 1VSBA 1DX6A 3PHLA 2JCYA 5H83A 3V48A 1YH3A 3EGXB 1KP9A 3I12A 4EDFA 1QYIA 1ZIDA 1JEEA 2E3JA 5A4JA 1C50A 5JSYA 3QYFA 1DP4A 1SA0A 1JHPA 4JJ4A 4C20A 3D5EA 4Y2XA 4TKVB 1A27A 5A03A 2RDMA 4AZ3A 4XWGA 3K9CA 3GLQA 3WK5A 1M1ZA 3NHSA 4H3VA 5BSGA 4RPGA 1R3DA 2CBGA 1IMJA 2QR3A 3ESYA 3K9HA 3NRCA 4MW6A 4Z1MA 3JVDA 4M0UA 4YRBA 3IMFA 3I34X 5JASA 5JMOA 2IPNA 1KJ8A 2VP2A 4EPTA 3FUTA 1XT6A 3NRBA 4P92A 5SICE 2WY2D 2X3UA 4KI7A 1O6CA 4R9NA 2E18A 4B9AA 3PUVA 3R6LA 2WFLA 4BMVA 3TD2A 3DMNA 3NDIA 2RGEA 4ECAA 1T9KA 2Q29A 3DV0A 3IT1A 3PC4A 5TS3A 1QJ4A 4KH1A 4OHMA 1SB8A 4ESOA 1REQA 3GN1A 2VOJA 1SHUX 5K45A 3EXHA 2CL5A 2EU8A 1Y1SA 3LC1O 2XT9A 2N1BA 5DKFA 1L5WA 3CLUC 3FN4A 4UKDA 1E3IA 4IDBA 3BMNA 3MS7A 4K87A 4UBMA 4KFSA 1QQAA 3EA0A 1BDMA 4CEHB 3F6YA 3OT1B 2OHXA 4Z3OA 2OBLA 4ZVTA 1A2BA 1AQIA 2ZIAA 1W6RA 5FOUA 4CT4B 2FZLA 1BEZA 1F3LA 5AW2A 3KAKA 1HFKA 2BN4A 1TJ3A 3ST7A 1RSZA 4I55B 4K6MA 4RMGA 3ZY5A 1RYFA 4FC7A 3RQSA 3CE6A 4FNOA 1YQUA 1EJBA 4IHQA 1PG5A 4KIGA 4KO2S 4MW0A 2XYGA 5CXSA 1G7TA 4IJVA 2XUDA 2SCUB 3DZCA 3L6BA 4LI3X 5AXAA 3SYMA 3L7LA 4JVSB 3U1VA 3VAAA 4JLOA 5EJ6A 3PPXA 2DWQA 3N3AC 3DZ8A 2W2KA 3CUTA 3NORA 1LTHR 1U7ZA 4U63A 2JL1A 2JBAA 3DFIA 1Z0SA 3I6ZA 3NUZA 4H4DA 5EZ6B 3CH5A 1A82A 3GQBA 1NBMD 4FZVA 4IIJB 4KXMA 1YQ9A 5GMOA 3PU6A 1IBKB 2XUPA 1T3LA 3JQ7A 4FFMA 1NQUA 1I3LA 2JI9A 4P35A 3G9XA 1M6VB 4R8MA 4DNFA 1QM5A 1Z28A 4LE2A 2ZYIA 4L4ZA 3WXMA 2O7QA 1I1OA 5JVDA 2FMUA 1K1EA 2X2FA 1XGKA 5JCOA 4XVUA 1P29A 2R7AA 3K94A 4EPVA 2CE2X 2FFHA 3NH6A 1I24A 5H02A 3L43A 2QRUA 1CJSA 5F3DA 1KRXA 3PKJA 5DYWA 2I55A 5CPBA 2OY0A 2R1VB 3ZPXA 1UKZA 4PQFA 1XZJA 2V7QD 2WIJA 3D2BA 4WERA 1YB4A 3GLFB 3R5SA 1O9BA 2JDID 1XYVA 2JVJA 1KYVA 3IAM6 3R2JA 4FD3A 1TO1E 3R6GA 1WWKA 4GMFA 4CFSA 5JYCA 4YCNA 3PGMA 4G4IA 4B3GA 1XTZA 4MDYA 2R6JA 4QKQA 2OCKA 4FM9A 3ZWDA 3KYIB 5EIAA 1T8YA 4WNIA 1UXHA 3SZOA 5ARBA 1ECGA 2DHQA 3BULA 4JEHA 2W6ZA 1WNTA 4UDXX 2ZI4A 4PW0A 2WPDA 1U4SA 4ZJZA 1KRWA 3FDFA 1M2WA 1Y48E 1BXGB 1L4LA 3OTHA 4K8OA 2OYRA 5A4MS 1OFUA 3NV7A 3PFFA 4AULA 4GSLA 4EB8A 1Q0ZA 3Q7SA 3REOA 1V1JA 3FGZA 4FZRA 4IEIA 3WL3A 4EA8A 4BRUA 1TYZA 4YAEA 3H2HA 3TVTA 5LQAA 1QUEA 1XVLA 1Z26A 2XMCA 2NV0A 3U3DA 2JCBA 2QVZX 1IXZA 4R8SA 3RYFB 1VJRA 2UYGA 3TF5A 3COWA 1QQTA 2FP4B 4B2PA 3TQQA 1C2TA 3AINA 1Z4PX 4RQBA 3I37X 2W4QA 1RRMA 4Z99A 1FPQA 5BVGB 5C51B 1BN7A 1DTWA 1EZ1A 2IHTA 3GAZA 1GAWA 2FRDA 4OI2A 1DC8A 1AD2A 2AX3A 2ZR9A 3HB9A 1KQFA 2ZRGA 4Z0PA 1RYBA 4HNUA 4JFRA 4NMXB 2VN8A 1ZHFA 5FL7A 1KH1A 1SUSA 3H2SA 2PLNA 2DJ5A 3AEUA 4QDKA 2Q21A 1BQ3A 2A6PA 3EGWA 3TGPA 3NBUA 1U4NA 2X76A 2CDCA 9MHTA 3AJDA 2CVOA 5EXXA 2EJVA 1B1AA 4UBIA 2G28A 2ZYWX 3GGSA 5DSZA 3P26A 5KWIA 3VTKA 4BNIA 5MN6A 3NG1A 4TQAA 4WAUA 1RAIA 4ZI2A 3MJFA 3SQNA 1LY1A 2WKQA 1T2NA 2OMKA 3GOQA 3OZGA 4XIFA 1KEUA 5CRIA 5HIJA 2K7FA 5KOJA 4D3XA 1R4NB 2P6PA 3I58A 4P82A 3S29A 3TJRA 4BO7A 4CKEA 3A0UA 3BFJA 5EYPA 3OFNA 2AMLA 1LI5A 3T3HA 2WF6A 2PZBA 1FNNA 4DGQA 2VLBA 5F1PA 3F5SA 2A1IA 2QAGC 3N75A 1RMYA 2Z5GA 3UAGA 3FGPA 1BD3A 4HQKA 1GU0A 1P4AA 3K05A 2PKWA 3W34A 4L75A 3DEAA 5DM60 1Y3HA 4QJ5A 2WILA 3U60B 4MCIA 1UC8A 2ZIEA 4B74A 3T3NA 4V0LA 1GADO 3R4CA 4LNAA 3JWHA 4WESB 1U8TA 3M6VA 4TUYB 5AXCA 1Y4AE 2C2MA 4X7MA 2UUOA 1EH5A 2WQ7A 2IBSA 2AIRA 3G7SA 4RL4A 4BZPA 4D99A 1I01A 4OA5A 1MO6A 4WJZA 4QPJC 4U6SA 4Y9TA 5JU6A 1IBLB 2ADFA 2WV9A 3OPYB 1YDMA 4MI6A 4QM7A 2W2LA 1DRVA 2H59A 3GARA 3HCOA 1EX7A 2I7DA 4MP6A 2WJ4A 4MPRA 4G9EA 3R8CA 3QBTA 5HTOA 1B8OA 4V1CA 4K9PA 1AQLA 5HOQA 4RTPA 3AESB 3HHEA 2PKCA 4IXDA 2P0YA 4E4RA 2EJWA 5AI8A 2UYCA 4RHXA 1WR8A 3ANMA 2COUA 1GGKA 3OICA 1FFBA 3QKUA 4MO2A 5AK0A 4DQKA 1ISGA 2Q5EA 1NJFA 1T91A 1K7XB 1CR6A 3F46A 2JJ2A 2ZRJA 2GFQA 3ZHXA 1T2UA 4MYHA 4AY6A 4MAFA 1JIJA 3C7DB 4RE6A 4XWYA 4C2AA 1EVEA 4JGIA 4F9EA 1PJ8A 3EF0A 5BR4A 4NZPA 3WKDA 1I5OA 1BVYF 4O3MA 2HXYA 4NCKA 2OQVA 3EOBI 5LWHA 2JFPA 3R0ZA 5A0TA 5GQSA 3FJOA 1FJGB 1XTJA 1I32A 1ORWA 1DWUA 4HH0A 1ENYA 2H8KA 5KYKA 1JRLA 1UXKA 1Q1EA 2H6EA 4HWTA 3HO1A 1EB8A 3JQ9C 4AJOA 1AKQA 3RDPA 1FUKA 4FGLA 5ITZA 1YRYE 1M54A 2NU7B 1W36C 2PJRA 4OOFA 4MWDA 1PN3A 3TTWA 3FNFA 2JRLA 1F0KA 3C8UA 3C4QA 3RREA 1Z16A 3JQGB 4BN5A 5EJ4A 4C6TB 4C4SA 2E21A 5F78A 1HDEA 3FOWA 1Y6JA 4R83A 4B4WA 1WB6A 4A36A 5EJEA 2NXJA 2XJ9A 3BXGA 1J97A 2BEWB 1E1RA 2W83A 1ZH6A 2Y4NA 3O4JA 5ALDA 2IYZA 1G5HA 2QSJA 2ZETA 4O4IA 8LDHA 4AIRA 3G2KA 3B1KA 1PGJA 3VDQA 1JEQB 4EW6A 1L7PA 4ETIA 2Q07A 3OOYA 3V7WA 1FFCA 2GKOA 2WWHA 1RKBA 2IBMA 3JWGA 2NUTA 2Y76A 5FV7A 1H3NA 3SHQA 1THGA 2GXSA 4R0VA 4FYIA 1H1LB 1HLDA 2IZ5A 1C8BA 3IUNA 4H0FA 2ON6A 3PX3A 3JAWB 3ZS8A 4JR0A 4NU0A 4ARUA 1L0BA 1GRCA 1JJIA 4M9QA 3VR1A 3I01A 1QO9A 2A94A 4LJ5A 1HNWB 3KAJA 4BO1A 2UAGA 5IJZA 4DIUA 4IG9A 4QPZA 4UE2A 1Q5PA 1W2WB 2PBRA 3LM8A 1DG1G 1N5LA 1YR7A 3K2IA 3ONVA 2YV5A 1K89A 3LDAA 3LC7O 5ALFA 3BD7A 2RARA 3VPAA 3R7NA 2G8NA 1PGQA 1QVWA 1UWVA 4J1QA 4F46A 1MX5A 2BJVA 2FSGA 2J33A 1NYLA 1Q6YA 1ISMA 3PRYA 4IVQA 4REQA 5EHIA 5BNIA 1E6EA 1V5FA 2IYXA 2NSLA 2VZ0A 5CPFA 2WHRA 5AKYA 3WRXA 3GJXC 4PWZA 3K6SA 3HEMA 1DE0A 1EWTA 3GWGA 4ND8A 3WO1A 1QS0B 4ZVSA 4TXNA 3ZNNA 3GRZA 1IDN1 1ZMXA 1SC3A 3OPQA 1IM2A 2QRMA 2WD7B 1JSCA 5GV7A 1P7PA 1P3DA 2GFHA 2H31A 2X6QA 1T1RA 2XOKA 1PR6A 4EBBA 3B7PA 3QUQA 4K40A 1FW6A 1JAYA 2DPYA 3OE4A 3TDMA 1U2PA 4KXLA 1C3OB 2EP7A 3DCIA 4GGOA 4D56A 2OORC 5J43A 2RC6A 2O2ZA 1OX5A 4Z1MD 1XFDA 4ZI5A 2JEZA 2EOAA 4S1TA 3IJRA 1HV8A 3U0BA 1US8A 5BP7A 4WASA 2O54A 1GGHA 1Q95A 1JKIA 2BSAA 3COZA 4PRKA 3AETB 4YY3B 3KQNA 2IZ7A 2QY6A 3SYNA 3BH6A 3NDJA 1E7WA 1ZD8A 3M6FA 4WOJA 4EG5A 2PUDA 1J7KA 1Y63A 1SVKA 3C98A 1PJBA 3AI7A 3GW8A 1JZTA 5D3MA 2SKEA 1OH5A 4V02A 2IS2A 4BWGA 5TF0A 3AHGA 1UBMS 5J47A 3NTLA 3ROXA 1BE6A 1ZRSA 2CXSA 3GGJA 3ZBPA 1P1RA 1MFPA 4QBHA 5KSZA 3L6OO 3NGLA 2O6LA 1Q1QA 2FAXA 2FR1A 2ORVA 3S44A 3SX0A 2G1JA 2XNHA 3SOZA 1V26A 2QY9A 5ICFA 2Q7DA 3SE0A 5CEFA 5EI5A 3AG6A 2FPWA 4GPEA 1VP3A 4LG1A 4MW1A 3WGKA 4Y2TA 3DL4A 4RGVA 5AT1A 2GPBA 2ODWA 5GONF 2AFHA 3AUAA 1VL0A 1CZOA 4UUQA 4XM1A 5CT4A 1G9XA 4ZOCA 1N1EA 4KQFA 2HJSA 4Z86A 4JI1B 3LZDA 3E1KA 4Z9YA 3V4OA 2B5OA 4EG4A 3HACA 4DCSA 2VQSA 4X62B 2WA2A 4EFNA 4D9CA 4IMIB 3RCBA 3T35A 1SXIA 6YASA 2J0UB 3N05A 2O2HA 1H0HA 3L40A 4GGMX 3T9DA 1HDRA 3X1MA 1QGUB 1UDWA 2NPFA 5EN4A 5DCYA 4L02A 2NO7A 1XTVA 2XPCA 2B98A 4DM4A 4MEAA 2O6HA 1SHKA 2RHGB 1P3JA 5CT5A 3SG0A 3EIUA 2C0CA 3CNLA 1Q1ZA 4M9XA 2YW2A 4MCJA 3KELA 3KQYA 4IFIA 3UVEA 5LIPA 1B93A 1CR0A 4M9SA 1YNOA 2PU7A 3MQ4A 4B6OA 3EGCA 5I7SA 1AV6A 3DMTA 4ENQA 4PZYA 3EFHA 4JJ8A 1NX9A 1ETUA 1W8DA 1ZI9A 4R1LA 1HY3A 4TTQA 5HMLA 2YJ5A 4ZIRB 1SQFA 3V4PB 1P9WA 1T9DA 1CG6A 1XLVA 3HGMA 3BGDA 3FNQA 3BWBA 5TNXA 3ZYZA 2FWJA 5TXGA 3EPJA 2SKDA 1LNSA 1UBJS 1YCGA 2YIDA 1YRHA 3G8BA 1I3CA 2CUZA 4O8ZA 5KNBH 3VSCA 2G09A 2ONYA 4PBRA 4DXDA 2Y9MB 1H6BA 4GYKA 3HUUA 2ILVA 2DU8A 4XLTA 4H0NA 1CUDA 1OI2A 3UATA 4E4TA 2ACEA 1QO0A 4P7GA 4BNTA 3AU8A 4HQRA 2IIBA 5AVJA 5MGNA 2X7JA 4CG2A 4YRPA 2VUSA 1FPMA 2EQBA 1GKIA 4KNVA 5IAGA 4A2WA 4ZVLA 3NHRA 5BN1A 1IUOA 1ZRMA 3EXHB 5GGYA 4ER3A 3QEMA 5CTAA 4F3CA 3NTRA 4JELA 4MVJD 3RSGA 2ZAIA 3DEHA 4B7ZA 4RDXA 2YIVX 1S5PA 1LBSA 4RLFA 1YXMA 3FKSD 4ZDWA 2PKQP 1HYHA 1XZCA 2VJQA 2JLVA 1K0UA 4H7EA 4ZVNA 5HVNA 3W2HA 1DXHA 1YZHA 4HR7A 4JDPA 4JP2A 4DAOA 4DWJA 2QN3A 4TS3A 3KLMX 1S8NA 4LF9B 2HLHA 3C7TA 3LQKA 4E2YA 5BR1A 4D3ZA 4N0EA 3U4MA 3UCEA 2P9EA 1PVDA 3V2HA 5LJIA 2AYZA 2QV0A 2XT0A 2AG6A 4W1QA 4LJAA 3MFQA 4J49A 4DEXA 4PICA 2GJ4A 1IZYA 1NVXQ 2JC3A 3DDOA 2HX1A 2P77A 3PNKA 1TZBA 1ZVMA 3SM3A 4K6OA 4UUBA 1W29A 3F7OA 5CFQA 2J87A 1SHZA 5IDVA 2I71A 2V7GA 2NU9B 1OSNA 3O03A 4ZJPA 4NX2A 4UE3S 2LPMA 4YR9A 3SQMA 2PH5A 3IO3A 3CSDA 2CE7A 3G7UA 4GNKA 4GQBA 3SIXA 2WDPA 4IX9A 4Q1BA 5LA6A 4IRXA 4EY4A 3EBOA 3FGOA 4EVRA 4OHCA 1ESNA 3V8EA 5KYYA 2W2LD 5L3ZA 2AYYA 2GF0A 3WIVA 1GQRA 5H80A 3SDZA 3WQRA 3R09A 3GLIA 3IUMA 2XH8A 4AMBA 5LFAA 3KHTA 2IS4A 3CG4A 1SWWA 1SN7A 3HP7A 1LVUA 4LDAA 4CV0A 1M0EA 2ZTVA 3HL0A 3OTGA 1M33A 3UKJA 4HGQA 2R68A 4I2VA 4F5ZA 3SGLA 4H31A 1Y33E 1C7QA 3DAFA 2D1FA 4H7KA 4X20A 3SFVA 2WB4A 4JVNA 3E8MA 5CLGA 4XDZA 2RGDA 1QIDA 1O95C 1ADJA 5F51A 1G3UA 5IANA 1UXOA 1LW6E 1XUOA 3QVTA 3GLFA 1D0SA 3AMVA 4K9NA 4DR6B 2W5UA 2DJIA 4KXFB 4HDCA 4JEMA 5BVHA 4NXNB 2QP4A 4DMCA 2ZGVA 1YIAA 1IIBA 3I73A 3A31A 3N6VA 1R66A 5GGXA 1ZYUA 4EA7A 1YUNA 5D51S 4DA4A 2VAWA 2PYDA 4IWXA 1GNVA 4DA9A 3VPSA 3ZGLA 3GJZA 3OX3A 4M8NE 4GUDA 3BD8A 1ESCA 3Q2OA 4ND7A 4YVFA 3RIGA 5LD2C 1IEXA 2VHQA 3AHIA 1X38A 4U8HA 1IOVA 5C8YA 4XVCA 1QPZA 3EVDA 3I53A 3DOCA 1NXXA 3CPHA 1UBCA 3RROA 2ZUUA 3I3OA 2X8JA 2MMCA 4KDCA 2MMGA 3AIKA 1BFDA 1U99A 4OHVA 4QODA 1HT1E 1Z45A 2B3DA 5EE9A 1QK4A 2XMSA 3G8YA 4J2OA 4BDSA 4CG3A 2FW1A 2ZB2A 4CVNA 3TB6A 3TG8A 1K6IA 1V5GA 2DSNA 2H1SA 2CL7X 3BQNB 3EZ9A 4BVLA 2HLPA 5FTKA 3HB5X 5IAEA 4R2MA 2RGUA 1M76A 4KTVE 5AW5A 1C41A 3RVQA 2C7BA 3IP5A 1M2EA 3M83A 4LECA 5JC1A 3IQGX 3GR6A 2ZBPA 2F1KA 4C1BA 2A1UA 4JR1A 1Y1KE 3N8GA 1NTRA 4KOEC 3AEUB 1LDNA 1NBWB 2ZTLA 2Q7OE 3PIIA 3F73A 4QATA 2OXRA 1C0LA 4DTIA 3VNUA 1S4MA 5TQ2A 1PT9A 4NECA 2CD7A 2JNWA 4YXFA 3ZJTA 5I7OA 3JYLA 2QROA 3RGGA 3HUEA 1NN3A 4QECA 2G88A 4GU5A 3DFZA 3GJ4A 5C5EA 5KS2A 4QARA 3BZWA 1VE3A 1Z8FA 5FJIA 3SOPA 4LHEA 2WMOB 4UU1A 4ZT7A 3TRJA 4XCQA 1II0A 1Z4OA 3F5MA 3SY8A 3QNWA 3PZRA 1J33A 1BYIA 3RTEA 2ACKA 3UJBA 4X1IA 1XTPA 5FYDA 3QNUA 4ASUD 2I34A 1WMSA 4EB6A 4QDJA 2XMBA 3GBVA 3W1EA 3RC9A 5M34A 1YVPA 1VBNA 2CUTA 3AJRA 3A9UA 2ZUCA 4G09A 3HLYA 4YJGB 5C8ZA 1G6OA 3D1LA 3T15A 2K2WA 4EGSA 1E9RA 4KR2A 1DUVG 1A2KC 3EDMA 5GONA 4XPIB 4YJFA 2CC2A 2I0FA 4I5GA 4ZEXA 1U9IC 1BHSA 1A3CA 1DBRA 1QBGA 1S02A 3CRZA 3H0KA 4QDUA 4UTXA 4TYWA 4OLBA 4AMGA 1GSHA 5AVVA 4CR6A 1CLEA 2XR1A 3H2KA 3E4DA 3Q41A 1XHEA 3SQDA 4GICA 4AY4A 2H7VA 3NAMA 1QOPB 5CM9C 4D9EA 1WBDA 1OAKA 2IDZA 3WB9A 4KQ6A 1BKYA 1SWVA 1JBQA 4KFCA 1FQOA 3U7QB 5D5QA 3HJCA 3S5UA 1DC6A 5J2TB 4NARA 3Q15C 4BNFA 3RF7A 4XARA 4YPOA 1X39A 3DQZA 3A9TA 5U4XA 1EPUA 2X9QA 4G1CA 1EUCA 5JXIA 3O0TA 1W44A 2B3TA 4Q4LA 4EY7A 1L7EA 1RJEA 3OUUA 3IC5A 3NTOA 5DLYA 3N87A 3AR4A 3NPAA 2FRVA 4P08A 1SQGA 1B6SA 1Y9AA 1QHSA 5MFZA 4YJ2F 4K6HA 1RZ3A 4LI0A 3LH5A 3Q8LA 5IYZB 1CHNA 4JI8B 5T4EA 2M2IA 1KQNA 2JAHA 5BSWA 1CXZA 5EHGA 3PQ4A 5EJ9A 1YIDA 5EHQA 3C41J 4WMLA 1NJSA 3M6LA 4EB3A 1JJBA 1XJQA 2WSMA 1XAGA 1IRIA 2QVBA 3PKZA 2GBIA 4HYTA 5ERGB 3U13A 2FPLA 3M3HA 4U2DA 2CMKA 4BKPA 5EHZA 5LKAA 2QK4A 2LV8A 4MQMA 2HQSA 4D8TA 1W35A 2BEVA 2XCOA 2HIAA 1VTKA 2IJGX 1G6Q1 3KBBA 4NENA 4XDGA 6CHYA 2IYRA 1LDBA 4GZ6A 5EP2A 5KYWB 1PLKA 1DIHA 2FXVA 3GT0A 4R1SA 5C1PA 5EY5B 1G8KA 1F1BA 3K8YA 2JFOA 4INZA 4CLEA 4Z53A 1C3EA 2W98A 1JMYA 3EG9A 4US2R 2O4UX 4XUEA 1E4EB 4EHAA 4DCTA 2I54A 2VQDA 2CF6A 1DAPA 5BSTA 2ZBQA 2DEUA 1YAJA 2DBRA 1N0UA 3IVMA 3K0FA 3KJQA 5DW3A 3RSCA 4CKCB 3FRHA 4EK9A 2JBWA 2G76A 4EELA 3IB3A 4MRVA 2FW8A 3O7WA 1QE0A 3GFQA 1HUQA 1N5RA 2YVKA 4DDWA 3TFOA 3T4XA 1NQ5A 2DGDA 1GZ5A 2J9XB 4UCXA 3U9TA 5I47A 3QVSA 4CMEC 3U4QA 4RHCA 4XXHA 2H8GA 3ZHCA 4JBHA 1I9CA 3ILHA 5F4ZA 1C5KA 5FTNA 4CDRA 1FU8A 1DJPA 2VJNA 3Q11A 1W76A 1CT9A 4JLBA 1MD9A 1QH0A 2QA5A 4RSRA 4YJHB 5GZ3A 5HCNA 1DEAA 1JEQA 1QP7A 3JWJA 4C7XA 1XTTA 3E9RA 4AG3A 3VYVA 2VUUA 5TGDA 2DLCX 5JPDA 3CW2A 1ZCZA 4R05A 3IKVA 1NJGA 4QGHA 3VI3B 1UBHS 4OXYA 1L7VC 2GBLC 7REQB 4CE6A 1R0YA 3F6PA 1Z9BA 4HPWA 4DQVA 5J2UF 1QANA 1N9KA 3LC0A 1AUQA 1H5UA 2VUHB 3JZFA 4HDRA 5B6JA 4LE1A 1OVGA 2WIAA 5EA2A 4KGZA 4D5EA 1IQ0A 1QRSA 1BH6A 4A03A 1CP3A 1XCOA 1KMMA 1RKXA 3NR2A 3JARB 3TNYA 1WW8A 4CG0A 4BQEA 2OVFA 3HKDB 1LX6A 5KSYA 1Q0UA 3BX1A 4PCLA 3HN7A 2F1JA 4DQUA 3BERA 2B20A 3EC1A 1NVEA 1T25A 1OOEA 2O8FA 3AFHA 1JZQA 4UEJA 3BSYA 3CCCA 1ZI8A 1T0BA 1Y5NA 2WUFA 3G85A 3EF3A 4U6QA 3C1UA 1YRAA 3ZDXB 3DHNA 3ZHQA 1XMOB 4R6XA 1E1LA 1XYYA 3MF4A 5TR9A 4NCAA 3OUTA 2DPHA 1T0PA 4UHJA 2W2VA 5IWCA 2BZ0A 2R47A 4H1VA 2J1LA 3X2SA 4YFVA 1Z0KA 5JT1A 4GOLD 1EFRD 2B9VA 3LXMA 4W99A 2AQHA 2G06A 2GN4A 2WTAA 1AUXA 1RYEA 2HIMA 4Q9DA 1D0VA 3ICEA 1HEYA 1FB5A 1OY1A 1DV2A 3IAS6 5JS8A 2QM0A 3W05A 5KQGA 2GD2A 3EY4A 5ILGA 1MPXA 4ZZ0A 1C0KA 1TLFA 1XVIA 3AEKA 4FGWA 3D8TA 2IXBA 3DT6A 3F78A 5D7NA 2VCYA 2ETVA 1LPPA 3ZGOA 2AMYA 4D57A 2NNLD 5KTTA 1VJDA 1RAAA 1CWUA 2XCLA 1RHKA 2FDXA 2OCPA 3KJIA 3OEEA 4W6QA 5FRDA 1XOIA 5EQFA 3R0QA 5G1OA 4F4IA 4YC7A 2IC5A 1MVNA 1NKTA 2FZWA 3DZGA 4N40A 5JAZA 1VCMA 3WHPA 1VBMA 1YKFA 3PJDA 3PR3A 4S2UA 3KFLA 3EPHA 1Y9EA 3FKJA 5AK3A 3MTAA 1H6CA 5JNLA 2AG1A 2Z2IA 3OIVA 3WA7A 3Q9LA 3R8XA 2M1XA 5EFZA 2C9CA 3WHLA 3QPCA 5AKHA 1AQUA 2ZR8A 3H04A 4A8PA 5B7QA 5A9SA 5H70A 1E9DA 4NP6A 5EMHA 3IDFA 1A9OA 2AHRA 2P78A 4R69A 1KSGA 3U6KA 1A7JA 3MPOA 4Q4JB 3UWSA 4Z0TA 1KZHA 4D46A 2IL1A 1X1EA 4LE0A 5B6PA 1K92A 4EB0A 5AI0A 4JCOA 4B84A 4DLRA 5CDYA 1Q2XA 2PJUA 5JAHA 4KXYA 4BO2A 4DCPA 3CR8A 2H0RA 1GN9A 3UG7A 3GDOA 4BO3A 4ZVQA 9GPBA 4P83A 4TRJA 5IKOA 1TO6A 2OG1A 3NGXA 5WRFA 1BAPA 1OA0A 5E4YA 5KI6A 4DPLA 3A1CA 1ARZA 3M5PA 3IPYA 2O9JA 3ONNA 1M2HA 1UQUA 4XJXA 1VJTA 1OASA 2W6MA 2X58A 2KBEA 1IAVA 1XTBA 1UMBB 3AFOA 4AB1A 1HOTA 3PEYA 1CD5A 4FP9A 4TL9A 2QPTA 4FSDA 4F7DA 2REXB 4UTOA 3PGA1 4UHKA 1XEWX 5JLAA 1MX1A 3GCXA 2IV2X 2VPYA 3WBFA 1MP0A 3W8NA 4OFWA 3WDKA 4UDNA 1WMAA 1Y8QA 2EXXA 2WTXA 2ZS7A 3ECCA 4MLZA 2DHCA 3DFKA 2FCAA 1RKUA 5HDQA 2QRKA 1HG1A 2QMHA 3U4IA 1QHFA 4OB7A 2QVGA 4TV8A 3AVUA 4LRUA 4MV4A 4CMEA 2DT8A 3DQPA 4EYQA 1MVLA 4FGUA 6AT1A 3Q7EA 1YDEA 2V6IA 1WRBA 2VNKA 3F97A 4OY3A 2XTMA 4DMMA 3UKDA 3GA7A 1TE2A 3SX2A 3V00A 4EGQA 1AURA 3N7TA 2BGWA 2JZOA 2O48X 2CB0A 1FJ2A 2E7ZA 3GOHA 1XCGB 2PYIA 5MF6A 5KOIA 4TVKA 5F35A 3GZNB 4UEWA 4OH7A 2I4IA 3D6TB 1N8TA 1EUDA 3TAUA 1NSYA 3NYWA 3MJEA 4TTIA 5BQ5A 2QPAA 2Q2WA 5CLFA 1IMOA 3Q2KA 3ZWCA 3QLUA 4FILA 1CYEA 3GL9A 3CLSD 2MWMA 4L15A 1DX4A 4UDOA 4INPA 3M7IA 4DJTA 2H1OA 2PR7A 4HNAA 3NBAA 1Y9JA 1RQ2A 2O7NA 1PI3A 4Q9JA 5COBA 4YPVA 4TLLB 1PNVA 1CJTC 1ZUIA 2R8PA 1NMYA 3QUAA 4D4LA 3I6YA 3IIJA 4NK4A 3RJMA 1PDVA 2HI0A 2QMEA 4D2IA 2GETA 2KW5A 2X5OA 3T3EA 5EMLA 4E30A 2NP7A 3EIXA 2MR6A 4JHLA 3ABZA 3GD7A 4LDPA 2YY7A 1HG0A 3Q7QA 1S3SA 2P5SA 1G9SA 1XZEA 1H2EA 4BO9A 2M6KA 4YCSA 2ADOA 5FPYA 4WPGA 4H1WA 5JS2A 3C48A 3HRHA 4NC9A 5EIBD 1JLSA 4IVNA 3IB6A 1PR9A 4IW3B 2GJ8A 4UFPA 3G1TA 1EE9A 2OFPA 3CX3A 4BO8A 3G0BA 4I1RA 1IHUA 3DR3A 3GH1A 4GPTA 3KQSA 2YFHA 1L2TA 4YBZA 4DXAA 2F90A 1NMXA 1V2GA 2EGHA 5EJFA 2AXQA 2VDWA 1GPBA 2WVHA 4PINA 5EZYF 5TF4A 1NW7A 1SVUA 3IP1A 4EKEA 2RIPA 4GOXA 4AS3A 1V8ZA 4DL9A 4A6DA 3RHZA 5EWMB 4DV3B 1KOLA 1ZGCA 2YCLA 5IM4F 5BWMA 3KQWA 3N8HA 2OG2A 3HCCA 1R6VA 1SOUA 5TQ0B 3UK6A 4EZBA 1FTGA 1TMYA 1E2UA 2DWUA 4JBIA 4LYJA 1PQYA 5JD4A 2GHRA 1NOJA 1RKQA 4BKUA 1H8EA 2RI1A 1GPWB 3U81A 1H1TA 1FK8A 3KUXA 1IOLA 4GKVA 2PGNA 3IXQA 4G1BA 2XECA 4RYDA 3TLJA 3WSTA 3KYCA 1E0JA 4PX5A 4AZSA 3KR1A 1N2ZA 1WP9A 4MMXB 3QV1A 3MUFA 5ADHA 5ICCA 4ZOQI 3C8ZA 1SKBA 3DHEA 3TSZA 2GNPA 2ZRBA 4IH4A 2GEFA 4LY9A 4FE4A 3KD3A 1NN0A 4AXBA 3RW9A 2B1GA 4ZMBA 4H16A 2H2IA 4ZT4A 4R9SA 3TEJA 4NJOA 4YRKA 4ANFA 4UD6A 1DRKA 2P91A 3OFKA 3UW1A 2YOFA 3NNDA 2X1VA 3L0OA 3MTGA 3O4HA 4HBGA 4LZPA 1N4DA 2PANA 5FA5A 4C0WA 5A4IS 3MJRA 1PGNA 4V38A 1STOA 2D1TA 2YC2C 4LSZA 4MS3A 1WD5A 1L5OA 2CJWB 1DRJA 2E5FA 2X0EA 5TMEA 3X3HA 1G8FA 1RACA 2O07A 5DO9A 1Z8DA 1WPXA 4JNCA 4PPQA 3W5DA 3NPMA 4K6KA 3DYVA 1SCQA 2C5HA 1R15A 3QF7A 2X42A 3ROFA 4BZQA 3AKZA 1HDOA 4UREA 3E5HA 1B26A 1XZLA 3CONA 2D13A 4NZOA 1KMQA 3HJHA 4M89A 5BYKA 3UXMA 3G88A 5TQ2B 5JXGA 4C6HA 1MU0A 3G0CA 4NQZA 4Y9SA 4DSOA 2DUUA 2I03A 1V7PC 3D2AA 5BOSA 4B3JA 5FH9A 1ZK0A 2X3YA 1JQDA 1Q0HA 1KU6A 1Q0QA 3KYDB 2IV3A 1GXSA 1SCUB 4N7BA 4KNYA 5IKPA 2IV7A 1WXDA 1ECLA 1X3SA 2GO7A 3IPCA 4UM8B 4GYJA 5CHYA 4YGXB 4L8WB 2DMRA 4DMFA 4RVCA 5CBKA 4UJ3A 2Y1DA 2E5LB 1LH0A 2GN6A 2PN1A 3W9SA 5CURA 5JCZA 5F64A 1EK5A 1ODLA 3U4DA 3JRNA 5G0UA 3JU3A 4IQFA 2C31A 3BDIA 3EWAA 2GN1A 4PLHA 3U5TA 2QTGA 1FVHA 3WMFA 2R85A 5AWFC 3LYAA 4C29A 3DUFB 3GEBA 1YS6A 1T0UA 1VMEA 5KAPA 1XKLA 3PYLA 3H9EO 1MTOA 5ED0A 4HNQA 1NNEA 4ALKA 4ARZA 2C99A 5HS6A 3S40A 3JR3A 4J3FA 4EG7A 1W0CA 1Q0TA 3LL4A 5CB8A 5I7RA 3F47A 5AM2A 2J5BA 1QX4A 3PCXA 2HYIC 2P4QA 2ZI7A 1MAHA 1D4AA 1XPJA 4MJ7A 3TLEA 1T3ZA 4QEKA 3RBAA 2P40A 1O96B 1MQ9A 3P94A 5A7HA 2YWCA 1C0IA 2OEPA 1WXGA 2Y1FA 4M1ZA 4M88A 4GSKA 1CUGA 2ZU6A 4I9FA 1DIGA 4FNMA 1PAUA 1QIGA 2FTKE 2GLXA 3K2EA 2EEZA 4I7EA 2XDWA 4J0DA 4X60A 4XRRA 3KTDA 5DX8A 5C8YF 1EQAA 3WYAA 2YBEA 5HUQA 3HCFA 4DAEA 2R4QA 1U7DA 4XVRA 3C3CA 1FYXA 1R5JA 4TRRA 5J59A 3RFXA 2Y9PB 3VVCA 5EZ5A 4AMVA 5IDXA 2GOYA 5JNTA 3JVEA 4GVXA 4A92A 3TQIA 1WEKA 1Z8HA 3AU9A 2GAFA 2JF0A 2R6AA 2BP7B 3P8ZA 4FGJA 3WFZA 2X0RA 1CUEA 1R3UA 4AMZA 2ZI6A 1Y8RA 4RZ2A 3Q88A 3WGIA 3PFGA 3H5LA 1M7BA 4KXVA 5A4DA 3L4BC 5I9LA 2JCVA 1RZVA 3L8YA 4A8HA 5AKIA 2XDYA 5BSHA 1C9YA 2H7XA 4RZUA 2OYSA 1IUNA 1Y34E 5KQMA 1R0BA 4LXYA 1DKQA 3X1WA 1NXTA 1DAHA 1YC5A 3OFND 1RD4A 2HA4A 3OOWA 2RCNA 3JQRA 1UP6A 1ZNZA 2WP8J 3Q87B 2NACA 4PZUA 1TADA 4OK3A 4S1VA 4ENUA 5EQJB 2GILA 4BFWA 4A4DA 4RDCA 4MULA 1GLNA 3I1YA 1ZM4A 3ETLA 2R8BA 5BSEA 2RI6A 2AZXA 4HX9A 5ERYA 4QOEA 1RXVA 5KSOA 2XZOA 1NQOA 2KSQA 3OOEA 1VPVA 4G5OA 3L8EA 3TL3A 2CL0X 4BNHA 3U4QB 3B1FA 3RS9A 1J23A