1K7SN

Fhud complexed with albomycin-delta 2
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
262
structure length
262
Chain Sequence
GIDPNRIVALEWLPVELLLALGIVPYGVADTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSAGYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIRSMKPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAVSIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSAMHFVRVLDNAIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic structures of the Escherichia coli periplasmic protein FhuD bound to hydroxamate-type siderophores and the antibiotic albomycin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Ferrichrome-binding periplasmic protein
total genus 75
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2001-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1k7sN02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1k7sN01
4TKVB 4MX8A 4WN9B 5KOHB 4MDYA 5AFSA 1M1NB 4TKVA 5JJ5A 1MIOA 3TEFA 3ZK8A 5I4KA 4LS3A 4UTOA 2YNMC 2M6KA 3ZK9A 1QH1A 2XUZA 1QGUB 3AEQA 3BE6A 3BE5A 2WI8A 1QH8A 4WESB 4WZBA 5BVGB 1M1YB 1PQ4A 2AFIB 4OXQA 4HMPA 2Q8PA 4HMQA 3LHSA 4PM4A 2PS3A 4INOA 1G20A 1PSZA 1K7SN 2XY4A 3AETA 1K75A 2MINB 3ZK7A 4ND8B 3GI1A 3AERB 1G21A 1L5HA 4LJSA 3LI2A 1N4AA 1M34B 1KAEA 1MIOB 4OVKA 4G09A 3ZTTA 1TOAA 4MLZA 4K3VA 1QGUA 4XPIA 2PS0A 1H1LA 2M6LA 3HXPA 1H1LB 2AFIA 3EIWA 2O1EA 2AFHB 4NNOA 3MFQA 2R7AA 4CL2A 3MWGA 1G20B 4BBPA 3CX3A 3U7QB 2OV1A 4NNPA 4ND8A 1FP4A 2YNMD 4DBLE 1G21B 3PDIA 4G07A 5M3BA 4WN9A 2OSVA 3PDIB 3ZKAA 4H59A 1K0FA 3TNYA 4PAGA 1N2CB 2Q8QA 4UDOA 1QH1B 3AEQB 3TLKA 3AESB 3EIXA 3K1AA 4WNAB 5KOJA 3MWFA 1N2CA 1QH8B 2AFHA 4WESA 5BVGA 2MINA 5FLYA 3AEKB 4HMOA 2OV3A 2XQVA 4UDNA 3UJPA 4FI3F 4H0FA 1M1NA 4INPA 5CR9A 1FP4B 4OXRA 2XH8A 4TKUA 2XV1A 4IRMA 5GGYA 2XDQA 5M34A 5KOHA 3NU1A 4FILA 1K2VN 2OGWA 3R5TA 2RG7A 3AEUA 2WHYA 4UTPA 3K1AB 5HX7A 1ESZA 3HJTA 3AEUB 4HN9A 4N01A 3U7QA 2PHZA 3AEKA 5GGXA 4WZBB 2R79A 5HDQA 5BVHA 1M1YA 3R5SA 2PRSA 3G9QA 2PS9A 3HH8A 1L5HB 1KARA 2QI9F 2ETVA 5B58T 4TKUB 3PSHA 2X4LA 3AETB 1EFDN 1KAHA 3PSAA 1XVLA 5JPDA 1N4DA 4MO9A 2XDQB 4FKMA 4WNAA 3AERA 5KOJB 5M2QA 5JOQA 5KHLB 1M34A 4WZAB 4FNAA 1N2ZA 4GICA 5CX1B 3MINA 4WZAA 5M29A 3AESA 4XPIB 4M7OA 5CX1A 5JG7A 3MD9A 3MINB 4B8YA 5BVHB
chains in the Genus database with same CATH superfamily
4NOJA 4MW1A 3UIEA 1RC8A 4HDMA 3GGPA 4WOKA 3JALA 5FWDA 4LHZA 2J4FA 1DKUA 1SKBA 4HNAA 4YA6A 3IVCA 1QIIA 4GR9A 5IMBA 4DQVA 1Z4NA 4QM6A 4FFWA 5FB3A 2R3SA 1KP3A 1ZLXA 2AXPA 4K6GA 4TXNA 3X1WA 1SUDA 1CY7A 2BEWB 2BTOA 3DLBA 3J81k 4LYJA 1SAYA 3SDZA 4BDTA 3KJHA 2AGVA 4HMQA 5CK4A 4DV0B 4YO7A 1P5ZB 1P7ZA 1SOAA 5EJMA 4BC0A 3DVQX 4EHDA 1LX6A 2GM3A 2FUKA 4E2ZA 4JLPA 2HZBA 2X1VA 4P5PA 3PF8A 3VR3A 3DXZA 3NX4A 2CY0A 3H75A 3MVEA 2H9IA 1JMKC 1N2SA 2YXBA 2A0XA 1G8MA 2O3UA 3FXAA 3LC2O 4QASA 3OPYA 4BC1A 4ZDJA 2Y0BA 2B8TA 4UDXX 4IV0A 3VISA 1KOGA 4Q66C 4ND4A 1EG2A 2DC1A 4P4TA 5CFOA 1EUCA 2DUNA 4K3VA 3FLEA 5IKOA 2W5UA 2R8BA 5KO2A 2A5LA 5J2TB 4BFTA 2H7VA 1U81A 3QUAA 4HDNA 1LWNA 2W83A 5EQTA 4B3TB 5J5AA 2IYZA 2HJ9A 1LC3A 3GJ7A 1CUUA 3E0XA 3H0CA 4NFYA 4B3IA 4RHFA 1LI7A 1ZM9A 1V11A 4RXMA 1A5ZA 4GMFA 3ZWXA 4AY5A 2XMBA 4D3XA 3AJEA 3WHPA 5B4UA 1A8QA 3DMTA 3AB7A 2ZYRA 3WO0A 3FLBA 3IDFA 2X5XA 4IFTA 2ATIA 4G07A 5FBHA 3VZSA 1QBGA 2AQ8A 2J3MA 1MO5A 4P81A 1T3ZA 5AIBA 1S3GA 2OYCA 1S8OA 3OQMA 4YEDA 4U0JA 4YLEA 1EM8A 2GCPA 3SJCA 3B7GA 3O3NB 3RJMA 3OZUA 4NG4A 3AEQB 3AG6A 4V38A 4Z86A 5E3JA 4P7GA 3L02A 4CV2A 4G5YA 1CVIA 4UJ5A 4DLWA 1BQ3A 4PXYA 4WK0B 3W9BA 2FZKA 1EKXA 1F6DA 5CG1A 5FTLA 3CPEA 4PNHA 5KHAA 4A6PA 3LLCA 2ZJZA 3R8FA 4FYMA 3ZHVA 1DQRA 1F0KA 4TKUA 3ZGVA 2PGXA 3SD7A 3CX4A 2Z9DA 2IYRA 4DLXA 2IPXA 2BR3A 1XLUA 1H8ED 2FF7A 3IRUA 4OJYA 2CK3D 4WK4B 3X2FA 3ZDCA 4FR0A 1K97A 2IKQA 1H2EA 1UDBA 2J32A 2ISQA 4Y2YA 1HFWA 3ETEA 4K87A 1ZBDA 1CY6A 1H0SA 1YRHA 3T6KA 1E9VA 5EY5B 1Q1QA 4JXXA 1UT6A 2FGKA 1HEYA 5B3JA 2GVNA 1G8HA 1GZSA 3OUZA 3NASA 3TI7A 4EFNA 3ZHRA 5ED0A 2R2AA 3OMXA 3FMOB 2QVCA 4ILKA 5AVRA 4NHOA 2WMDA 3K16A 4PC2A 4YUYA 3I2KA 3EYAA 3DBIA 1Q1AA 3KALA 4MWEA 2YC2C 2QG6A 1IYZA 1U3WA 3LFUA 3NM4A 1U9CA 2EF0A 3PRJA 4QBIA 5JMTA 3AERA 1JIXA 1SCIA 3KQTA 5HVNA 2QTAA 1K6XA 2Z4TA 5EPUA 4Y2TA 1E6WA 1KYYA 3NV9A 2PK3A 2XTMA 1P5RA 3N5KA 5CDUA 1M2VB 4HQNA 3MD9A 4JMPA 2JANA 3LXRA 5LQDA 1LBSA 1UC9A 2M1ZA 1ATZA 4GH5A 1N5IA 4J0FA 4QGAA 5GADl 3UKJA 2ZI9A 1CIJA 2CMHA 2PKQO 5DWQA 5LD2C 1C8BA 1YOBA 4F04A 4TXLA 1D0VA 2YN4A 1Y8QB 1FLDA 1UXOA 2CLSA 4TS3A 5CJ2A 4E33A 4G25A 4EI2A 3HP4A 4KODA 5I47A 2ILTA 4GXNA 1QGAA 4RJ2A 2QSYA 2ZYTX 2ZIXA 5BVGB 4ITRC 4IAOA 2QU7A 4K3UA 4P0TA 3DPUA 1P2GA 1QXSA 4C4TA 1Y6GA 5TIIA 4DR5B 1CERA 4FNOA 2WTMA 2DWCA 3N05A 5T64A 2L19A 3K92A 3P4XA 3ZZUA 2PS3A 3VZRA 4C3OB 4PG8A 3DZ8A 1Y8RA 2BKVA 3KBBA 3TLAA 1Z0IA 3NHMA 1QRTA 2YHIA 1NP7A 3RYIA 3DEZA 1N0WA 4XB6B 2P6RA 3UNXA 3VAZA 1BVHA 3FRJA 4X1KB 1TVMA 5DIFA 1ML3A 3AUXA 3LE8A 3ZY4A 1JJ7A 5L53A 2HH9A 4GQBA 2J5RA 2GCEA 1FDUA 221PA 3GFPA 4KZKA 4R98A 4F2HA 1XRNA 1KC3A 4QDOA 5T4BA 1LK7A 3GHHA 2C3OA 3MS4A 3GJ0A 1B6GA 1K7FB 3EIWA 4RHXA 5D86A 4UZFA 5EI5A 5CK5A 5EWJB 3R0XA 3VKUA 1PHRA 5IT4A 3O8CA 1N9GA 3R4CA 2DR2A 4KPUB 2X2OA 4Y0NA 1USUA 3MNFA 4UEOA 3RVNA 1XQYA 4Y9RA 4A7PA 2P9GA 5F1OA 4I9FA 2ZRIA 3JQBA 4V03A 3NJRA 2WB4A 3BZUA 3ROEA 2E7ZA 5DP2A 3SCZA 1I10A 1R4MB 4WFKA 3IPXA 3EZ6A 2R9VA 1IY0A 1JQJC 2Z6UA 2ZI3A 4DL9A 4NYIR 1RHUA 4IXDA 3KHSA 4XR4A 2DY1A 3DULA 3W5HA 2YFKA 1QH1B 4GNRA 5CURA 3UVEA 3EIXA 3D4BA 3JASB 5KJCA 3I9KA 2HCRA 4TMFA 4OBEA 1XDSA 4MS1A 5AHKA 1CTQA 1BWQA 3U9SA 1OGJA 4X95A 1KJWA 3VO2A 2D4AA 4DRXB 2OWEA 3RKUA 3MMXA 2R4QA 1FFAA 1GVNB 4H08A 1SRQA 1WPGA 5CXUA 5FOSA 2XEDA 3V5NA 3RIEA 2B4AA 4ZC1A 3SIPA 2B94A 2VDJA 1T5IA 5EIAA 2BDEA 5CA1B 1KI6A 3GDOA 3VPFA 1G8PA 3D31A 4L2IB 4NBTA 2EEZA 4FFNA 4YT4A 2R1TB 2PGIA 4BX0A 1J23A 4RVGA 5F3RA 4FEAA 2OM6A 1D8AA 2ZYSA 4PPNA 1EFRA 2OESA 3DLPX 1LZKA 1N7IA 3TDMA 4OJMX 4N7RA 5G4LA 1M1YA 3W04A 5GZ3A 1NXTA 1W4LA 1Y5NA 5EJIA 1QQ5A 421PA 3HCCA 5H5JA 4D74A 3MJEA 4MS4A 5ALNA 3LWZA 4US2R 2YHSA 2VUSA 2PRJA 5DI3A 2GN6A 2XXJA 2VHCA 1A2KC 1SU8A 3OPYI 4Y7DA 5DNAA 1IK4A 4DJJA 1ESMA 2B30A 3H65A 4ND7A 1FRNA 1KHHA 2VSNA 3Q98A 3UOWA 3LCCA 3URMA 1V3UA 2W7TA 1B42A 5IULC 1SBZA 2C92A 3OOHA 4G67A 4ZEMA 4CF6A 3EQ7A 1U5CA 2C2XA 2P9EA 2QMQA 1HTTA 4B85A 5BSGA 2ENWA 4U7DA 2QUKA 2RHRA 4DXHA 1Z6QA 3AP2A 1C3OB 1JMYA 1G5FA 1P9RA 3NHPA 4JC8A 5FOVA 4CR8A 5ITVA 1FZTA 4WLNA 2VBIA 4YJDA 5AW0A 1EU1A 2ZB3A 3QVWA 3ITNA 4GM4A 2C9BA 4IRXA 5A7GA 2VJKA 1HY3A 2PMCA 5AI8A 4XLLA 1WD7A 1WE2A 4X71A 2AR0A 1NI5A 3TK1A 4KH1A 4C7JA 3K6KA 1GFSA 4MINA 3FCSB 5FOTA 4WZBA 4OIFA 3ZOZA 1CUSA 1GL9B 1TTQB 3DM9B 3G7SA 3CVJA 4F85A 2J3DA 2ORED 1AU9A 1KFBB 1MEOA 1W5FA 2CNDA 1G20A 3W05A 4AN0A 4QBTA 5IAAA 2YWGA 3O75A 2CFRA 4LN1A 8MHTA 3KXLA 3WL3A 4DREA 1OKKD 3AFHA 4OQLA 3Q8WA 2JPDA 4AJJA 4DY6A 5AJWA 2B82A 5LBIA 2G6TA 4ZTUB 4TM8A 4WL0A 3L40A 3R41A 2QUAA 2O3RA 4YECA 3G6WA 5ALGA 3RR2A 1UMDA 3ZY2A 4B32A 4KOAA 1MOPA 1SOWA 2OO7A 3HVHA 4CQLB 4EUHA 3NH9A 2IF2A 1OU4A 4L78A 4KLZA 5KTNA 4C2UA 3GNLA 3QNUA 2WDZA 1E5VA 3DGEC 1KEPA 1PSDA 3L92A 3LQRA 4G86A 5AI0A 5ARCA 2FUNB 4LVNA 1KAGA 1KDOA 3RRNA 3SHQA 4BWGA 4C43A 4N6GA 3WFIA 2AIRA 3NDBB 1KP9A 1AK9A 2FDXA 1I7PA 3UG7A 4MJLA 4F6LA 3VR4D 1LQUA 1PFVA 3Q1KA 4ZDKA 5TRTA 4XEHA 5CVTA 3NO4A 3S44A 3OQ1A 3HC7A 4M53A 1GUFA 1OB5A 5I3ZA 3BMNA 5CT6A 3U4AA 2QX8A 4IF4A 5TNXA 3U6BA 1NUSA 4G0OA 3ZG6A 4W8HA 4HO1X 1E4VA 1DKQA 1BEEA 2VNAA 2YWJA 4JJ7A 4Q1AA 5JI3E 4OX9Y 1XEWY 4Q9KA 5CVCA 3PNYA 5B7NA 2R48A 3ZLBA 2BBTA 3QVXA 5H81A 5JI2E 3FDZA 3LX8A 5EWMB 2PYDA 3C5VA 4QOGA 3Q41A 2R62A 2Y0CA 4PC1A 4RK6A 4YASA 4ZU1X 4MUAA 3UGQA 3T7CA 1ST2A 3ANMA 3HY3A 3WFZA 5HWSA 5K0CA 5H4HA 1G7TA 3DD1A 4I4TF 1E7MA 5A71A 1PQYA 2HRBA 5JJLA 4TMZA 2AWNA 5L3RA 3HEMA 3ICOA 4WK6A 2GXSA 1LRJA 1RHJA 3DO5A 4TKLA 4OFBA 3C5WP 4LY3A 3EZYA 3OQIB 2ZIZA 4D9EA 4Z54A 3IA2A 2I9PA 3WK6A 4EG8A 3PD0A 1X94A 3UJBA 1FFEA 2BMFA 3BJRA 3CLKA 1XT6A 2C2MA 4TWAA 5AIAA 3VOTA 3BWYA 4D4HA 3GLQA 2FPXA 4C21A 1TU4A 2FMKA 1VIYA 2UYQA 1DBVO 3G2HA 3WV4A 3B3QA 1TYAE 4BNMA 4DTIA 1JKXA 2J3IA 4Z5XA 4PEVA 2I7CA 2VDOB 2JRCA 2XD4A 2XJ4A 2QW0X 2Y76A 3B48A 4QUDA 3AV0B 4B84A 2P3SA 2CLKB 1K4MA 2H57A 2PD4A 2QY9A 2G07A 3ES9A 2DFNA 4JD5A 4DFDA 2YIDA 3MB5A 5FA6A 4PRKA 2Q4BA 1SVSA 3OWHA 5JXWA 4IJ5A 2OV8A 1E2NA 5FI3A 3T1OA 2WZQA 3LPCA 3HVRA 4MR9B 4PIVA 1YD7A 5HTKA 1V1MB 2BL4A 3JR7A 4BZQA 5DWVA 4MMXB 3K6SA 5GJWC 2H4JA 3TUJC 3S99A 4EW2A 4DV4B 1X0VA 1WBBA 3FPKA 1WUJS 2KMLA 2ENUA 1Z6PA 4YJ2F 4IQGA 1FA9A 1T9ZA 4CDNA 4R1SA 3M1LA 2ODAA 2RIPA 4EYOA 1IONA 5FOWA 2ZAYA 3ME5A 5KC8A 1KEKA 3WQSB 5FUXA 2ORVA 3M6XA 2UZ1A 2Q4RA 5TY0A 5A5GA 1G9XA 1GNQA 2VAWA 4HD8A 3E53A 3RC7A 3WNVA 3WLIA 2BZSA 4IW3B 2OQIA 1OPRA 4J07A 3ORRA 4RZ3A 2Y1DA 4HDCA 4TZ6A 2D3TA 3BN3A 2UZ0A 1Z75A 4EPWA 4AQYB 4B34A 4DVGA 4OV6B 4HNRA 4NCNA 1NV8A 4C06A 1YMUA 3OC0A 3BSSA 1A8HA 1HTBA 3CH6A 5ALLA 1BVRA 2DSNA 3HUEA 3Q7RA 3WRXC 3U3ZA 2B3DA 3H4TA 4ZT4A 4DQLA 4J0DA 1OU0A 1WVMA 4AQ7A 4LJ9A 1YE3A 3HDHA 4IBOA 3MLAA 2GD6A 4OK6A 2Q3CA 2Q3FA 1BX0A 1RQRA 3DMTC 4R1MA 4DABA 1RWMA 4CEJB 3C3KA 3JZAA 5TDHA 3WLOA 4LYFA 1KJ9A 1U8TA 1FVOA 4Y6QA 2PZJA 4U2BA 2ZUTA 3U1VA 2IA5A 1I5RA 3TIXB 4IHQA 4ZXPA 3UJ3X 3KCQA 2VK8A 1GQYA 1VP9A 2QR2A 1JA0A 3FUTA 1L9XA 3IKJA 4CM8A 1TQ8A 1JU3A 3H19A 3I53A 4TTPA 4RADA 3WY9A 2BR5A 1N36B 2Y1LA 1RWXA 4C4AA 4QGFA 4Z49A 1K5DA 2A14A 4CFSA 1DUVG 2NO0A 1RRMA 4GDMA 5ALTA 2RCNA 2FVXA 3RU3A 4BRUA 5LR6A 2VWHA 2O2JA 1E7WA 2P5TB 1G2IA 4RPLA 1R18A 4TLEA 1E1RD 3DBRA 1Z7WA 4AKTA 2WFAA 2C8VA 5GP1A 4EP1A 1L8LA 2A9FA 2RC5A 1JEQB 3G2IA 2IX3A 3Q5DA 1ODLA 3H84A 4G26A 1ONSA 1FP2A 1A4IA 1KA9H 1K8XB 2NO9A 4I9GA 4ONEA 1DGQA 3IKLA 4WKBA 2PV7A 3C8MA 5A02A 5JHHB 1EUCB 1M5RA 4ZCPA 1JFTA 4L75A 3DPIA 2H3EA 2WSMA 3EGCA 3LT1A 4RY2A 4P33A 3QPDA 2Y3IA 3T1HB 1UT5A 3IODA 1HNZB 5JE8A 4OBBA 3V34A 2C8LA 2O7QA 2TMDA 3JWPA 4P22A 1NVUQ 3SYMA 1TGVA 3SE0A 1S8AA 4ZQCB 4RV4A 5IXYA 1RZRA 2P1DA 3HDYA 3K0FA 3PSHA 3IB6A 4IQFA 1BD3A 1JYEA 1AKWA 3RVKA 1ISRA 2QRHA 3CQ9A 1DDGA 4EI7A 3IQXA 4M99A 2FDRA 3RC1A 5C81A 1RHKA 1WDTA 2BZ1A 2H5EA 3PQCA 3QIAA 3KQYA 2R65A 4EA8A 3D1LA 1CUWA 3EW7A 1QRAA 2FFAA 1SD1A 4A0FA 3QKUA 2KLBA 3ZWNA 1Q95A 1TJPB 3JD3A 1M2WA 2RGWA 3MTQA 1E8DA 2IYFA 1DAPA 1UT8A 3FJ1A 1KK1A 1YL5A 3CUUA 2HN9A 3BQMB 5H02A 1O6GA 2EW1A 3BBLA 4N5IX 5F1KA 4ZWNA 4AMBA 4LXIA 3DT6A 3ZVMA 2ZRDA 2XKKA 1Q57A 5LBUA 4B46A 1JDBB 1RYDA 3UENA 4P83A 3P0HA 2GHIA 1GNRA 1R4ZA 4FYWA 5H16A 3VC3A 1NF9A 8OHMA 3EXHA 4WSOA 2YNMC 1EQUA 1NSYA 3NS7A 1Z0SA 1UBLS 2MR6A 2PG3A 2IBMA 4EENA 4NU0A 3K20A 3HJBA 3F9CA 2Q41A 5GM2A 1X80A 1ZK1A 1XDWA 1BKYA 1S4MA 2GCIA 4FCWA 5DX8A 2V1UA 1COWD 1HG0A 4Y3UA 4OJKA 1PWYE 3OZEA 3BX1A 4N3AA 3U4GA 1JP7A 3TLZA 4CE6A 4KQEA 2IS2A 1N4AA 1BDJA 5IK2D 2YS6A 3GLGB 4KR2A 1PO7A 3B9PA 2ZRHA 3DZJA 2WQZA 4JLUA 5GQSA 4CIAA 1EFVA 1IEWA 1FQWA 1M8KA 1WB4A 2HD4A 3FW1A 3I01A 1BYIA 1UZNA 3HDVA 2CNNA 2JFUA 3CWCA 3PFWO 4HXGA 2H8KA 1X1RA 3FNGA 5C4GB 4AI6A 3U49A 3VR4H 3JQQA 1Z83A 3CZ4A 4I4IA 2CXSA 5DM70 1BXGB 4D9GA 1CVLA 2P6UA 3L49A 1G2OA 3I01M 4WNIA 3SG0A 2PGNA 3IV6A 5JZOA 4KDRA 1L4HA 3V1LA 3SSMA 2IYWA 1O94D 2GERA 2CJFA 4HQ0A 3HN2A 4KX5A 2VP3A 3VQTA 5I9LA 1WF6A 1MENA 2H2GA 3E3OA 3V7WA 1OJ7A 1SCAA 4U7GA 3BB3A 1Z5UA 4RYDA 5IC5A 3CONA 2PXAA 2Q49A 2ZIUB 3IEIA 1X7WB 2PQ6A 4GMHA 4QQNA 4WNAB 3UV3A 4Q01A 1P0CA 4X6YA 4ER6A 4ITUA 4JUFA 1AV6A 4BV9A 1NQTA 2ZSEA 2HC9A 4NE9A 5TT1A 4E22A 1UFKA 2A57A 5DIZA 3TO5A 3PNLA 4INPA 4RSMA 5F2KA 1AA9A 1U94A 1ZVJA 2BGIA 2IE0A 3T9AA 2XV1A 3T7DA 3V7UA 3VZQA 3OLCX 5FD8A 4C4SA 1D6JA 3LO5A 1SHKA 1WMEA 2QN6A 3NANA 4R7GA 3SLRA 4X1IA 1PNVA 2VJCA 1GPAA 2YJTD 4B0PA 2UXDB 2ZSIA 4PSCA 3K1TA 3ZW9A 1SNYA 4TLBA 2FQWA 1VSBA 3KT8A 4Q4CA 4V1CI 2WG2A 1FFWA 1GLVA 4INZA 4DLPA 4LDZA 2QJFA 4RF5A 4PLFA 5LQCA 4ICIA 1UC5B 1UXGA 1NI4A 2Z2IA 1C7FA 3SNHA 3WTCA 4KR3A 1JH8A 2A0FA 2BMVA 4JIGA 1R8SA 3CEJA 1JTVA 4FCTA 2FHPA 2R86A 2R8RA 3K96A 1Q0RA 5KYVA 1MW8X 4TTVA 1E96A 2Z3WA 4FS8A 3X1ZA 4F2PA 1YQWA 2I8AA 3ZGNA 1RQGA 5E2AA 2JCYA 3EPPA 5LXTB 2V8OA 1ZYUA 2X2FA 3V4LA 1NMSA 4YDHB 3CNLA 4TWRA 3COPA 2DHDA 3JATB 4ARSA 2GEDA 4QG7A 1CX9B 1WKBA 3V9AA 3QXHA 1W4AA 1ZVKA 1LEHA 2PUCA 1QKIA 3ZCPA 1U2GA 2G5TA 3EXG2 4OFXA 3AIIA 3RREA 2FKNA 4PCLA 4CETA 1AMUA 4QD3A 4KXUA 1M1XB 1BTOA 1TEXA 5DN9A 4C20A 1KDPA 4MGEA 1ZSVA 1OXMA 2YV2A 3JQDA 4KVAA 3A7DA 3UHAA 4CIVA 1MEJA 3E22B 3NNDA 4E03A 4HRVA 3IQZA 1TM3E 3IERA 3FI0A 2AZMA 2BEUA 3ASYA 2NAFA 3G5LA 5CVDA 5J2TF 4ZMRA 3QBDA 5JZVA 2VQEB 1KI3A 3PHJA 3G0DA 3VDRA 1G0OA 4LZPA 4ARAA 2PUJA 3UMMA 2Y2UA 3AONB 1XZGA 2ZYUX 4V0SA 2QTLA 4KEAA 1KY2A 3KAJA 5CHYA 3SLGA 3VZDA 2W6IA 4BOYA 3PB3A 3DP9A 4JYPA 3IMCA 1KZHA 1AS0A 1V0JA 1FLVA 2OHHA 4G0MA 1Z26A 2AH5A 2FX5A 2W2OA 4JLAA 4HWKA 4OF4A 2XGGA 3FMFA 3VTKA 4NYMQ 5DK6A 3RHSA 4EX6A 4CT5A 5FI1B 4KO3S 5ELMA 5HQ3A 5JS8A 1XTRA 1BXZA 3C45A 3E5MA 3TUZC 1QOPB 1Q16A 2W48A 1BOOA 1Z4KA 3OWOA 1G8GA 2KB0A 4JR2A 1RJEA 1CUFA 2RAPA 1CP2A 1M0WA 2J85A 2FN3A 3T3HA 3V8RA 4BE4A 1JG2A 5T4FA 2XQIA 3AVQA 3JZFA 1O8CA 3AR5A 1WVGA 1K5GA 2IELA 2Q1SA 1F8YA 1T5TA 4B4UA 3RAGA 2A0UA 1BAPA 4LRYA 4IEIA 1D03A 1J0XO 3DKKA 5I8ZA 4F56A 2PWPA 4P3NA 3ZHZA 2DMRA 2OCGA 1ZHFA 3BE8A 2HQSA 3G3EA 1TA9A 2NACA 1GPJA 4RZ2A 4LCEA 2VJMB 3IBSA 4HEJA 4UBNA 3VHQA 2VS1A 1OFIA 3NP7A 2I7XA 3GAZA 3TNYA 4CF7A 1HI9A 1XA0A 2W2XA 5LQSA 5DGIA 3CLRD 2JCGA 4JLJA 3N6VA 4LZLA 3HKEA 3EFOB 4QTTB 2AEFA 1IEVA 1F51E 3OE5A 3X2EA 3CW8X 4QXOA 3DAYA 5BUQA 2V45A 3PXXA 3SYLA 5BMOA 2X4IA 2NUAB 2DB3A 1YI8A 4QFCA 4EY5A 3LA8A 2L42A 4KHZA 3V9PA 4MYCA 3THWB 2HK7A 3OMLA 3CKYA 4FLFA 4AFNA 5BSVA 4RDXA 5I4BA 5FOUA 3FVQA 3B52X 3EMDA 4GW3A 2X22A 4D9BA 2F1OA 4FFVA 1O08A 3NU1A 1T4BA 3QYPA 4L4ZA 4XX1A 1OFTA 2P68A 2PVCA 1HQYE 3KLMX 1OAOC 2NXCA 1OREA 4B74A 4OMFG 1H2AS 1KYQA 1R15A 1RR6A 1RI5A 3QIVA 4UHCA 4GPAA 2CE7A 4AY4A 1RKVA 4I1VA 5HDQA 5ES4B 3TOCA 1KI2A 1JE0A 2X2PA 3G2MA 3CW2A 4BCDA 2H4XA 3QLVC 4H1VA 1SN7A 4IDCA 3VVBA 4V24A 5JNTA 2ZJ3A 2H16A 1QK3A 3ANLA 1LPAB 1TFRA 2BH9A 2DLNA 3PSAA 3PNBA 3IIIA 4TXMA 3ZDAA 2V0GA 3HB0A 2ZS9A 3OF3A 1VJ0A 1Z34A 2UYGA 3EOZA 5FWAA 3PXEA 3BPSA 2J5KA 1VJ5A 5IPFA 5CX1B 3KB1A 4BZPA 1KK2A 1QVRA 1PT8A 1GGHA 3ILHA 4BZZA 1FNMA 5BSWA 5FQNA 5CDYA 5FPTA 4FNGA 4ZPJA 1P19A 1U9IC 2OY0A 4U2FA 5AW4A 1G5RA 4RO0A 5FL7A 5EKUA 3JW8A 4PZZA 3VDNB 4A8TA 1SZDA 1JS1X 1K8QA 4KI7A 4MPPA 4BFWA 1NZFA 5D1NA 4YPFA 1EJ2A 5AQ1A 3QU4A 3ENZA 4IIJB 2Q3EA 1A72A 1X0XA 2YQZA 4HAXA 3ZI7A 4NMHA 4YPVA 5HOQA 3ICQB 3QFCA 4EFDA 3K09A 1JHDA 3QEMB 4YAFA 1V3VA 1FU7A 2FN4A 1M8PA 1E1QA 4WFIA 4FMPA 1YBFA 4LJ4A 2HX1A 3P2EA 3KZ1E 2CV2A 1GJRA 2GYWA 3NBAA 1W85B 3FSEA 2BFMA 3PPVA 5KQLA 1GXSA 2E1RA 3OJCA 2IUYA 4YXFA 2MJLA 1TPYA 1PR5A 1S5PA 1P2UA 1JR6A 2NT3A 4NBRA 1CY8A 4E13A 4J9UE 1P7WA 3ENVA 3F6CA 1AN0A 1DG1G 1Y3HA 4Q3BA 4YLYA 1Q0ZA 1ATIA 1NMZA 2FAXA 3NTUA 3ZJYA 5CMLA 3W8DA 2GJSA 2YX1A 3AIOA 1CFJA 1RU3A 3H5TA 3NALA 3EMVA 2P9CA 3PHGA 1YMQA 3OQOA 4QICA 1K98A 2FPSA 3GRVA 3FZEA 2W9XA 1SWWA 4NG5A 2EFYA 5JQGA 1A50B 1HT1E 1UBUS 4Q9AA 4BY9E 2I4LA 1VG0B 1NGSA 3LJKA 2IITA 4JB2A 4PPQA 2BGWA 3COJA 2PZGA 1XF9A 1T9GR 4Q3AA 3TX2A 1VRVA 5I9SA 3U0VA 1Y3BE 1RMTA 1D6MA 2ZBQA 4TTQA 3EGWA 4GM0A 1Q14A 2J67A 4KW7A 4PCVA 1YZQA 4TKZA 1DLJA 3UKDA 4BMXA 2X5KO 2ZTLA 4QVKA 2IEDA 2YN2A 1RYZA 1UXKA 1ZXLA 2R66A 3SF8B 1JQKA 4Y2PA 4D5EA 2J5XA 1TI7A 4IINA 3KXKA 2E4WA 1IWPB 3DG9A 2UXCB 5FWYA 4JQYA 4G0WA 3MMNA 4NJMA 3KXDA 2HMAA 3B9BA 3FMPB 3P2MA 2C3PA 2WBLC 1XMJA 3HG7A 1L1FA 2X0FA 3ZGXA 5I4CA 4IDBA 4ZEWA 3ODGA 1VMKA 4YDSA 4BLRA 1XN1A 4RL4A 4S1NA 3U2QA 3W1VA 1OZAA 3AIMA 4IFIA 4MCJA 3OLXA 5CDSA 4V0NA 4O4HA 1NHGA 1U2ZA 2RAFA 4QUKA 4F4HA 2Z5VA 3I5UA 3B53X 1DB3A 3NEAA 4LI3X 4UVGA 2BUCA 3NH6A 4MI9A 3EXG1 3RRMA 5DTIA 3UPDA 5HJEA 4YJGB 4A36A 4HN9A 4PE5B 1XG5A 3KTDA 4BIIA 5JAZA 2VH5R 1UPFA 3EYWA 4NOLA 5SYNA 4YMLA 1P60A 2D0OB 3HY6A 1JJFA 3ASUA 4M1EA 5H3LA 5CEJA 4TT8A 4CKBB 2DBZA 5C53B 2B1JA 3D7MA 3O0TA 3SEFA 3T3GA 2OMKA 3I9V6 4NTZA 4K9PA 1XTSA 4MQFA 3O38A 5ERXA 3OCJA 3DL4A 5K0LA 1V8OA 4EF5A 1K08A 5JZSA 5L40A 4B8ZA 5KHLB 3ZD8A 3Q87B 4D26A 1U8CB 1EA5A 5L4NA 4YMGA 1TZCA 2UUAB 4LFAB 2D74A 4K9QA 1IY2A 2Q27A 1XQXA 2MMGA 1XK6A 2JGDB 3OFKA 4I1IA 2HL6A 2YWEA 4S12A 1B0PA 5DV9A 3CZCA 2PSFA 3EAQA 1XMQB 1JHVA 1PYDA 1TCBA 2W2TA 3G02A 4REMA 4B9EA 5A0TA 1FXUA 4FLMA 1PS8A 2J31A 4TS9A 3RS0A 5ADWA 4RTNA 3F6PA 4R81A 5LOVF 5LLSA 3FDXA 2P2GA 4AMYA 2C78A 2IEIA 1MX1A 1RCTE 1GUYA 1XCJA 1C9JA 3NAGA 4KYVA 4O2RA 5AKYA 3RIMA 3S40A 1I2CA 4EYQA 2XUZA 3AEQA 1I3LA 2BIFA 4UU7A 1Z38A 1M6EX 5AJZA 4F3KA 3N8KA 3OECA 3P19A 4QJ4A 2DR3A 1V4NA 4XQ0A 2CUTA 1KXJA 1QF9A 4MWTA 4MVXA 4U9IS 3LKBA 5DTJA 3RIGA 4MDFA 1RLIA 2X9QA 4WKPA 2XWBF 3HEBA 1S2LA 4NJEA 2BI7A 1I9GA 4KBYA 1TT5A 2OBLA 1DS6A 3U44A 3NHRA 3GF4A 5ALJA 1QS0A 4BFSA 1GPWB 4RANA 1EHIA 1HK7A 4ZOQI 3UO8B 2AZXA 2REQA 3RO7A 3C3JA 4Q00A 2MHCA 1CJCA 1TRHA 3UAXA 3AKDA 3LP6A 4E07A 1GTRA 2DETA 2YJGA 1EH5A 2XB4A 1PEDA 4N82A 1EXVA 1TYDE 1USWA 2QP3A 1XMOB 1A9RA 1VL5A 3E15A 4GHWA 4IXNA 4IIFA 5KAPA 2W37A 1JEJA 4BBZA 3EC1A 5L95A 3PX2A 2XCTB 4HAYA 5HE9A 1G8FA 3SJUA 4D81A 1FDWA 4C4ZA 1IUOA 3G88A 3GCZA 4IF6A 4YAOA 4BGUA 2GOYA 4MW9A 2C5LA 2BFFB 2CFIA 2E5WA 3N8GA 1A95A 1NBMA 3PUZA 3T15A 3G9ZA 4Y2XA 4R16A 1T8UA 1NJ1A 4RS3A 5C32A 4CL8A 3C3WA 4YLGA 2GEUA 4OHZA 4E1BA 3EE6A 1XEXB 1OC4A 5CM9C 1ZUNA 4KG7A 4WXYB 5EXDA 4ZAZA 3IEPA 1PTJC 1JHOA 3JAKA 4YP1A 1UMKA 3H6KA 4N39A 4RPKA 4LOLA 3CBGA 2Z3VA 4HLCA 4HMOA 4ZV9A 1D6NA 4EB0A 5B3LA 4OUDA 4C03A 3GLGA 1FTWA 5B2FA 5DGCA 4CODB 4OY3A 3BFPA 2DGDA 2IYXA 3CLTC 1IHOA 1Z7BA 1MO4A 3L5KA 4FINA 4H7DA 5EZSA 1PWXA 1F7VA 2X0NA 1JJAA 1RXYA 2JHCA 2XMGA 3CT6A 1Q7BA 4ZVTA 1XBTA 1Q1GA 1RJDA 5JJKA 1VFPA 4YY3B 1X1BA 2O7RA 2Q4DA 1US8B 1QUFA 3MT7A 3E8SA 2DX7A 3GLFB 1TM1E 3IUNA 5L3QA 1MABA 2VSQA 5ECGC 1OHHA 1CJBA 5BN4B 3FFWA 3SGLA 2R79A 3GAAA 3K70B 3QG1A 2YHIB 3CO5A 4G1VA 4PLVA 1C3OA 1V9LA 4IIXA 4YALA 2QG4A 3CW9A 3UN1A 3TW6A 3HBFA 5KNBA 4LMPA 5GWXA 1C5KA 3W77A 1P1KA 521PA 1ECLA 3DS8A 3O74A 2VAXA 4QQKA 2Z98A 1MQ8B 3PWKA 2C04A 4XWOA 1A5SB 2J9FA 4WOBA 2WOOA 1M1YE 3FVTA 3WNBA 3BD8A 2Z8YM 1DFHA 4YI3A 3HJRA 5BSEA 1S7GA 4HLQB 2W2PA 4P2BA 3K2BA 3CJTA 1G4UR 5A3VA 4KJXA 2OUKA 4NS4A 4TMXA 1ZITA 3W5VA 2BHRA 1FYVA 2C58A 4Q03A 5BOSA 4ESOA 3CISA 2FSVA 3D2CA 3UMYA 3B1JA 1YACA 4ZYWA 4AN1A 1OTYA 4DR1B 2FWMX 3GGDA 1R6UA 5C7OO 3IE1A 4BNUA 5KTYA 3I30X 3OJOA 3C8UA 4KL8S 4LVUA 5JDCC 3NDJA 3AXSA 1CJKC 1A8IA 5IM4F 4EJ2A 4XLZA 3BS4A 2FW9A 1ZINA 4L5IA 2ZWVA 3OCCA 3S1AA 4MS3A 4UTVA 3W5BA 4MSUA 5K2MA 3D0KA 1JDSA 1UODA 1PGNA 3BQNB 3HUFA 3P9NA 1FCJA 2JS7A 4HGNA 4PAOA 4JBWA 5I45A 5JEEA 2HHHB 4KQJA 2IH5A 1EVZA 1HE4A 4K88A 3ED5A 1VG8A 4EHAA 2VPZA 1WCV1 3OHMA 4J91A 2Z56A 4BLVA 5FFFA 4HB0A 5ALXA 5AK3A 4QDJA 3MGCA 1CQWA 4IIVA 4YRGA 5LSAA 2J9RA 1IN1A 1Y82A 3H5AA 1FRFS 4LDJA 1VLLA 4GBGA 4HEA1 5BWOA 1ZL0A 1ZFNA 3EDQA 1QIDA 1Y80A 3OM0A 2HUPA 4HS9A 5SICE 1B4DA 4PHTA 3DE3X 1YRWA 1V3TA 3B6ZA 4UC0A 1VA4A 3CR8A 2R68A 1OTXA 4QRDA 2R8OA 5EHQA 3WGKA 3L8YA 5D1HA 1REQA 3KVNA 3PCXA 3F5FA 5HK9A 3MCAA 4KFUA 4MKRA 1DCFA 1M2OA 1SVOA 3O3MB 3GGSA 4B76A 1U7OA 4MVJG 4EARA 2NU9A 4LGMA 5JEDA 4KK3A 4CQNA 3EBPA 2E6KA 1R0ZA 2NNLD 4BQSA 4DV7B 3DEFA 3IGFA 4JOSA 3K4QA 2H54A 1OXKB 3FG9A 3RRJA 2ONZA 4M8NE 2R85A 3ZWDA 3GPDG 3PGXA 4EA6A 1QF6A 4C7XA 4IPTA 4EJ0A 1PQUA 1RYMA 1IBRA 2VPXA 1NY5A 3RU7A 4YRMA 5DCWA 1T3SA 1GR1A 1EVQA 1A9SA 1P7PA 1Q12A 2CFSA 5EP3A 3RFVA 4MCIA 3V8NA 2RI1A 2E2WA 3PD7A 4INJA 4X61A 4F38A 4R0NA 1NVTA 4WY5A 3SQOA 4E2WA 3INTA 1K63A 4GE3A 3KT6A 2IU0A 3W5CA 1C7IA 3FPEA 5AHRA 2WINI 4UAVA 3TMYA 2CLEB 3U17A 5M34A 2J0VA 2IUUA 2OVBA 4QOHA 1H9BA 3GUUA 5DLEA 2ZB2A 3M6FA 3I6BA 3U6KA 4R05A 1BHJA 4IIJA 2X9GA 2OSBA 1YDGA 3OA2A 3T5PA 3PYMA 1CQJB 1C3LA 3HFSA 1VI6A 2AOVA 1Y6JA 3AEKA 2I6UA 3PWSA 5CG2A 5KNDD 1QP0A 4PN7A 1XL0A 5U9CA 1BWSA 4KYUA 4UD2A 4ZO8A 3U80A 1TYZA 3H99A 3UUFA 1WULS 1P61B 2WOJA 3FYUC 4R3WA 4C3ZA 3KLNA 2PU7A 1UBSB 1WUYA 3A4IA 2NV6A 3Q0TA 4BRZA 1SOUA 3V6MA 2CNWD 3TZLA 3SYRA 3UICA 3C4VA 2JD2A 3MWKA 3FVWA 4QWWA 3ZHBA 3SKVA 1WP9A 3OC6A 4GLJA 4UPEA 1ZD4A 3M5CA 1A8SA 4GX1A 5BVHB 4GEKA 4Y18A 1QIGA 2PZBA 3U3KA 1UXIA 5CB4F 4D8XA 4EW6A 1ZZEA 5HGJA 3GH3A 2BFAA 1F8XA 1JT9A 1XWFA 2AC2A 3FTPA 3PITA 4BVHA 1RXEA 4FM9A 2DBVO 2XADA 3RK4A 1DAHA 3I2IA 4C0LA 2VR1A 3BMNB 3F96A 4HWSA 1ISFA 3A6LA 4XVQA 5EXEA 4DA6A 5FEUA 3T5AA 2OP0A 3GLTA 1QGUB 5GM1A 3RTCA 4F9GA 3FNRA 2FRXA 5IUJC 1Y9ZA 3AILA 3BIWA 4OD0A 2YRXA 4UEWA 4R9SA 1NC1A 2FFQA 4YBRA 4YRJA 1BJKA 3WL8A 4BJ3A 5DF1A 2QENA 3L84A 3NTLA 4E14A 4M0KA 3JAMA 4AJLA 1S3IA 2ZG6A 3HSKA 3FKSA 5JDIA 5TMPA 1W30A 2G9ZA 2QQFA 3VR5H 1E8NA 2HF2A 4CM4A 1T36A 3P27A 4QIHA 1EP1B 5FPPA 4CLDA 1RJGA 4D4MA 4C2TA 5AJXA 5FHQA 3C41J 5EAIA 3UXYA 3EULA 5AKLA 2F1HA 2IVZA 2I54A 3AF1A 3EVZA 3KPUA 2QUHA 3OLQA 1S3FA 3Q0IA 1KMMA 3SKXA 3WIDA 4ZJZA 4NR0A 3LKDA 1XZCA 4D9KA 5A62A 1RVV1 1IJEA 2I78A 3A8TA 2Q1WA 4PYKA 4QXMA 4BVAA 5J2TA 3RSFA 3S7TA 2PUDA 1K68A 2GCOB 1DSSG 2J9ZB 3G7NA 3QWFA 4BO0A 2DWOA 4X6LA 4KITB 1SIUA 5AVTA 1NBHA 4JI0B 1OYOA 5BNFA 4MRPA 2NU8B 3STYA 3TZEA 1J0CA 2WM3A 4LWZA 4DWWA 4IHJB 1U0LA 2O1SA 2B20A 3ESQA 3THOA 1JIUA 5KTKA 3N7TA 3IJPA 1TTTA 2VTEA 2CYBA 4U2KA 4PGFA 1ZUIA 1EWKA 4PLPA 1RI2A 3QOFA 5JS7A 5LLDA 4N48A 1G41A 2FW7A 2ZJ1A 3OTHA 3PQDA 4C4XA 4E5KA 5CAEA 2VNKA 2VP0A 3TBFA 4Y7CA 1NOIA 2Y0EA 3KTAA 3SPXA 3IFSA 1G6Q1 3VC7A 5A4JA 1TF7A 2LPMA 2GYVA 1WZCA 3UFBA 3NBQA 3F6EX 1N0HA 1ZC3A 1WXIA 5AUQA 3GZNA 1GDTA 4HAWA 4EZIA 3S2GA 3QWAA 2WJHA 4E51A 4YTEA 3IA7A 1JG4A 1GL3A 1DC7A 4FDMA 4L0MA 5DGDA 4KMRA 3H1TA 3ZHUA 2O7SA 4BQFA 3HU2A 4TL8A 3ETHA 1J8FA 1KK0A 3UZUA 1U0JA 3CURA 4HK4A 1L6RA 1YB6A 1NBAA 1GQ2A 3L79A 2WWGA 3HPQA 4IS3A 3GYGA 3KUCA 5F76A 4FFDA 5F2OA 1W52X 2A9PA 3PTLA 4R2HA 3DEKA 3LGAA 3PA6A 1K89A 4QNRA 5U4XA 2R47A 1XZEA 2P5UA 3JQ9A 3LYHA 3Q3IA 4FW9A 4ZO7A 3SJAA 2XT0A 3FH0A 5H70A 4OYRA 1EDEA 3F74A 4EK9A 1W9HA 4HWOA 1SVNA 2HDNB 3BMXA 4I5IA 4DNFA 1T91A 1LNZA 3SF8A 3VGPA 2UZAA 2P6NA 4F9TA 1T5OA 3IVXA 3ZV3A 4DCVA 1FP1D 3AF0A 4AZTA 2LP4Y 2J4DA 1E0JA 1TVKA 3R0IA 4HS4A 2NU7B 3I9V1 3LY8A 3ZTYA 4B7CA 4ZRNA 4WADA 2QAGB 2F2TA 3DTVD 5AK5A 1I30A 3EODA 4EPXA 5KDDA 3SBEA 2QJWA 3GBPA 4LXHA 4UCXA 1HFKA 3U3RA 4ZFNA 5BRAA 4OI2A 4JMLA 4L4YA 1C2TA 4MX8A 3JQFA 2BFNA 1NKSA 1ULAA 4JELA 4K40A 4KE7A 1T1JA 2DE0X 3A3KA 3M9LA 1N3BA 2SECE 2VNHA 4GC9A 5JAHA 2WT4A 1XA4A 4HVAA 1E2DA 1RXUA 2W6JD 1MR3F 3ZVRA 2F8MA 4G89A 3HA7A 2YJNA 1C1XB 5JNUA 5K6AA 3Q9NA 1FPMA 1CPYA 3DDUA 4ZYUA 1AMOA 2NWQA 4ES6A 3DBHA 4EVRA 1EFAA 1PVVA 3PQ8A 2G04A 2DZDA 1V5IA 2I4NA 1PT9A 3TQQA 1AKUA 4ZP1A 1T36B 1FK8A 4AU1A 4TWZA 3FY4A 3IOEA 3NUGA 4WGGA 3W5AA 4NE2A 4F3RA 4E5VA 5B55A 2YCLA 2HA6A 1VPEA 1T25A 1WR8A 3ACCA 3H4MA 3LWNA 4H6VA 4JP5A 4KDFA 2BHSA 5ESDA 4K28A 4WEQA 5KB3A 1A69A 2ZDHA 4FB4A 1PW7A 1EFRD 5D51S 3M6IA 5C1OA 2Q50A 4IIYA 3BDIA 3RM3A 3LUDA 3GLRA 3UT6A 1AB5A 4DA0A 4OSOA 5A4MS 4QUIA 2KPOA 4PLGA 5FPQA 1C9DB 3E4DA 4XPIA 4D9NA 1U1FA 5LKRA 1CV2A 2O14A 1VL0A 2OYSA 1HRKA 2XIQA 5AXBA 4MV9A 4EJSA 1WPQA 1W4BA 5IF9A 2H4ZA 1L7XA 3ZNQA 1QTIA 3AHFA 4IVQA 3PQ4A 4RUKA 1HMYA 4RQUA 1Q50A 3CTPA 2QVZX 2FLVA 5CU7A 1SZJG 2LBPA 3I32A 1SHTX 2TRSB 3SEZA 1HEIA 4Q4JA 1JW9B 1Y8QA 1WF3A 2XLCA 3EIOA 3Q9UA 4MO2A 2ZB7A 3WGMA 4EQ6B 2HDOA 2VIIA 2ZZKA 1K27A 3HJUA 4MARA 4YR9A 5AM4A 1B1AA 3DTNA 3IUSA 1HBJA 1DZ3A 4GSKA 1J8VA 4O0MA 3LYAA 1EGAA 4FT2A 1Y6RA 1YI1A 3AF3A 5IZCC 4KI0A 1V7QA 3LL4A 3DE6X 5HUJA 2FE4A 1O94C 4FI3F 2VAPA 4F06A 5IABA 1EGMB 4FDTA 3UOGA 4IIDA 5K8IA 3M2TA 2P6OA 1V8FA 3D5TA 1JEEA 3VYRB 3L01A 2P2ZA 3HWSA 2ZE5A 2ZCVA 1NOKA 3TLCA 3EHDA 2FHSA 1TKRA 2I67A 1T8SA 5HBRA 4WBSA 5ILGA 3I37X 2XVYA 1PV4A 8GPBA 4MKIA 1DOAA 1UBKS 4D82A 1UBNA 2N1MA 1DWUA 1PT6A 1V5WA 2CE2X 3P0EA 4U7TB 3STXA 1ADYA 2FXIA 3C6MA 4R68A 2P30A 5LZ8A 1SKUA 1XMVA 3K0FB 1Q0TA 2CVQA 1R88A 2HRCA 2N3ZA 4IOKA 5KHOC 4B6EA 2QGNA 3KFVA 1P4GA 3AQIA 2PEZA 3D3JA 3D59A 3PNVA 1SUEA 2I6XA 4R2JA 4CFYA 5A0FA 1YS4A 4QOEA 3TJRA 2XZTA 1PFYA 5CITA 5IHXA 3A6PC 5E95A 3IP3A 4MGIR 1VJDA 5KQRA 5EJ9A 5TF0A 2XKJE 3AVXA 3WLNA 4QFBA 2HZ7A 2IHVA 4PG5A 2D1RA 5FEMA 3RQIA 4DCCA 3UV7A 1BFUA 2Y1WA 3V2UA 4F92B 2NO4A 4UZEA 1KO5A 2RAVA 4XE5A 3ANSA 4ENTA 5TQ2A 2UYCA 4A8PA 2FEKA 1QK4A 2AD1A 3LTNC 3ZBUA 1AQYA 2QX7A 1P4AA 2ZT6A 1LLFA 1R12A 4L15A 1ZEMA 1WP4A 4MXDA 5B7GA 5D01A 3HRIA 1CJVC 4OHXA 5K3SA 5A4FS 3M8KA 2JRLA 2P3LA 5J58A 4LS3A 3ZZ1A 1J97A 1NBIA 1PR2A 2A9KA 4DIEA 1YDHA 5CNKA 4F5WA 1NM5A 3LBAA 1E2QA 3VKGA 5JUWA 1Q0HA 4AYTA 3JSAA 5EJ7A 5AUNB 1FXWF 1KI4A 1VGRA 3PPXA 2H4FA 2WWTA 1AHIA 1A3CA 2WUVA 2EL9A 4O2AB 1R64A 5EHNA 2O54A 4A91A 4G2TA 2R44A 5CB0A 3T5GA 3SIWA 4ENPA 1YK0A 3AOEC 3IMEA 4KXNA 5IEJA 2PGOA 2XF8A 2G9RA 2ZETA 3AF6A 1UADA 4RDIA 3AZQA 3RUCA 5GIPE 2X9LA 3L0BA 5DASA 5MN5A 2XUQA 2FUG1 3AF5A 2PBZA 1SKMA 4IGEA 2POQX 2QEQA 1L7RA 2D06A 1ZJ6A 4MIYA 4PZAA 2NX2A 3ZJUA 3U5ZB 4QJ3A 1BXGA 1E63A 2B6NA 1ZDMA 2OCPA 2VG8A 2VHEA 3LP5A 2E0IA 2H1LA 2HLDA 3RE1A 2HV9A 4EFKA 1IVSA 3TI9A 3AVPA 3ICVA 2KW5A 5AK6A 3ILSA 2W70A 2NUBA 5BOSB 3LP8A 3ZR4B 4BGEA 3T7RA 3N39C 1R0LA 1X9IA 1JEAA 1RZUA 2POCA 4WINA 3E2IA 3A4VA 3OP1A 4IMPA 2GJKA 2WAMA 1JZTA 1SB8A 4MVJI 1PGQA 3BVPA 1TADA 4N3CA 3SR3A 4TZTA 3X1KA 4G0VA 5I7EA 3GBVA 1S9HA 4DV1B 3QOXA 4M89A 1QHHB 2FQYA 2P62A 4QRIA 1FU8A 3C3CA 3EG9A 4KREA 1ODTC 1YJCA 3WKAA 1S1CA 2DH5A 2XQVA 3FB1A 4KV9A 1JIQA 1P2DA 4IKOA 1R5JA 1NJGA 4DCTA 5AMXA 2DKNA 4BQIA 3NR2A 1LNSA 3GJYA 4H9GA 3GVCA 4I5DA 3W9UA 3I8OA 1ISHA 3LF2A 4FR2A 3C3DA 5E8JA 4BUZA 3O3CA 3ZX4A 4YVFA 4YWJA 3ZEIA 1WV1A 2LCFA 1AGXA 2NN3C 1S3SA 5HG0A 5EIHA 4NKRA 2JLWA 5FX2A 1DL5A 4HNSA 3ZLTA 1UMDB 5C8ZA 3RVBA 2WG1A 1N2BA 3PF9A 4JXKA 2PL9A 4YYEA 2CDAA 3M49A 4WNCA 4LNAA 4WPGA 1PWZA 1ADCA 4H6XA 3IV7A 4KCGA 4Q3DA 4QGBA 1HURA 1J2EA 3K5HA 2Q5JA 2GDZA 3N8IA 2XOXA 2VF5X 4HSGA 4MV3A 2OGZA 3L6UA 5KOIA 3OZCA 1JJVA 1L7AA 4XX0A 3LNTA 2I99A 3PGJA 4KXMA 5F98A 1IHYA 4X20B 3TTSA 2QPLA 5A6SB 3T0FA 1ZG3A 2WF9A 1P2TA 2O0MA 4ZC8A 3BAZA 3QI2A 2RHJA 3TNDA 2IHTA 4WEOA 2DJ5A 3T38A 1OUMA 1G60A 1F0YA 3PBKA 1P1RA 5D3MA 2A2ZA 1E61A 4ZRMA 4JVNA 1NUHA 3NUQA 5CH5A 4WECA 5E4JA 5K8LA 4BLQA 4L73A 4MUYA 1FFXA 4G56A 5C18A 3EISA 2BMAA 3HP7A 3SHOA 4P4LA 3DZDA 1EXWA 3HDQA 5EEHA 3VR0A 4BVJA 1M7GA 1NBMD 1SU4A 2FZ5A 1BE6A 5JCXA 2H3HA 5CBPB 4JJEA 4CR7A 2BISA 1GZHB 2G82A 1ZVMA 5SZKB 3CRNA 1SM4A 4HAVA 4YDQA 9MHTA 1RYHA 3BG5A 4B82A 2VDQB 4RH0A 2CV1A 3LHSA 1QQTA 2PY6A 4CG3A 3A6JA 3BXZA 1LLQA 3CUEF 3EGEA 3IAM1 4K6FA 1I1HA 3QKIA 1N6NA 3F90A 1XJCA 2AL7A 2GBFA 4Q1FA 4EB8A 1SQGA 2PSSA 3MJFA 3R0JA 2W4IA 4HH4A 2WHRA 4EMTA 5ALVA 4XW2A 4DAEA 4G24A 1P1JA 4DW8A 1IBSA 3BQ9A 3GLIA 1R2QA 4JP3A 2FSGA 3VU9B 4TXJA 1RQ2A 3P9CA 2ZSKA 5K7SA 1W96A 2QZPA 3PGA1 1RWKA 2JJ1A 4NU5A 5EIOA 4NZNA 2PS0A 3HBLA 3Q8KA 3HBJA 1JSXA 3FFXA 3K9QO 3TG2A 4GLFA 1SH7A 4FEGA 1J8YF 2OECA 3B2QA 2X7HA 3L7IA 4O02B 4PQYA 5EWLA 2QTZA 3ZE7A 2OD7A 3LZ6A 2QUIA 4TKVA 4LOHA 1G20B 1G17A 2HJRA 3PPYA 2ZIEA 3O90A 3OY7A 3QVSA 5DE3A 4ZEXA 4BWVA 1KU6A 2FOLA 1IPHA 1GSHA 5FIUA 3R3VA 2GWRA 1QP8A 2JAOA 3G68A 4OAPA 4JT9A 2LV8A 3DKVA 4RIFA 4PLYA 3RC3A 3U0BA 1Z5NA 4FVTA 4V0KA 1CF9A 1XMSA 3KVVA 1LPPA 4ON9A 4ZGWA 3DJFA 3MWEB 2FR1A 3NLLA 1JHXA 1GP2A 4GVLA 1QHHA 4LNUA 3CN7A 4YJGA 3T5CA 3AVTA 3H2SA 2HBYA 3INYA 5FLYA 4DWJA 1XHEA 2V9ZA 5CCXA 4EBBA 3A32A 3HCOA 1ZONA 3THYB 2VL7A 3X43A 1U4NA 2WWFA 4FDVA 3EXFB 1B43A 2YY5A 3F3SA 4YB8A 1O4VA 1SR8A 1ISMA 1FL9A 3QELB 2JHFA 5HS4A 2AKEA 3P9IA 3ZY6A 2Z6QA 1TJ3A 1FUEA 4DDTA 4RJKA 16PKA 3P94A 1CNFA 2Q28A 1ZS9A 1JNXX 2WA2A 5E9JA 5ED4A 3R5TA 5LNK6 4D4KA 3NGLA 2G09A 3H5OA 3MC1A 2AUNA 4X64B 4R51A 3M7IA 1EPUA 1GLGA 1S2IA 3LX4A 1DG3A 4BFUA 1IHXA 4WBNA 4BHTA 3LLMA 2HBQA 4B7ZA 3G6KA 2A3NA 3CX8A 3H42B 4C3VA 4E3WA 4JVSB 5BNZA 3I12A 3BIOA 4FBMA 2C7OA 3O4HA 1GV1A 4PQGA 1NJ8A 2RGCA 3UWKA 5LYJF 1TZKA 1IDOA 3F3YA 4F5YA 3UC5A 5KS2A 2JFVA 2C1XA 1V5FA 3I9JA 2D13A 3G89A 4RACA 3DHVA 1T2FA 5CIQA 2C03A 5JXGA 4R54A 4AS3A 1L7DA 3KL4A 2ZIAA 5DBIA 4ETMA 2C7QA 3IP1A 5E1OA 3L6BA 1D4ZA 3CWZA 2KJQA 2J0UB 3L8EA 3S4YA 1USIA 2FZLA 1TU0A 4B40A 4DNQA 2ZBFA 2N47A 4UTOA 4CDMA 3I5YA 1JEQA 3IUPA 3LYLA 4X6UA 1UWLA 3ZCUA 5CLQA 3MN1A 4QRHA 4IDGA 4RABA 4ENSA 1UBFA 4WE3A 4GO1A 4J1TA 1JAZA 3JQAA 3V80A 4C1NA 4F21A 1QHNA 1UDXA 1VDMA 5CCDA 3HJCA 4IGFA 2OHXA 5BV1A 2VI5A 1C7EA 2JGRA 5BSTA 3ESCA 4JDUA 4BO5A 3BIFA 2I3GA 4ND8B 4UXHA 3NETA 1EXMA 3VPAA 3UCFA 4FBGA 3IEVA 2JCXA 3AJ8A 4X6XA 5KWSA 4O25A 4YAGA 7AT1A 4F97A 3OE4A 5D87A 2YFYA 3FTCA 3W79A 3AR4A 1E5QA 3DAOA 2VTVA 1I9CA 1GKIA 1ZI9A 1P1BA 2QM8A 1PU2A 1VBMA 2VDWB 3Q3EA 4U02A 3U61B 5B3KA 4AC9A 1Y8AA 2A9QA 2DECA 2C9YA 1RYFA 4XB2A 1FLNA 4KC0A 1ZGCA 3I2JA 2H18A 4TYWA 3EH2A 4KP7A 3ZXIA 2R5FA 3FHLA 1PF7E 1AHHA 3A26A 1J1ZA 1TZ2A 5ELLA 5JWRA 1AGYA 3H4VA 4ND8A 1FDRA 1WLSA 5CTJA 1H6AA 5EMMA 2P77A 2Z3ZA 4O1MA 2XA1A 3GGOA 2P2SA 3MS2A 4AWXA 4AKHA 3BBPA 2HLNA 1HOXA 5HIJA 3EZ2A 5FL7D 5K3DA 1M72A 1Z0KA 3TCNA 1QB8A 4TYYA 4TQUS 1RWNA 5C8YF 2DTXA 1IJFA 4PF1A 3KETA 3ROQA 4YO8A 4MHSA 3SQXA 3NXSA 3FGZA 1CYDA 1J9GA 2JEYA 3B1FA 3VNQA 3I23A 5ERGB 3KSAC 2E9SA 4FT4A 1G21E 2PVSA 2OB1A 2LCIA 4GMKA 5EXPA 3X0DA 2Q0QA 3NT5A 1RXWA 5HF9A 1J06A 4YXWA 2IBTA 3H2ZA 4J2HA 1EB8A 1UQRA 2C9ZA 3ICCA 1I2DA 3M6AA 3RG2A 3RLFA 4JK3A 5FBWB 4ANFA 3EG5A 4MRRA 3FHJA 1OR8A 3T1YB 4IKPA 5FUMA 4ZTZB 3PGMA 5DHRA 1NNEA 2H1OA 1UBCA 2AN3A 3RBZA 2O8FA 1DC4A 1R8XA 3K8OE 1PFKA 2II6A 4DSNA 1G3MA 2IC5A 5CEFA 1CUHA 1A4XA 2VLBA 4ZVVA 5DB4A 5JSHA 2PRSA 3HYLA 4OQPA 2H0QA 5I9BA 2A4KA 3U5TA 4PHHA 1P73A 3Q3JB 4LX8A 5BT8A 3LCJA 2FA9A 2IRWA 3CUVA 4KR0A 4X3PA 2ZUFA 2C9CA 2IZ7A 5JU6A 4QPNA 1UK8A 1EAMA 4EYSA 3D0OA 1UAAA 2ZWPA 1OT3A 3HKBA 1JPNA 1VI2A 2GM9A 1BE1A 3NJ8A 3CNOA 2G63A 3AF2A 4FBLA 4QBKA 3MERA 5LA6B 4ZICA 5I48A 4DRZA 1LFAA 2PSJA 2VA8A 3QLUA 3HCWA 1C0EA 4HRYA 4XD2A 3UA4A 2WT9A 1FRQA 4Z2YA 3SYTA 1YS6A 1WNFA 2O6HA 3ZJTA 2EDCA 2O8VA 4DCGA 4HVTA 4FYPA 3KE8A 4LV8B 4LZJA 5L4SA 2QXUA 3WE7A 5JWOA 3OLWA 1U7UA 2IEBA 2XWJI 5JSYA 2EKPA 1DIAA 1Q7CA 2JFOA 2X1MA 1BHO1 2RGRA 3ZXUB 4DJ5X 4RVNA 1QF7A 3LPLA 1QC5A 1JKFA 1RAAA 1YNOA 1MT0A 2VZ8A 3TVDA 2XHZA 4JLSA 4K6CA 2C96A 4J0JA 3F8WA 5KYUA 3PEVA 3V7NA 3VOSA 3KYBA 4BMCA 2H1RA 4BZXA 5BNTA 3OKFA 4DNPA 3EWSA 3L41A 1XJWA 3GGGA 4EJ6A 3JWGA 2WWIA 2B5WA 2C3YA 3KQPA 4CKYA 3N2KA 1EGVB 1SU6A 1TT7A 4OIMA 1CP3A 3TQFA 5SZJA 1D4OA 4JX9A 4LW8A 5JSQA 1NQUA 3DB1A 2VDUE 3JASA 3UJNA 3H9JA 3PFKA 1RJ9B 3TLJA 1TCAA 4P4UA 4ID3A 2PMWB 5AOBA 4RLQA 1JBKA 2WY2D 3RCBA 4NCXA 3KYIB 4WKNA 5JH7B 3FKSD 3BGDA 3WB0A 2ATVA 4TMVA 2FFRA 2H6EA 5FBRB 2C88A 2OEPA 5AW8A 2NUTB 4PZEA 2RDMA 1W1WA 3HLYA 1U1IA 1C4KA 5CPBA 2B0JA 1W25A 7REQA 1YB4A 2YQ4A 5JAOA 1PV2A 4OQNA 3PTAA 2R7MA 1GSOA 1R50A 3MWLA 2EP8A 1TFUA 1YQXA 2OLEA 3CX3A 3LECA 4GWKA 1KXZA 3QX7A 3TW8A 2ZB8A 4NNPA 3K0SA 3O4FA 5FJJA 1EE2A 2YWHA 3TZBA 3NBYC 5A7FA 1NOJA 4CM3A 1G1AA 5K05A 4MWSA 2X3FA 4JEMA 5KDOA 2QG9A 3J81A 4RPGA 3R4VA 3IOYA 2IYNA 3A27A 1MQAA 3LXXA 1GKYA 4P5EA 1CF2O 3G5TA 2EX1A 3OD5A 3FAKA 3PE4A 3E9RA 3NHSA 5D6NA 2WMYA 2XMQA 5IBRA 1E2JA 1ODKA 1R0BA 2H65A 5IJAA 7REQB 3KQWA 4S05A 2PCLA 4LISA 3GGJA 3L6OO 3NTRA 3U1BA 4BLWA 4KDEA 4RHEA 5CR9A 2CUZA 4HVLA 5B6JA 4BRSA 1G8KA 1N5MA 3E23A 4L9WA 4LK3A 5C1IA 2ADMA 2QY6A 3BMQB 3QFHA 3R0VA 2ZKIA 3DYIA 3PUJA 3DF7A 3DTVA 3F3KA 3KV3O 4L08A 3LDHA 4IJUA 4WXMA 4U63A 1VIAA 5K6TA 2AOXA 5KPDA 4MVJP 2OD9A 5I6DA 3ZDYB 3O6VA 5LXTF 3HXMA 4UBJA 3QX9A 4MROA 1RM3A 1R4NA 4HDSB 4TZ0A 4E32A 4WZBE 5TVKA 1DEAA 2NSLA 3ZCTA 1WY5A 1QFMA 3NHKA 2R1ZA 4Q6BA 1PP4A 2DLCX 1DIOB 3L4BA 3LLVA 1A4RA 3WRWA 5KQSA 1CR2A 5GAJA 2J5BA 5JFTA 5IBPA 4B3RB 2JIZA 5FOQA 4XX0B 2P27A 2PIAA 4FHGA 2OFOA 3SF0A 1JKMA 2OFXA 4GX5A 4A27A 5KMGA 4WERA 4IXWA 4XCXA 1B1CA 5F64A 1CUAA 1GSIA 1JILA 4LGYA 4A6DA 4XPIB 3R8CA 3OTOB 4IIGA 3A9SA 3GA5A 1J9EA 2BGTA 4MV6A 3B6IA 3NC4A 5LL6P 3A9RA 1S89A 5KUTA 3IURA 4NV3A 2GYYA 3OEED 4PLCA 2RGBA 1C4XA 4YRQA 3RS2A 1DAMA 1GZ6A 2E21A 2YVLA 1O0CA 4IWNA 2WUFA 2BCEA 1DBRA 3JSXA 2YASA 2JZCA 5IANA 3JYHA 1G18A 1LTKA 1L7NA 1S8NA 4P54A 1KDVA 3N2GA 1NAIA 4CMEC 5EYPA 1PIWA 4HNAB 4JSTA 2RGNA 1VJTA 2EZ9A 3JD0A 4CMAA 1MJGM 2F64A 1O89A 3ESYA 1M1YB 3KBOA 4B17A 1RADA 1WXEA 1NVVQ 2I4OA 5B64A 2W2LA 1VZ2A 3P9PA 1H2RS 1PD1A 2VSXA 4ZJUA 3W1EA 2G06A 2J0EA 3PGVA 2YWBA 1QGYA 2AK3A 1GOTA 2PJZA 3BC1A 1KGDA 4ZGBA 4DLKA 3MRTA 4YN3A 3S55A 4F1KA 2A58A 1T8WA 3EGVA 3RJTA 1QG6A 5BO5A 1JQ3A 2PSDA 2HNBA 2E5LB 4WKOA 3BF8A 3I9NA 3WI7A 5B58C 3GPIA 4YV1A 1EWQA 2PT6A 1A9XA 4FX2A 1DCKA 2F1IA 1MHTA 2R7AA 3UHOA 5MFPA 5AKIA 1WKCA 1FFXB 1R00A 2AC7A 3KUUA 2WSBA 2VHVA 4XRRA 5AICA 2ZGVA 3ZGZA 2ZJ7A 2DEUA 4JCOA 3UJHA 1JG6A 4GP7A 2RGDA 1X7YA 3K31A 4YCMA 3PDIA 1ZLYA 2GB4A 2V9CA 4UDYX 3WVNA 2FFJA 5EE0A 5EIFA 2IXAA 4PWZA 4NPAA 4JNCA 5I01A 4NCHA 2AN5A 1U6KA 3EPKA 3UWMA 3N0RA 2I6FA 3OJWA 3ESZA 4HQOA 2FLKA 2ZANA 3A58B 1CQZA 4RCVA 2BBOA 4ZN6A 3RSOA 5K09A 4L8FA 1CB0A 4R5HA 3P52A 3WLFA 1C30A 2IJGX 3NC1C 4Y2JA 4DLLA 4WASA 1FLAA 1RWPA 2BCGY 3STWA 1IY8A 3MBKA 3B1KA 1MJGA 1GXSB 4JGBA 4ARUA 3O03A 3BHMA 4YYZA 4C0XA 4PO9A 1V6SA 1DT5A 5HYVA 1G16A 3OICA 3FYCA 4O2BB 2QPOA 1CDOA 2BUBA 4MR9A 621PA 1EX1A 3KQQA 3R7NA 2F9MA 5AOAA 3WB9A 1FQOA 4H31A 4RXTA 1RT9A 2FRDA 4HY3A 5IHPA 1EBFA 4C4RA 1V6CA 2IH2A 5KCZA 1L4FA 1V71A 4ZALA 4F5DA 1NPYA 2D0PB 2JBHA 2ZKLA 5IKEA 1BMTA 1EUQA 1QRRA 3KXPA 2A6PA 3GJQA 3PNPA 2XUKA 3U3OA 4PQRA 2WIKA 4TTSA 2XT9A 4DBLE 4DB4A 4GQAA 3U4MA 1CNMA 2P9BA 4P0QB 3OPXA 2PL3A 3LKVA 1L7PA 5JS2A 5CPFA 4PXSA 3T4UA 4FKMA 3A6FA 4DDVA 3FB4A 4KFCA 2O2HA 1VL6A 2PEYA 3AFMA 5DCUA 2PLRA 2OAQ1 1UPBA 2J8ZA 4RZIA 1OB2A 4ZVRA 4R71A 2W43A 3R3HA 5K20A 2V7QA 1SKYB 1V4VA 4LNUB 1HT3A 3AWIA 1YE5A 4OHPA 2X13A 3GAFA 3DE0X 5JRDS 3IHLA 1VJGA 5HF5A 1CB7A 1TECE 3CRQA 3CF4G 3GLUA 3MOGA 3ZIDA 3FKJA 1SUAA 1XZMA 1GFZA 2IYYA 1SBTA 3EVBA 4YBZA 1RKUA 5DPMA 1Z13A 1PQPA 1E3QA 1WSBA 3CNEA 1LSJA 2AUMA 3GPLA 3GR6A 5CLJA 3QNWA 3KR9A 4Y2SA 1ZY2A 2GRAA 2IV3A 2JJ8A 4QDKA 1KOFA 1MJ5A 1VFNA 4EKIA 4DMRA 3WWYA 5IM5A 5DNUA 3U4QA 1PVDA 3EF3A 4P80A 3RGGA 4AAYA 2Q9BA 3LV8A 4JN6B 2X15A 2XBLA 721PA 4QBGB 1G21A 1Z08A 1T2AA 2QVGA 3W2EA 1JAHA 1NURA 5CM8B 5AI9A 3O8DA 2WRZA 5IBCA 1BG6A 2PUVA 1EHCA 4GLOA 1FS6A 3KHTA 3IJRA 4J4BA 4LRQA 4XI9A 4WZAE 2NVUA 5TE9A 2VBGA 3NBFA 1SBIA 3UGTA 1H1LB 3DCNA 3T3EA 2WJJA 4DUYB 5A2QA 1K4YA 3E7FA 4KIGA 4LC0A 2PWBA 3DV0B 3KD2A 1I5OA 3AC0A 4MI3A 1YFLA 1EIWA 3ZYCA 4H7PA 4QYIA 2PJUA 1R0KA 2IV7A 1NUPA 1O9BA 5L3SB 4TV8A 1DTWB 3KLOA 1W29A 4EPYA 1Y1KE 1SOMA 3GARA 4PAWA 3VSDA 1G5IA 4YAKA 5HQ3B 5CT5A 1ABEA 3KTOA 1WD5A 5J4VA 4LQCA 4R84A 2J08A 1HETA 4YCJA 2B5OA 4XH9B 4J0HA 4N4AA 3A0RB 4R2LA 1YDFA 2WHPA 4Z4CA 2D2EA 1ENOA 4LV6A 3O21A 1M5UA 3G1WA 4QHYA 3AX6A 3IEXA 3R8XA 2WB2A 1FQKA 1WQ1R 3DMGA 4OMUA 4FFOA 2Q1YA 2OTCA 1M7HA 1PLLA 1GADO 4YJ3F 5IYZB 4DKJA 2B1IA 4B6OA 1CLEA 3BZWA 2YVKA 1SWVA 5LLTA 2ZSDA 4Q7MB 1ZMRA 5E7MA 2OZLA 5MGNA 3NZEA 4OUDB 4A6XA 1Q11A 3OEHD 4EYKA 4DLAA 3Q7TA 4UUOA 1Y3IA 1HC7A 4OU4A 4MV5A 4D8VA 2BGKA 2VYNA 1U2QA 2VHTA 4H3SA 3WYDA 1R9MA 2P2DA 2XMRA 4Y9DA 1QB7A 5DHPA 5EP1A 2HREA 4HUQA 4I4TA 1I4LD 3WQQA 4C29A 4HZUB 4J4HA 3RLIA 3AY6A 3HL0A 3Q6IA 4ASUD 3OF2A 4C6SA 1UM8A 1LTQA 2BFCB 5H9WA 3H1FA 5I7UA 4G1UC 3C7KA 1OYYA 5E9AA 3ELWA 4BFYA 1CZUA 1XLTA 1YS9A 2REOA 4X44A 1U0TA 3GYBA 2HY7A 1JFVA 1AQIA 1TXGA 5G0VA 3U48A 4MP6A 4L0DA 2X9NA 1TD1A 2O50A 5KJEA 3LDAA 1ORDA 2IIBA 4N3BA 1W7AA 4C89A 4ZCLA 1XLWA 2HR1A 1EA7A 2C82A 3AWDA 2FR8A 5KSOA 2FPWA 2YNMA 4RAOA 3Q5EA 4MUGA 3RD5A 1DQYA 1SVMA 5K8UA 1R8QA 4H3VA 4RC9A 3NVMB 4M6WA 1P2BA 1XNJA 3BUSA 1IB0A 1JPJA 4MICA 3O95A 4KRGA 3ZDZB 3HVKA 2W2QA 3RH0A 5K0TA 4KQHA 1RDFA 3FDIA 3T5DA 3OFNA 4ZZ2A 4UOEA 3UWDA 4HGZA 5LP6B 4AIRA 1D0IA 3LLSA 3EDOA 4DG9A 3NHZA 1C1XA 4RF2A 3C3XA 2PDAA 2FUCA 1LRLA 2QBYA 1HZJA 1NQXA 2WPDD 2X19A 4FIZA 5TR9A 4C6TB 3LQ4A 4F86A 4XQEA 1GGEA 5DHTA 2XTZA 1LBQA 5EWJA 1B76A 2VPIA 4L95C 3WQHA 2DTDA 4YCLA 1QR6A 1QFYA 3EXAA 1YZKA 2RHHA 4I99A 3N2LA 2W6PA 2V4ZA 5LIRA 3OOYA 1ULTA 3F7OA 3FZGA 1XHFA 4LE0A 1GQFA 5BQ5A 4AKSA 2M6SA 4G5SA 3SZMA 3PT9A 5AW1A 2IEYA 1U8UA 2CDCA 1YBHA 2PNFA 3H5RA 3LVQE 3R24A 2WD8A 3CMMA 4MW5A 3JZMA 1G98A 2J59A 2RI0A 4S2EA 4BJ6A 3HUUA 1DG9A 1X7XA 2J3QA 4X5OA 4FOPA 4KZPA 4LJ8A 4NV1A 4DA8A 1U2RA 3ENWA 2ZJAA 4LGVA 1ACMA 5DXAA 5HPYB 1Y4AE 3QG5A 3NHWA 2EKQA 3VH2A 2C1EA 3AJRA 3N5CA 4TRJA 3REOA 3UC9A 4C78A 4OX9B 2O8BA 5I7WA 3WIEA 3U44B 2QYHA 1IQPA 1RWBA 5EZ5A 3ZQUA 3B5JA 4LRWA 3EWAA 1C7QA 3AHJA 2OCIA 3WTBA 1ODCA 5E9QA 1V6AA 5LWQA 1IH8A 4RQTA 2A7QA 4IUDS 2PBLA 1LJUA 1F7UA 2NU9B 5JXJA 1M83A 1N1MA 1JBEA 1BQ4A 1Z4PX 4IH9A 6CHYA 1PX0A 2QUJA 2IXBA 3OCWA 3R5JA 4L8WB 3C2QA 4WXPA 1WOYA 5GJVC 3W2HA 2OXEA 2IDMA 1TM5E 4L85A 5TARA 3U37A 4C2BA 4IM7A 3IVMA 4URVR 5BUSA 4R1UA 1R4AA 3FZQA 3BWVA 3DEAA 4HF7A 4D98A 2BW0A 1ZH2A 1CSEE 2YYAA 3KVOA 3NQ41 3ZQJA 5JY6A 1T9CA 1Y6FA 3KEQA 4RZXA 3OEEA 5LZ5A 3WJ7A 4HH0A 4B6JA 1DX4A 3O7MA 3TR5A 5JR3A 1EX7A 4PSAA 3VTAA 4UTPA 1VKJA 1Q0QA 3E27A 5BQFA 1BVUA 5CFRA 5F2EA 4O33A 4YJHB 5BN5B 2HSZA 2NSHA 1RSZA 3G13A 2LXNA 4XWKA 3FSGD 1G8AA 1AGPA 4AP5A 3U4CA 3TAUA 1A7JA 3L4BC 3I92A 4BP3A 3FYTA 4QQ8A 3NKLA 3Q8LA 2PWYA 2C5AA 4OATA 4KGXA 3GLHB 2G0NA 2FQXA 3N2NA 1ENZA 2IXDA 2WUGA 4N5HX 1VECA 1Y1TA 1KS2A 1JTEA 2H2WA 2GEBA 2ID7A 3I1JA 4MRAA 4L2IA 1BCSA 1OYVA 3DTYA 1N2CE 4NMLA 4JHXA 3ZGYA 3L6CA 2VAVA 1F2TA 1ONOA 4J3JA 3Q8XB 2HSWA 5LQKA 1DPGA 2LUOA 4IOJA 2FPPB 3LH5A 1CHDA 2O5VA 3I9LA 4N65A 1G2PA 2FUG6 5IFLA 1XTZA 3OTWA 2QTRA 3NDPA 3RUPA 5ALKA 1Y7PA 4D44A 1RQXA 2SICE 1RWWA 2QZSA 2QN8A 3HE3A 2J9FB 2GA8A 5JJBA 4PO1A 4XXHA 2QN2A 1ZSYA 3ZE1B 1SG6A 2GPAA 5TSDA 2ZRJA 2JEOA 3L8FA 1XXHA 4GSYA 1CUZA 2ZTSA 4QATA 4E21A 4CTMA 5AD1A 4P08A 5CLLA 4UEKA 1ZMOA 4AMZA 1PR6A 1U9YA 2VZ9A 1AVTA 2BEJA 3RYIB 3HXQA 1TC2A 4C0AC 4LUCA 2Z83A 1Z0DA 3MQ2A 2WK1A 1FVXA 1E7RA 1U9IA 3P2JA 5EN4A 4GPD1 5EJ6A 3JVEA 1V16B 1E3WA 2JDID 2I2BA 2PJDA 3P20A 4NFLA 1J0AA 3EIHA 5C34B 5LQUA 5FA5A 2GZ1A 3UYLA 1Z8DA 3PKIA 2O0HA 2WW8A 1X9HA 4YRRA 3TLGA 4CMIA 2P9HA 3VDMA 5DT9A 4GVPA 3KM0A 3ETDA 5D00A 4N7BA 3SZOA 1EFPB 4GP6A 1WO8A 1Q20A 5EZYB 3S2IA 4GI2A 5HSGA 5IUNC 1EBUA 1ZA2A 4AXBA 1SBNE 2C4UA 2XHEA 4JEIA 3RC2A 1NPDA 2XAUA 2WQ6A 2BONA 4LGCA 1Q44A 3KOUA 1JF8A 3PI7A 4A2WA 4BLPA 4MIOA 4LF4B 2IEGA 3QQPA 1ZIOA 2Q6VA 2NVBA 2FMXA 2GS9A 1ACJA 3OWXA 1ULHA 3O2JA 3QITA 2WV7A 1VE6A 4H59A 4MK4A 1DAFA 4UMEA 1A2QA 5DHFA 4CF5A 1XGKA 2X4DA 1JHYA 1NONA 1QJCA 4UBOA 2XDWA 2HA2A 3A4NA 4JITA 1SCKA 5GONA 3D64A 3E9NA 4MLCA 3ZNPA 2VRWA 2D5LA 4NNJA 3JCZA 3LBFA 1QGDA 1KEEA 2PWZA 1W76A 1YU6A 3FA2A 4OHKA 5B1IA 2Z6AA 2ZAOA 3AMVA 2CKDA 3AZPA 2JL1A 3NEPX 2H2AA 3OTIA 1PE0A 1F06A 4I6GA 2EJWA 1KSJA 3AM4A 4UNPA 2HBZA 1H2BA 2PRZA 1PRYA 4YRIA 1BO6A 3RBVA 2B4QA 2N0SA 4PHGA 3AKYA 4LVOA 3IALA 4FGSA 1CS4C 1E9FA 2WHYA 3BKWA 3K1AB 4OLHA 3VNBA 4AJHA 4Z8YA 5ER6A 4HLUC 3F47A 4E7OA 2GD2A 3DHNA 4TL6A 1VRCA 3QMVA 4GVXA 3MCTA 5AI4A 5DM4A 4MV4A 5KVQA 3TIIA 4JXZA 3P1JA 4GRAA 5C5CA 1PR9A 1GTMA 2K2WA 1JHMA 5EP2A 3D54D 1FXSA 1P33A 4D3ZA 3L7NA 4Q9IA 4W5OA 1EWTA 2HWKA 2D6FA 1P2SA 3ZWOA 4NVRA 5FHRA 1G64A 1FS4A 1NE2A 1JECA 1HQDA 3A1SA 2FPPA 3O1LA 4KFTA 1E1YA 1JQAA 1XI2A 1N6LA 3CT4A 4KQ9A 2FI1A 4L5YA 4MPRA 2O7VA 2VHUA 1YTUA 2PTGA 5L3VA 2IZZA 1YV9A 1YCDA 2GKSA 1V26A 3CB2A 4J0GA 1O3YA 4PPGA 2YWRA 1OH8A 3CLSD 5EJAA 1O57A 1IM2A 1UFQA 1NXPA 1AKTA 3MTEA 4P53A 1U0NA 3VRHA 5D8DA 2F7SA 1NASA 3WX0A 4BCCA 4EI8A 4RTJA 2P4SA 3FRHA 3RAEC 1Z2DA 3V2IA 1HF3A 5JXIA 2GK6A 1MO6A 4UTRA 1Z5OA 2IWHA 3BHNA 4CKWA 1C0IA 2IDJA 3K70D 1QH8A 2XUOA 1SBYA 3WQRA 1F3LA 1GTG1 4MR7B 2QRMA 3GXBA 4L27A 5DTRA 3R7BA 4ZPXA 1ZJJA 4BASA 3TPFA 3LW7A 2DHEA 3ZHCA 1TA4A 1H94A 4L4XA 4MV8A 3GN2A 4Z4FA 1E92A 2VOJA 3GI1A 2CB9A 3D3QA 4GSLA 3B12A 1RJFA 3RF6A 3UB4A 1RYEA 1NP6A 2BFDB 3FIUA 4YAUA 3SZLA 2JJQA 4K8RB 3DQPA 5JYBA 1QGUA 1X7GA 3C4JA 3CLSC 3OZAA 3PJDA 3PXGA 3SZUA 3ZLVA 3E3NA 3RJ9A 3D81A 2M6LA 1H1TA 3JQPA 4CMBA 1XYGA 2VJNA 4BB0A 2AW5A 4BTEA 2YWFA 2O2XA 3MCZA 2B25A 3EEYA 2PV0A 4WXHA 1Q74A 10MHA 2IHUA 3ZBTA 4AY3A 3H3FA 5JRZA 1RCUA 2ZULA 2ZE6A 1CHNA 1WSDA 2Y2VA 4QVGA 1WMSA 3E58A 3AR2A 4EO7A 2RIRA 2Q5OA 4PNEA 4YRBA 2TSYB 5JS6A 4PIPA 3RT9A 1YF3A 1IN7A 2AZTA 2IU6A 1NX9A 3JXEA 4LKOA 3B3AA 1A2OA 4UCWA 4BV3A 1L7OA 1GU0A 1NNSA 1NSFA 1E1NA 1NBME 2PMDA 3T1VA 4UM9B 1V35A 5CW1A 1NW4A 5KX5F 3BXGA 3RWOA 5J59A 2SHKA 5SZIA 4BNGA 3H5VA 2BM9A 5KZMB 3RUEA 4DANA 1WU7A 3I61A 2XB9A 2PGDA 2V74B 4TUYF 1P1HA 1VKRA 3NHBA 1RYYA 2BM0A 1T1GA 1WXFA 2NXWA 3HLKA 1GCGA 1JXQA 1O96A 4R83A 3BXFA 3FFBA 1KWGA 4Q15A 1U3UA 1KO8A 1NZDA 3ZQ4A 4TX1A 4Y1EA 4JL5A 3TGWA 3EXEB 2UUOA 3TOXA 3P9XA 1X39A 5JC8A 2NQTA 4J1QA 4B75A 6NULA 3GFRA 2LGJA 3BSWA 3H7IA 4ZU3A 5TEWA 4LTNA 4R2WA 1RC1A 1PTKA 5J2UA 4PHCA 1RTTA 2OORA 2RJOA 2P9JA 3ZHYA 5L3SA 4Z6KA 4OLAA 2A5DA 2XZDA 2M32A 3LUCA 1FTQA 3OKAA 3PC8C 5BMVF 2HSJA 1XVLA 5IASA 1BMDA 3FOAA 3K9BA 4QSHA 3RRYA 3WSWA 3O0DA 5G0TA 3ECAA 4DJTA 1YA8A 2R4UA 5LZ7A 1HDGO 1XDBA 5TT0A 2GZ2A 4KVZA 3KC2A 1UBEA 3BL8A 3TNLA 5BW5A 4UJ3A 5DW3A 2RCYA 4QECA 2EHJA 3MRXA 1IMJA 2EERA 2B3TA 1GTVA 1R6TA 3V4OA 1IOVA 1KH1A 1PNOA 1EWVA 2XW6A 3LQ1A 4GG1A 3LC7O 4JY7A 4F1WA 4A5OA 4WKCA 1H8EA 2C59A 3PCTA 1HZZA 3J7TA 1AH2A 1ZR4A 4D46A 1SIOA 2WJGA 1KAQA 1Y9EA 1O5IA 3BRQA 4J0QA 2GK3A 3X1MA 2JLCA 5AJHA 3N2IA 5T57A 1IFXA 1P0QA 3T9BA 3LUFA 3SHVA 1W5EA 2FWIA 2I2XB 1E0KA 3NBXX 4EHLA 3EXIA 2AFIB 3D6UA 5KTPA 3S3TA 3ZUGA 1YKSA 3LVRE 4GWLA 3C6YA 2AFHE 3E3AA 4YJKA 2ZUSA 3QE4A 1PCXA 2Q8NA 1V37A 1KJZA 2HFJA 2RMKA 3DONA 3DXYA 4GC5A 1YA6A 4J1SA 4EH1A 5IN4A 3O8OB 1QYXA 4O2AA 3CG0A 3R3JA 3FHTA 3U3XA 3AOEA 3LI2A 4GF5A 2QL7A 5AOCA 4RJTA 2QTGA 3ZDBA 3KEMA 3QWHA 4XDGA