1K7SN

Fhud complexed with albomycin-delta 2
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
262
structure length
262
Chain Sequence
GIDPNRIVALEWLPVELLLALGIVPYGVADTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSAGYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIRSMKPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAVSIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSAMHFVRVLDNAIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallographic structures of the Escherichia coli periplasmic protein FhuD bound to hydroxamate-type siderophores and the antibiotic albomycin.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Ferrichrome-binding periplasmic protein
total genus 75
structure length 262
sequence length 262
ec nomenclature
pdb deposition date 2001-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01497 Peripla_BP_2 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1k7sN02
3.40.50.1980 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nitrogenase molybdenum iron protein domain 1k7sN01
2PS9A 2O1EA 2RG7A 1MIOA 5JG7A 3PSHA 1N2CA 3AEQA 1QH8B 4K3VA 4HN9A 4HMOA 1EFDN 3U7QA 2ETVA 2OSVA 1QH1A 2R7AA 3GI1A 3EIXA 1G21A 2XDQB 3AERB 2PRSA 5AFSA 1K75A 1H1LA 2YNMD 3ZK8A 1N4DA 1G20B 5CX1A 5BVHB 5M2QA 1ESZA 2XDQA 3AERA 4DBLE 1KARA 3BE6A 3AESB 2OV1A 3LHSA 4MDYA 3G9QA 2MINA 3R5SA 1N4AA 1QGUA 5KHLB 4LS3A 5CX1B 3ZK7A 4TKUA 4WZBA 3BE5A 3MFQA 4OXRA 1K0FA 1M1NA 4B8YA 4HMPA 4N01A 5M34A 1K2VN 4MLZA 3AEUA 4MO9A 3ZK9A 3AEKB 4M7OA 3MWFA 3EIWA 4BBPA 4WZBB 3HXPA 3K1AB 4HMQA 3NU1A 5GGYA 1N2ZA 3U7QB 2M6KA 4UTOA 3ZTTA 1FP4A 1G21B 3AEQB 3AEUB 2XY4A 4GICA 2WHYA 1L5HB 2YNMC 4WESA 4G09A 4WZAA 4IRMA 5FLYA 4PAGA 2WI8A 3ZKAA 4NNOA 5KOJA 1FP4B 4XPIB 4FKMA 1PSZA 3K1AA 3UJPA 1G20A 1M1YA 1TOAA 4WESB 4INPA 4OVKA 5BVGB 3MWGA 2QI9F 2X4LA 2OGWA 4FI3F 5KOJB 4WN9A 4XPIA 2PS0A 4LJSA 3PDIA 4UDNA 1MIOB 4INOA 5HDQA 5BVGA 1N2CB 2AFIB 5KOHB 1QH8A 1K7SN 1H1LB 4WN9B 3HJTA 3AETB 3PDIB 1KAEA 5BVHA 2OV3A 4CL2A 5JJ5A 2AFIA 1M34A 3TEFA 3AEKA 2PS3A 5M29A 4G07A 2M6LA 5JPDA 3TNYA 5M3BA 3R5TA 4FILA 3MINA 3AESA 2Q8PA 2AFHB 4PM4A 1QGUB 2Q8QA 2R79A 3MD9A 3CX3A 3PSAA 3TLKA 4TKVA 5JOQA 4WZAB 2MINB 5CR9A 4FNAA 4UDOA 1PQ4A 3HH8A 5GGXA 1XVLA 3AETA 2PHZA 1L5HA 4ND8B 4WNAB 4TKUB 5KOHA 1M34B 4H0FA 1KAHA 4TKVB 2XV1A 1M1NB 2XUZA 4MX8A 4NNPA 3MINB 4UTPA 2XH8A 2AFHA 4H59A 5HX7A 1M1YB 2XQVA 4ND8A 4WNAA 1QH1B 5B58T 5I4KA 3LI2A 4OXQA
chains in the Genus database with same CATH superfamily
2FZEA 2RHDA 4KR6A 4PWYA 4L2IA 2JA1A 2YWEA 1HTBA 4CBVA 1E2KA 3OJEA 3K32A 2BI4A 1T5OA 1A96A 2QXTA 3RDPA 5CFPA 3L0YA 4L5CA 2YVLA 3U7QA 5KX5B 3A2KA 2QRNA 3T06B 2VDVE 2SBTA 3JQQA 1A5SB 4BFTA 5KPDA 2EZ4A 5AH0A 2GEFA 5ANRB 1NHGA 3AHEA 4HUTA 3LP6A 4KQ6A 1RJDA 2PD4A 4PSVA 4MUXA 5BQ5A 3HADA 1HDYA 1FRFS 3GEHA 7REQA 3NKLA 1VLVA 5LJIA 1A9OA 1ODKA 2VSFA 1Y4SA 1DJMA 1QE0A 5JH7B 3PEYA 3AF4A 2CVFA 2JFHA 3MCUA 4IDGA 2XW6A 1N2OA 1PJ8A 1N6PA 1B6SA 1ZRMA 2RDMA 3ICPA 4DILA 2E82A 1NBMA 1W5AA 4G41A 3C2QA 3N2YA 1K8XB 5JXWA 4Y7DA 5FF9A 4XASA 3A58B 1WOMA 1L7PA 2B0JA 2CMDA 2EWWA 2FOIA 2HBQA 2ODBA 2HSZA 2PH5A 2YRWA 3D81A 3GW8A 1MAWA 1X7YB 1ZGBA 1UMCB 2YXBA 5J4LA 4MI6A 1YVEI 3VNUA 1E66A 2DHCA 3W5AA 2ZR9A 3CLKA 2K2WA 5AOBA 2RIPA 1TEVA 3T0GA 3IMGA 4R1UA 2HSDA 1EHYA 1DBVO 1G3RA 2A1UA 3A9SA 4GPD1 3FROA 4NL4H 4UE6A 2Y1EA 1WKVA 3TK1A 4DF3A 3JU3A 2C92A 5EZYA 2WJGA 1GWNA 1MNAA 1Q0PA 2N0SA 5ENZA 2VZ8A 4FE3A 3WXBA 4D81A 1YJXA 1DZIA 3C7AA 5IZCA 4HTFB 3ZW9A 3DZDA 3OAAD 1K4MA 2BFAA 1GPNA 3IEKA 2FE4A 4RNDB 5E9JA 1RI2A 2HWUA 1NN0A 4OD0A 4BVLA 2C99A 1NURA 1RKUA 1JHZA 5P21A 3BF8A 5JDIA 1QMGA 4PX9A 5KJ6A 4AUMA 2WOOA 3TB6A 5AIBA 2HX1A 5ALEA 5HTOA 3AL2A 2ZDGA 3IR7A 4ENWA 3RC3A 1Y8QA 1I36A 4PIPA 4Y1RA 2OM2A 3LCVB 3O26A 4BJ1A 1VA4A 1JHOA 2Q5CA 2GESA 5HIJA 3SLGA 4PR3A 1L5LA 3A4YA 1SC1A 4RSHA 3FB1A 4UJ3A 4CKZA 2CV0A 4US1R 3T3PB 3UT6A 3CRQA 1KSFX 2JI6A 4XGIA 4QREA 4YAJA 1SM4A 4EARA 1ID8A 4CEJA 2YHIA 4QSMA 3UUGA 4XVUA 2ZFUA 2YFQA 1XVVA 2I87A 2J0UA 3CPHA 3FWNA 3OC0A 1HUQA 1GGVA 2JAUA 3D4NA 4GD3Q 4GI1A 4WZBE 3DW3X 1AK2A 1M75A 1ZM3A 4MV0A 2A0WA 2I2AA 2DHDA 4UTRA 5H80A 2QIPA 4GOXA 3E9QA 3SSOA 2QTZA 3VZDA 3ZQ4A 2NPIA 3H2GA 4AICA 4BQQA 1N34B 1QFZA 1Q0HA 1R9JA 3L9XA 3PSAA 2O8EB 2B6NA 1TUBA 3OT5A 3WKDA 4OQYA 3NJ4A 1TU0A 4LMRA 3V1LA 4URXR 3AMVA 3GJ8A 3QOFA 5AI9A 1WPQA 1K9SA 4C78A 4YIKA 1LW7A 3UCFA 4A6DA 4DMKA 3EEBA 1QJ4A 4FFMA 4TYWA 4QG3A 1QOZA 3BN3A 3RKRA 5H16A 4D43A 5IH7A 2JLAA 2IFTA 4JLOA 2YMMA 4QTTB 4EHHA 1Q6YA 2DT8A 2FEAA 2J45A 3MEQA 3LT1A 3KHSA 3IBFA 2C2MA 3RUPA 2P7IA 4YBRA 2RCNA 4YUAA 2R6HA 4EDFA 3IIIA 4Y3UA 4ZMBA 2WU1A 3A8TA 4XSVA 5G3ZA 5E6SA 1W6RA 1NXWA 1L1QA 2G36A 4MR9B 5TT0A 1XVTA 3AW8A 4WJZA 2J85A 5FI0B 5A9SA 3HCBA 1I13A 5LYYA 4UAVA 4WUVA 3N2KA 4X60A 2C7PA 3T1HB 2UZIR 4MS1B 5KVCA 5LQUA 1SPBS 2CNLA 3Q7SA 5LXTA 1E2FA 4EJSB 4M9CA 4A5SA 1NPTO 2VJDA 3N1UA 1KI4A 4GZ5A 3P0FA 3JQEA 1RD4A 3DOCA 4RPJA 4GXTA 5FUVA 3R9IA 3GLKA 1XNRB 2X5OA 1FQJA 1R1DA 1DWUA 3PIDA 3R0VA 1NJFA 2ZWIA 4G5FA 1N0IA 1FTWA 4FVTA 2ANCA 1DINA 3S2SA 3ZWWA 2ZYSA 2GARA 1CE8B 1NT4A 3ASVA 4I1PA 3CUVA 3E9ZA 4BVAA 3GEDA 5A3QA 2ISCA 5JMWA 3O94A 2CEAA 1DJPA 1DPGA 4GSKA 4BMPB 1MGPA 3BCSA 3L41A 4MVJA 4HAIA 2PBRA 1WULS 3WWZA 4DSTA 3AU9A 1Y7LA 2PKQP 3NATA 4YUYA 2IW1A 2E4ZA 3TQHA 2QL5A 1YB2A 3C3DA 4UM8B 4BL5A 4EUSA 3LQQA 4QASA 1NQTA 1DWQA 1R74A 2GKGA 5JSYA 5JMOA 3DAGA 2Y92A 2C4VA 5B1IA 3JARA 2XNDD 2A4MA 2IA5A 2QX6A 4ARZB 2WIKA 5JROA 3FMPB 2CWWA 3K0SA 3EZYA 2XMZA 3L8EA 2A9VA 2JAPA 3WK9A 3FPLA 3FXAA 4PINA 4LRTB 5J1SB 4HDAA 1UJ4A 4DT1A 5AVWA 4O0LA 2OV2A 2HJRA 2FW8A 4QOJA 4U1RA 3H1TA 2FP4A 3RAJA 2FHSA 1XCMA 4JB8A 1X8LA 4WESB 1L4LA 1KO8A 2GPJA 2PX3A 4IGIA 4ZK6A 1Z2PX 3FGNA 4JLWA 1XC7A 2LE0A 4LYHA 1QX4A 5LB4A 2TMDA 2W7TA 2XIJA 3ZXYA 3OKAA 4CTJA 4RV4A 2EZ8A 3K6JA 4A0HA 2VSOA 3BK1A 1OYOA 4IIVA 1OF1A 3K70D 3A25A 1XALA 3TMKA 3DE1X 4RHCA 4ER3A 2J3IA 3VHXA 3S5JA 1G1AA 4P7KA 1K3UB 1R5BA 2BW0A 4WCVA 1U7TA 3DBLA 4BNNA 2Z5FA 4BO7A 1FYEA 3R09A 3M7IA 3R3JA 5SY9A 1NDQA 3IOEA 1T3SA 2Z4RA 3KKOA 4QUGA 1RJFA 3S2FA 2BEWB 4KYUA 2QVZX 4C3OB 1IVSA 3AG6A 3W8EA 2CNWD 3GLHA 1SD5A 3ETHA 3D8TA 1Z7EA 3KFXA 4IDBA 4QPCA 3ZHUA 2AFHB 3OFKA 1PJ3A 4QDZA 2D5AA 3I92A 5T57A 5THQA 1C9YA 1CR1A 3L18A 1FDRA 4TTJA 1K6EA 3IVGA 1OBFO 4EG1A 4OHCA 1CR6A 2XZDA 2PT5A 2CZQA 2IEGA 4I1OA 4Y9TA 3MUFA 1Z6AA 1VJ0A 2WP0A 5FOTA 3VC3A 2XRFA 4A16A 1UOOA 1IB0A 3G7NA 4B3IA 4HQRA 1Z0KA 1COWD 3CQ9A 5HGJA 4AKIA 3O3MB 2FUCA 4WXEA 1VJ1A 4G24A 4K9QA 2FN8A 4RSGA 4XOIA 4Y0VA 4QSHA 4A91A 4NMHA 1NA5A 2J4CA 3PDUA 5FJJA 3IQZA 5IM4A 1UFRA 4XXHA 1D04A 1NX6A 1RJ9B 1X74A 1ZUIA 2BHSA 2HWXA 2J30A 2OKCA 4R8MA 2P9JA 2BFPA 1CFJA 2P77A 1U9CA 3RYHB 3TIGA 3TI9A 1L3IA 1J0CA 4M6WA 4IG9A 5KNBA 4RJ2A 2OILA 2E4VA 3QLUA 5IAOA 2HBZA 2X3FA 1X15A 2W2LD 2WKPA 3PQ5A 4K28A 3TQFA 4S1VA 3FPEA 5I9NA 4KIGA 3ANNA 5TEVA 5IBQA 5KQMA 2H6EA 1L5YA 5EGSA 1JIJA 1Q50A 4X1KB 2LW7A 4EJMA 4ZXFA 2PNJA 4IDNA 2ILTA 4J0EA 3MUOA 4MVJI 4K2AA 1YQ9A 5CA0A 4UUQA 2ZI3A 3JAWB 5KVAA 4P4LA 4RHTA 5IXYA 3CHYA 3G2IA 2IHTA 2Q27A 2Z6UA 2YJNA 2OFFA 1Z6TA 2B92A 2ZYGA 1KVUA 3I28A 4HMPA 1UIMA 3ZZUA 3ZBPA 3NZEA 1E6CA 3V8NA 1OBOA 1UC9A 1BH6A 4ISCA 4V03A 3WSVA 4EA6A 2D4HA 3K0AB 4UMVA 3T5GA 1I0ZA 3SC2A 1CV2A 5ITZA 1B16A 1NBOA 3ULKA 1JAYA 2CXSA 2WF8A 4P9NA 3U7JA 3Q2IA 3B2QA 5TSDA 5LQJA 2FFJA 2D1SA 1J5EB 2EGUA 3EZGA 2B83A 3T5AA 2VWPA 4Q7KA 3AVWA 1ONSA 1SKAA 3OWHA 2VAWA 4ZTBA 4PIVA 4DIUA 1YBHA 3CF6R 4FMBB 4QXMA 3X44A 3KJXA 1N3IA 1X42A 2PGXA 1ZNYA 4WEQA 4DM7A 4EMUA 5C31A 4BO2A 2QX7A 1IFXA 1UEIA 1Z5UA 3TMAA 4N7RA 3GMDA 5COQA 4DCGA 4PFQA 1KHTA 2EFYA 3V7WA 4F6LA 3JW8A 2V6FA 3FTFA 1PG0A 1XRJA 4ZVMA 4YCCA 3VKVA 1P45A 3BICA 1GPUA 2HIGA 3B1VA 5DFAA 5H83A 4WN9A 5ECYA 1T9KA 5CA1A 1P1JA 1EINA 3FYTA 1FTGA 3DBHB 3TXXA 1F9EA 1A8HA 2H52A 2V5AA 1CS0B 4EIWA 3ZJTA 2I6SA 4X91A 4YQEA 2EARA 2E21A 4WAUA 3IKMB 4E03A 4GYWA 1QHSA 4R54A 5AHRA 1QRDA 3CH5A 4I81A 1I4WA 1KYVA 1WR8A 2NAPA 1FXSA 1G6Q1 2G3YA 2ACVA 2GCEA 1E2IA 2PH7A 4S0ZA 5BO5A 2TSYB 2W2MA 5BV2P 3MBOA 5LQDA 1KPIA 1VMKA 5C3UA 5KKNB 3OY7A 4MZXA 3AW9A 2G17A 4BV9A 4GMHA 3COVA 2RJNA 1KMCA 2WPDD 3HKBB 4DV3B 2IXGA 2VAVA 5F2KA 3R0QA 5T3UA 2JIPA 5B6IA 1RKBA 4MJ7A 5BN4A 1MVLA 4LDPA 2XUAA 4LQDA 4C43A 5D00A 4LF8B 3I0MA 3LBYA 2D13A 4Z7JA 3MD0A 3H97A 1XQ6A 3ADPA 1GG2A 5HUQA 3KPWA 5IVIA 4ZFNA 5KC8A 3JZAA 2EP5A 4YMIA 1PDWA 4PR0A 4BVFA 5JH7F 2ODTX 2Q4BA 5BSWA 3G9ZA 3CH7A 2XBLA 3GP3A 3RM3A 3OEYA 2YXPX 3L1VA 1TJ3A 4LNUA 1QK5A 1C7QA 4GX1A 2X40A 5E6RB 3GMIA 4BQRA 4NNJA 3UFBA 4DV4B 4QM7A 1Z63A 3UMFA 3W77A 2VATA 3GUCA 1RWNA 3STWA 5KJFA 3LXMA 1I7SB 2N1BA 3GI1A 3FCXA 2FN7A 1VGRA 3GB9A 2CBGA 2ZRMA 3UIEA 4E5NA 2BGRA 3H0CA 1BDBA 3QMVA 3S81A 1JKIA 1JBQA 5DEIA 5AVQA 4W5OA 1GUFA 4X44A 3B9PA 1E9RA 1JJVA 1FK8A 1V3VA 2IUEA 3P26A 3JPYA 4CL8A 3ANTA 2P75A 8MHTA 4Y2QA 3LLUA 1YL5A 5BSGA 3PNSA 4AURA 2AKEA 1TYCA 3FRJA 3HU5A 4MWCA 4UHHA 5DJ5A 4OAQA 1QP7A 3P2KA 4Y2UA 1XXHA 1SVSA 3UWPA 3LZ6A 2J0VA 3Q3JB 4IR7A 3ZE0B 3CUSA 5ADVA 5K5EA 2AZMA 4HN4B 4RHYA 5K3BA 1JAZA 1OHHD 1MX1A 2NUBA 2OB2A 4HEQA 2KS6A 2HRZA 4Q02A 3JR7A 4LUCA 5E7IA 4ND5A 3UAWA 2QLMA 2C1ZA 3QPCA 2Z56A 3L4SO 5JCOC 3AYXB 4OGKA 1O7JA 3P20A 4XA8A 3G79A 5JNLA 5LP6A 2QZ9A 4JR1A 1L7VC 1Q11A 3SOZA 2VOEA 4AL4A 4UHDA 4RCYA 4Y2SA 4ZZ3A 4YMHA 3T61A 2JB9A 2XB9A 3HLTA 3NC1C 2NZWA 1EUCA 4J7UA 3FM9A 1KEWA 2I4MA 3GFGA 1VJ5A 3H19A 5SYNA 4BC0A 4BTLA 4CJXA 4EKGA 1TZ2A 1N32B 5JNVA 2D59A 2ZG6A 3L05A 4GNKA 4RD3A 2D2IA 2NGRA 3SC6A 1FYWA 3R4CA 4GQIA 3LA8A 4W9NC 1WMEA 2F9FA 3E5RA 5CYPA 3STYA 3BGIA 4BV8A 2OE2A 5BMVF 5HM8A 4ZIRB 1I7DA 4MIKA 3KTOA 3HI4A 4JMPA 3IVMA 1EWKA 1SUIA 3F7OA 3MGCA 4B6EA 2A92A 4PYNA 1R27A 3W5UA 3ZPXA 1MRNA 4HB2A 1Z88A 2XI4A 4CMAA 3W5IA 5GOZA 1NC3A 4ZU1X 4D8VA 1CC1S 4DFDA 1NM5C 1KJQA 3EIUA 3H1EA 1N5RA 4I50B 1U90A 3IP3A 3N58A 3NB0A 2D5IA 3L7LA 4C4XA 3U39A 3T4UA 2WWIA 4PLHA 4C3ZA 1TM3E 2H4XA 4DLRA 1QVAA 4HQKA 4CEHA 3ZCSA 1GLGA 4FOSA 4P4NA 4PLFA 3MCTA 4DNQA 1CG6A 1KI8A 4DA4A 3LWDA 5KJEA 1G19A 1R4ZA 1IZ0A 5DT9A 5AK3A 5REQA 2JZCA 3HO1A 2ZRCA 2ZIXB 3G02A 3H13A 3KOMA 4OFXA 5C8VA 3I9OA 1KJ8A 3GA0A 4IS3A 5HFJA 5HF9A 4MR8A 1IZ7A 1OJ7A 3FDJA 2IEYA 1XQXA 2XF2A 4FGSA 4ROTA 4D0SA 2DY1A 1AB6A 2ODNA 1ZRHA 4M9SA 3OZUA 2SKCA 3P19A 5FDFA 1JA9A 5JHHB 4QFBA 3EPLA 2PHZA 4A2WA 5B7PA 1Z13A 3IAM6 4BHTA 2D7JA 1LPSA 1ZGZA 3AIOA 4BKQA 3UGKA 2H4FA 3N76A 3Q7RA 2FZWA 4JB2A 1EP2B 2X0KA 5GONF 3B2NA 2IH5A 1E2DA 1JFFA 2ECQA 5FNVF 5TMEA 4DUGA 2Q46A 3U3OA 2Y9PB 4IHJF 3FI0A 5ARCA 2WPNA 1N6HA 4ZCPA 1YR1A 2XPCA 1EFPA 2G83A 4CQMD 3QNWA 2C9YA 2L69A 4FYMA 1OGJA 4OQPA 2H1SA 1EDOA 4FW9A 4HD8A 3V1TC 3DT9A 2HA3A 1I4OA 3J7AC 2VTEA 5GZ6A 4AG5A 1KDRA 3GLTA 4TROA 4JXZA 2ZWPA 3VNQA 4W5JA 1PU2A 1U81A 1LCIA 3D02A 1PHPA 5EA2A 4EFKA 3R9XA 2RHMA 3K73O 4TT3A 3KV1A 3SZUA 5M2QA 1SCNE 3EEQA 1V1MA 2VYQA 4POOA 2A58A 5GINE 1RI4A 3TZKA 5JWOA 4KXXA 1U8YA 1RAEA 2QJTA 1DWPA 2WHPA 1YZVA 2A35A 4MQEA 4MQLA 5DTRA 4JX8A 4RKFA 1RKVA 1WMSA 3IV7A 4J7XA 3MS4A 5DM60 4BVBA 2YVUA 1RACA 1JWAB 2FHPA 2FEKA 2Z8YM 3ZEAA 1G7TA 1F20A 1P4AA 2NVBA 1GZHB 4V02A 3ONFA 2I71A 2L0XA 3WG9A 5CB4B 4HMQA 1RZRD 2AE1A 1JNYA 4HZUA 2ZRKA 5D5QA 3F74A 2JJ1A 5LYJF 4ILKA 2QLFA 3PA6A 1BS1A 5J63A 4C89A 1QS0B 1QHGA 4KO4S 1HNNA 1Y8AA 4XKJA 3SVZA 2IXBA 2RGYA 2XD4A 3CVOA 4BO5A 1RYEA 4DGSA 5KOJA 5LD2C 3OF3A 3UOWA 3WGQA 2R7NA 2QVGA 1SGWA 1UT6A 1LK5A 2BEUA 4OKSA 4EYQA 2XDYA 3DL4A 3H9QA 5DZSA 3KXKA 1W35A 2AMVA 4F2DA 4R83A 1S7CA 5JFTA 2JIMA 1SOWA 5KYUB 2WVGA 1J97A 1IEWA 1OPXA 1Q7BA 1M8GA 2MR5A 3EVGA 1U7HA 3NCTA 3QKUA 2CFSA 3UMSA 5FUQA 1TB4A 2XNJA 3C97A 2DC1A 4CM4B 3I04M 1DFHA 2DRIA 4EI7A 1ZN9A 2YC2C 1C3LA 1SULA 2A0XA 2QI9C 1CT9A 1DIHA 4NPAA 1EXDA 5IBPA 2YMLA 3O8RA 2RGNC 1QG0A 1JAIA 5CD9A 3DMRA 1SVMA 4LI0A 3K0FA 1CF2O 1QLHA 3F71A 4MVYA 5CLGA 1RP1A 3DLAA 4RE6A 1NG9A 1U8CB 2OV3A 2P30A 1CRQA 2OLKA 4UMFA 5F77A 4XRGA 5JAPA 3FTNA 3FIUA 4M98A 1YSCA 3L3BA 2CXNA 4FYVA 1A5AB 3BL8A 3RU2A 5BSFA 3GQVA 3LL4A 3UMMA 4GLBA 2HU5A 3IDSA 4ZT7A 4WZZA 1HYEA 2DVMA 5BWLA 2I4RA 1EBUA 3COYA 4M60A 2WWYA 3MWDB 3OZFA 4NS1A 3FOEC 4EB3A 4Z9YA 4DM3A 2Q2WA 1ACLA 4P86A 3X1KA 2JLUA 3EC2A 3EVCA 3SZGA 3JQ8B 4UZEA 4YRAA 4OQZA 4LGVA 1Z6YA 2PUHA 2V9ZA 2EIHA 4MX8A 1T1SA 2XNCA 2QMHA 3ELWA 4FD3A 4RGBA 4AW9A 1W85B 3L4JA 1AV7A 3U3RA 3GXBA 4AUNA 1ZMBA 3TE7A 4EMSA 1IWOA 1OBHA 5HHTA 4UDYX 3WK5A 4CKBA 1GITA 3KOZA 1RLUA 1L7EA 1QIFA 4FS3A 1BDMA 1J9EA 1RBQA 3BMCB 4P6VF 1SBTA 3AXTA 3JS5A 2VQDA 2VLBA 4RKEA 2ZTUA 2JFNA 3F1KA 2D3TA 4FN5A 1FRNA 1ZHOA 1YFJA 3OKPA 1QOPB 2G7MC 3C5CA 3Q1LA 5DCYA 5TQVA 4HAZA 4NZNA 1E6KA 1UAYA 1JEYA 5DCLA 3HBNA 4RHFA 2ZXEA 2BDTA 2CXHA 3F96A 4RK5A 1FUKA 2HMYB 5I4IA 2AVNA 1FTYA 3SX0A 4PTYA 3WYNA 1K27A 1ZD2P 2OAP1 4ID3A 3K0CC 3FX2A 3L40A 5EEHA 3M5CA 5FNVB 1BTOA 3DWIA 4Q0MA 1AC5A 1RJEA 4ZOLA 2Q6OA 4KQIA 1THGA 1C9KA 1CLUA 2WNIA 3EDYA 1UBRS 2HRBA 3A3YA 3OLQA 3OPYA 4LWPA 4TV9A 5EMJA 1FUIA 3UCXA 3FDZA 2F1RA 1IBMB 2UVDA 3MZ0A 4UM7A 4JL6A 1BFUA 1VCHA 4WK2B 2GEUA 2H07A 4LHYA 2WDZA 3M3DA 5ECWA 3T0IA 5HDBB 2QTLA 3KZKA 4NZYA 2WG2A 1Q6ZA 1XPJA 2IXEA 1X7DA 5EMKA 5B36A 4MB0A 2ZVJA 1E1DA 1RPNA 2VEOA 4ND2A 1T2NA 4Q24A 1RXCA 4HS9A 4ZPXA 3EXIA 5DNYB 1ETUA 4BX0A 4B3TB 4KQFA 2B7BA 3MJEA 2GHRA 2Q62A 3KFLA 4E46A 1S5PA 1S96A 2HLDD 1SCAA 2HV9A 1YUMA 2CHQA 2FWMX 1QKJA 1ZK2A 2XVXA 5EHGA 2KLBA 2L18A 3QXXA 4FWBA 2VN8A 3P94A 3P32A 2G0AA 1MENA 1V71A 2HJWA 1OWOA 2FSHA 2REQA 1ZQ9A 3KYJB 4J2HA 4QQ8A 2I34A 4IHAA 4U0JA 1FPMA 4MP3A 5JD6A 2EC5A 2F43B 1X0XA 4CT0A 4CIYA 3N7UA 2EF1A 4IV5A 1GDHA 1F12A 2I65A 3OKCA 3T7JA 3UATA 3HDTA 5LOVF 1BJRE 1FXUA 2JI8A 4NIMA 1GU7A 2AFIB 2FVXA 2Z9CA 2WV7A 3W6PA 1D2RA 3RU9A 3H3JA 4DG8A 5JADA 4GZ3A 1C8BA 1RS0A 1CR4A 2Q3MA 5EZYF 5HQJA 3E1GA 3IIMA 4EVQA 3UUWA 5DSZA 1QC5A 1U9IC 4Z8XA 4WHMA 5B6PA 1QZZA 2ZU6A 1RJGA 4X85A 3RUEA 3W8DA 1KMMA 4BWYA 4M88A 2Z58A 2J3QA 2VJCA 3PIIA 1ENPA 2WWXA 2ZBRA 2VNAA 3ELBA 3ETNA 1I2ZA 1A9SA 2Q45A 4S1TA 3VZQA 3T38A 4B6RA 3EPHA 1G18A 3TLCA 3M1YA 3EGXA 4LDQA 1T0JB 5IDVA 4FMCF 3NI2A 2DMRA 3H16A 1L5ZA 2QE6A 1EP9A 3SEZA 3UMVA 3ASZA 3DOHA 1ODCA 4DVGA 3DDWA 4WLFA 2B9VA 3IC5A 3LDUA 4R2JA 1SC9A 4AJ4A 3JQCA 4FJ2A 1QYIA 2ZTMA 4P31A 1Z4QA 1R3DA 2BHRA 4JLSA 3A9VA 1T8PA 2WVJA 2K5UA 4L74A 1B93A 2VTVA 3LLVA 2AHOA 3QEOA 4RA9A 3CRNA 3AU8A 3CRZA 1QRTA 1LTHR 1Q0SA 3Q7QA 4P4TA 3OU6A 1E1KA 2W2QA 3NWOA 4YTEA 4FBLA 2I2CA 5JXIA 2PD6A 4XOUA 4N48A 1O2DA 2G70A 3AJ8A 3CX4A 2D74A 1U9IA 4B17A 4Z9XA 4DIDA 3NXKA 1XDGA 4K05A 3OFSA 3E8MA 5I9LA 1W25A 4AN0A 5TQ0A 3THWB 1KZ6A 2IPAB 4FCCA 3M33A 3TCNA 4WCFB 4KGDA 5JBIA 3CZQA 2BVNA 4ZHQB 2DZDA 2DCUA 1W52X 5JCJD 5LBIA 4A36A 1AUPA 4INZA 2WSSD 1U3WA 1JLKA 2AXPA 3WGGA 1QCYA 2AFRA 3R0JA 1RQPA 4WZBA 3I5UA 1HLDA 1V41E 4B80A 1B8OA 4PPYA 4ONEA 3GN2A 4AZ3B 5D85A 4ZI7B 1QK3A 2PDAA 2QV7A 3PFBA 1YD7A 4BNYA 4DHWA 2O6LA 1IM5A 2GJSA 3KVVA 4L0MA 3B70A 4M1YA 4MICA 3ZK9A 3EVTA 2WINI 4IJMA 4Z2YA 3ZCUA 2XYQA 4KJXA 3ILYA 1SWVA 3QPAA 1GSHA 4TKLA 4M2LA 1FQOA 5AQEA 2D62A 2PJUA 3SC3A 2ERCA 5JNUA 3B5IA 2IV2X 2PR7A 4B0PA 4MULA 4E22A 2GGSA 3LU1A 5IMSA 1DUIA 3R23A 2QM3A 2DWQA 5CT8A 1PGNA 2R1ZA 2WABA 4GOOD 4CR8A 5H8WA 5IPFA 4G09A 4HNRA 3X1XA 5JTUA 4H7EA 1L0BA 2YZ2A 4GBED 1Z0DA 4C4OA 1F2UA 2X6TA 2RHRA 4Z4QA 3ECCA 4GLLA 4HVLA 4XYBA 1ZOIA 2W70A 1OX5A 4E15A 5ALVA 3THYA 1EA7A 4P3NA 4GHWA 2WG1A 1D2AA 1VPLA 1W6UA 1XDBA 3HGMA 3V4ZA 4HNQA 2MT9A 1E1CB 3Q40A 5DHAA 3GLGB 3IPCA 4JLVA 1QHHB 1U3UA 2BBOA 3RABA 1OT3A 3EFOB 3HBLA 2BGMA 3T12A 4EK9A 3L8GA 5FT9A 3L7CA 1QQBA 5K4HA 2DT5A 2GXSA 1J7JA 4NHOA 1LX7A 3B9QA 5KQPA 2FPKA 2Q1TA 3WLMA 1U2TA 4FGKA 1EXNA 5IXSA 3R7WA 3LQRA 4DE5A 3EGDA 2DWPA 3NORA 3ZDBA 4I36A 2E6KA 2XEDA 1I1NA 1XRSB 4LVUA 2OTCA 4YR9A 1E4EB 4WWHA 2VQFB 3ZZNA 3OUZA 1E3IA 1KJ9A 1NOJA 2H8GA 1UP6A 4NDAA 4TL9A 3TLYA 4KODA 5KYYA 1N2EA 2LD4A 2VJKA 4ZREA 1D2CA 1PS9A 1LJ8A 1U1FA 1KFKB 3NP7A 3R3ZA 4ML3A 2FN3A 3T7KA 5EJ6A 1A9XA 3R24A 1A1SA 3Q3HA 3U4CA 1R4MA 3T94A 3KB8A 2NG1A 3G49A 3QX9A 1TT5B 3GBSA 5KOHA 1ZUNB 1FQWA 2DPYA 1IZ8A 3QKRA 4J3NA 1IJFA 3NPMA 3FYHA 1N2CE 2FOLA 2ODAA 2ZUTA 1C4WA 3SDSA 4EI2A 4YMUA 5BXYA 3AL0C 3PEVA 3V9AA 4AECA 5BV1A 1S2IA 4G0ZA 3FFBA 3UAGA 4W82A 1EDDA 3LPLA 4MQBA 3SQOA 3NBUA 4JYPA 4HDKB 3L7AA 1E79A 4TYPA 2AEMA 4ZVKA 3VPFA 4B84A 4YAIA 1X3LA 1AURA 1Z6ZA 3C14C 4O3FA 3WLIA 4RHUA 1V45E 1M8PA 1OOEA 5DHRA 3WAGA 4PAWA 4D9CA 5JWRA 1DC5A 2D5CA 1YZ3A 4ADSG 2CJWA 4RH0A 3DL0A 5IARA 2P4EA 2B4TO 3GPIA 3C85A 3AZPA 4B5KA 2OD7A 2A9QA 3I32A 1JN0A 4AG3A 1BROA 1GDDA 4GXQA 3L04A 3MOSA 4PG7A 2QVCA 1Z0JA 3AERA 3WAKA 3MA0A 4TTSA 2WTEA 5F3DA 4AJNA 4B9AA 2HYIC 2FSVC 1N1EA 2OZLB 3E22A 5KYVA 1XN4A 4DA6A 2G76A 3DWEX 4KSYA 4GL4A 4ZOBA 3BE5A 4EY5A 3IILA 3BFKA 1VZ3A 2C42A 3D7RA 4CE6A 2YWDA 3U7IA 4GE0A 5TJ9A 1N5OX 3B52X 4X1YB 1KETA 1T9AA 2WICA 3M0EA 5BQ3A 1W88A 3GCZA 1X3SA 4BUCA 1BW9B 2LIVA 4UVGA 2QL7A 3ZGZA 5L4SA 4CKCA 4KLNA 2JFVA 2X4DA 1DFGA 4NZOA 5KYKA 4JT8A 2W4MA 5TMPA 2GCOA 5IUJC 3KZNA 3GLVA 2B8JA 1ANKA 1UJ2A 2BUBA 3RJ5A 2P4HX 3WWOA 1XHFA 1ATZA 5LMUB 3DDUA 4BFWA 4PG6A 4KZPA 1GFIA 3NHWA 1ADCA 1F5NA 3WJ1A 4A82A 4RZXA 3AR9A 3ZY5A 4COOA 1M2OA 2FPUA 3WIDA 4Y9UA 2ZT5A 4RF2A 1TRHA 3EZ2A 5TQ2A 4KH0A 3W9UA 5I9MA 1HY3A 1NJ5A 4Y6QA 5DDIP 3OLZA 4GZLA 3W1EA 1JFVA 1Z5ZA 3AVTA 5D1NA 2WP8J 4DN6A 1DAGA 2PX0A 3C3KA 1CUCA 4I6GA 1NXXA 4LF7B 3QKSA 2YJTD 1HO3A 1H22A 1EFRD 4HPXB 1FNDA 5C7OO 5EP2A 1R50A 2P27A 3KU1A 5ECDA 4W7IA 1L8OA 1XRRA 2AG1A 2V7QD 3W4JA 3LMKA 4ZCSA 2IU6A 4XWOA 5IVKA 1Z6GA 3DAFA 1W0KA 2PL5A 3I30X 3CX6A 2OCBA 4I66A 4D2IA 2EJCA 4XD7A 5F23A 4II3A 1TYZA 3ELUA 1U5CA 1IDN1 1RPTA 2KPOA 3R5TA 1W4ZA 1OXTA 4G97A 4D99A 4AMBA 2I3ZA 2PIDA 2CFIA 1F2TA 1WV1A 2JK1A 4Z86A 1Z39A 3UN1A 1LBEA 1R4NB 2NO4A 4LVCA 1PWXA 1BHJA 1ZN8A 3B9RA 2WNSA 4F84A 1Y7PA 2BEVA 4Q3LA 2ZE6A 1RYMA 1Y4UA 2BJVA 3AEYA 4AZ0A 1RXVA 1SUEA 1RLJA 3U31A 4P92A 2Q1WA 4REMA 3H9JA 2W37A 4ZYWA 1U2PA 4FU0A 4OIFA 3N3BC 4H59A 4KR9A 3O9VA 2HSGA 1M1YB 2FZVA 4ZOCA 4MUKA 1KIAA 4D44A 2FQ1A 1EK5A 1MPTA 1T8SA 5B4UA 3OECA 3I4CA 3ENVA 3W9SA 2PMBA 3EDCA 3RT7A 4E2WA 1K3TA 4X71A 3ZDCA 1UPFA 1CJKC 5L53A 3Q9SA 1TA4A 2F7SA 2NO9A 4CIAA 1KPGA 3COPA 2DUWA 5JXHA 5LLTA 4FOOA 1A9QA 2FMFA 2WJ6A 1GEEA 3E3AA 1DV1A 3EWIA 4ZP1A 1J2TA 4N5NA 1XTVA 4X24A 3ZV5A 2AN5A 4RLFA 5U9CA 2GAAA 1RWPA 1GYPA 2XUGA 3DKRA 1M1XB 4LOIA 4MUYA 4WY2A 4XWGA 2QX4A 3U37A 4CU5A 4KXUA 3OZVA 4MRPA 1EA5A 4BPBA 5CCXA 1DTEA 3BA6A 2AT1A 1P7YA 2HQBA 3GIDA 1Y1PA 4FBGA 4F4JA 2WKRA 1GUDA 3ROEA 3EARA 3HBJA 1X86B 4M37A 3KQUA 1AKNA 3O5AA 3LSTA 1EFVB 1JJFA 4JBXA 1Q21A 3RSFA 4I8DA 5IFLA 2WF7A 6Q21A 4MHTA 4E08A 3V1MA 4A6EA 2VHWA 2X7HA 4NOMA 1GPWB 1MV8A 2LDBA 1N5DA 3W06A 4GI5A 1FQKA 3ED5A 3PUZA 4XW2A 5DK4A 2FW9A 2PVCA 2QG9A 1EAMA 3NONA 3LCMA 1ZA1A 2QTMA 2R62A 2IOYA 2WUVA 3JALA 1NPDA 4S1PA 1QQTA 4TXMA 4MCIA 4HNSA 4JR0A 2HEGA 3GD5A 2JLSA 3ACBA 3KLOA 2HDWA 3LYLA 3NU1A 3QTTA 1E61A 1YQUA 2I03A 3PXCX 4ND6A 5D7BA 3SZLA 2RD2A 1ZG3A 1VBKA 2F1KA 4IIFA 3N0WA 4ZAWA 2IV7A 2GWHA 4UU8A 2TECE 2I4NA 2GHTA 3HB1A 5F9HA 4Y9SA 3NBMA 4WOKA 1TU4A 3ILXA 4QO7A 1R9GA 1G5TA 2QMOA 1RI3A 3OHMA 4PONA 4YROA 3A4NA 3MYYA 2E6UX 3KO8A 5KMGA 1XA3A 3Q0TA 1V5FA 2QM0A 3FJYA 1USIA 2JVKA 3PP8A 4RMIA 2DFDA 2A2ZA 1DC6A 1RLMA 2H1WA 3EGOA 4JB3A 5LPNA 3NC0C 1E60A 3AQIA 1Q1EA 1YR7A 2Z3ZA 1TNDA 5U1PA 3ZLTA 2R6FA 3HUFA 1LBHA 5JI3E 3RAEC 5AW6A 1XPUA 3P9ZA 4LJSA 4GYKA 2AMJA 1MDFA 1RZUA 3I53A 5FV4A 1K4YA 2O8FA 4BVJA 3AF0A 3QYAA 2FSIA 4BEWA 3KB1A 3BILA 2JIZD 3T3OA 3T7TA 1SU4A 4FNOA 2JCVA 3HJTA 3CN7A 4BBAA 4KZKA 1Z4JA 3QIVA 1JZTA 2BRUA 2D0PB 1NJGA 1GFWA 4KVGA 4OJQA 4DQDA 1PEYA 4OQEA 3T7EA 2BTEA 3CGGA 1ONPA 1NM5A 3NNNA 2VO1A 4QQNA 1UMDB 2NZ8A 4X7PA 5AM5A 3A9CA 2AA3A 3CVVA 1FX0A 1QZ3A 4F4CA 2PRKA 1M5UA 4KMRA 2Q3LA 1R37A 2A5LA 4KPUA 1E3EA 4GC9A 4FUTA 2ZZMA 2NSLA 4BP8A 3CLTD 3FH0A 1DJOA 2DQYA 4N6OA 1LRKA 4B76A 1LWOA 3LUCA 2GEKA 2R7LA 5F33A 1INLA 1NYTA 4GPIB 3UGQA 4YASA 2NWQA 3QYPA 4EHAA 1V95A 1U04A 1N77A 2W2LA 1JG7A 2CFOA 3A9RA 4EGJA 4KTTE 1PAUA 3I6IA 4MR9A 2ZDHA 4FX2A 3UTCA 1P31A 4F5WA 4J0KA 5FTMA 1G9SA 1OZAA 5ALOA 5C1OA 4U0KA 4CMBA 4L73A 1L4MA 2FETA 2IE8A 1FBTA 3LUBA 4WECA 2Q5OA 2L42A 2FRXA 4OUDB 3WBJA 1YTUA 1EWRA 4Y6RA 3NH9A 2FZLA 2IZZA 3CMCO 1I2CA 1V8ZA 1EDEA 2B99A 2AZDA 2IZ5A 5DHTA 2JBHA 4HGOA 1NVMB 2ZWMA 4RM3A 1LDMA 5JLJA 2DBYA 3Q2KA 5LZ7A 3QE3A 2BISA 1MLDA 2GZSA 4CMEC 4KQJA 5C7LO 2VJOA 5FBVB 4YRCA 1X8KA 3BWVA 3COWA 3E7WA 3MJHA 4D97A 5AM3A 3OT1B 3FWYA 1Z08A 4CKWB 1GA1A 1ZD9A 3X2EA 4A26A 1EIWA 1W46A 2TRSB 5KJCA 5ALPA 2EW2A 5LZ8A 2Q1SA 2XGMA 4L4XA 1H3EA 3AI7A 4N1AA 4B8WA 2CXUA 5EJIA 2PZEA 5CGZA 1G5QA 2XKJE 5JOQA 1KSHA 3L1IA 4DM4A 1Z5WA 5JIBA 2FCAA 2H2HA 2J4DA 1GG8A 2PA0A 1P7PA 2C7OA 4M0CA 2ZB7A 4B8ZA 3FAKA 2B25A 4HFMA 4KWIA 4HLDA 1NRJB 3ZJVA 3T5BA 1QVWA 3NYWA 4C6TA 4DQLA 3WK6A 4K6OA 4PRLA 4FONA 5I4BA 3FUWA 5EIBC 3VSCA 2DFVA 1KOLA 2PWPA 4NCNA 4P35A 4DR1B 4DXHA 1PNTA 3GNQA 2GLTA 4DT1B 4YA6A 4GICA 4BWGA 2W98A 1XKTA 3BHJA 2QD2A 4YO8A 3WDKA 5JJCA 2UYCA 1E3LA 3FNBA 4WESA 3IXLA 2SICE 4D57A 5LA6A 1GRVA 1G4UR 2H0RA 3BPSA 4BNZA 4JT9A 5DNUA 5EAIA 2A5YB 4YFYA 2P8JA 4OO3A 1FFXB 3IQDB 3NOQA 4H7JA 1L5QA 4HAUA 4Y7CA 3SQLA 4AK9A 3RR2A 2WTXA 2QTTA 3TW4A 2XCSB 1JT9A 1UQUA 1ZI6A 3M6XA 1IY0A 4LXHA 1Z2EA 1CEEA 3ROQA 4AT1A 2FPLA 4YPOA 3U6KA 4LDAA 3DBLB 3HHEA 3GMSA 1SQ6A 4M9UA 2YVQA 1YIOA 5CDFE 4DCMA 5B7NA 1XTJA 2BEWA 1D03A 1XJWA 1GKKA 1LV7A 4CMHA 1LFAA 3K6RA 1WHSB 2AB0A 2GCIA 2QMEA 1E63A 3QE2A 1PNVA 5BSHA 4O59O 1KZ4A 4G9EA 1WB6A 1N8NA 1GTMA 1PJZA 2IDZA 1NBWB 1UR5A 2QN7A 2HNBA 4COKA 3VFDA 4ESOA 3LJKA 2PZMA 2ZRHA 3ENQA 2XA9A 4QG7A 2IZOA 4F97A 1YOBA 3HKCA 2D0DA 4TV9F 3V1YA 4XJTA 4ARIA 3TEMA 3ANLA 4AB1A 4K81B 3A06A 5F64A 3KT6A 3QFFA 3QFSA 2H7YA 1J2RA 3LBAA 3T5CA 3DOIA 4WA7A 3KKNA 4QHYA 1Q1BA 1NVEA 2YWGA 5AKXA 3RTGA 2H1IA 4A1FA 4IHKA 3HXOA 1V8DA 5CFLA 5FBRB 4XDYA 2OBLA 1VJRA 4JHLA 2QAGA 1GZ5A 1G7SA 4JIMA 3L01A 3CPEA 5KYXA 1YZGA 2OFOA 2HY7A 3H5IA 3VNAA 4XR9A 5JDCC 4HK4A 4PLVA 2Z09A 3KKPA 2BOVA 5JVDF 2B9EA 1TD1A 2RGNA 3DW1X 4POAA 4J4BA 1K89A 3BYZA 5DGHA 1BQ3A 5LQKA 4LX8A 1DU4A 1TJ4A 1E7RA 3KWMA 5AW9A 3EDOA 4JITA 1MRZA 3D6JA 3WB1A 3O1JC 5ALYA 1OLSA 5KDLA 4MRAA 3DNFA 2E18A 5KB3A 3ZOKA 2E2WA 2AI1A 1U0HC 3HCCA 1PQYA 4U2BA 2ERXA 1IHDA 2I1WA 3AHJA 1OYWA 2IIQA 1MORA 3VM6A 1MO2A 1HR0B 2PV0A 1BWQA 1N4AA 2BFFB 2JIDA 3CLSD 3DKPA 3K92A 1OZFA 5AHXA 2XEXA 3A1DA 3AR8A 3TPCA 1PW7A 3THSA 4G0OA 4NCJA 1T36A 2W2PA 5BN1A 4B3GA 3ZS9A 2EKZA 2EZTA 4QU0A 2PPVA 3LY5A 4TYYA 3KEGA 2WUFA 4EYEA 4URUR 1UADA 1OXKB 2VAMA 3GJ6A 1E1NA 3I12A 3ROKA 3UJHA 1K2VN 2PKQO 3NO4A 3OOHA 2EJVA 4DXAA 1EVYA 2GPAA 2NPFA 1W75A 4HR7A 4WK4B 4MYRA 2JJ8A 2CDCA 3CPJB 3N5KA 5K6AC 3LUDA 2C3UA 3HVJA 5ENVA 4J16A 3DTVA 4DMHA 4MWEA 4BLPA 4QZVA 3U40A 3KR9A 1WXFA 3WO1A 1YDEA 1LRJA 3HKEA 4RZIA 3I5MA 4UCFA 1ULUA 1WXDA 1DQSA 5AICA 5ALXA 3HEMA 1U11A 4L4SA 1GA6A 4IDEA 3RIMA 1YZLA 3FETA 2C98A 5CDFA 5MGNA 3TFQA 2PRJA 2VHYA 3QWIA 1F8YA 1CS0A 3WYFA 1KH3A 2X13A 1XFAA 3KDAA 4IICA 3JAKA 2JGFA 4CFYA 5FV7A 1OYYA 3EG9B 3Q98A 4FI3F 5KYWA 1KQPA 2P9ZA 4HEA6 5G2OA 5FWNA 4ABYA 1MIOB 2FSPA 2BFWA 2X23A 3ZY4A 1ICEA 4JKIA 1QIGA 3FWKA 4BJ5A 1X1BA 3H5LA 3MW8A 1CZKA 2R8EA 3UJCA 3WLEA 4MW4A 1VSVA 3L7IA 4X63A 4FC6A 4LRYA 4BNDA 3FOZA 2BT4A 5EJ9A 1Z4MA 1HL3A 2QUZA 3GDGA 3I2KA 4S3MA 1BU8A 4O63O 4Q7EA 5G1NA 4TXLA 5BRNA 3AKDA 5JJ5A 1Z2NX 4MR7A 3VYUB 4H6WA 2HNAA 3ADDA 2BHTA 1JKFA 1MNQA 4ARAA 1T9BA 3OOSA 1SVIA 2C5SA 1E5DA 2VK1A 2Q8QA 4NEQA 2E4XA 2PTGA 3EE6A 3KTDA 4YK7A 5K0FA 3HV0A 5ALLA 1DEKA 1ZD4A 4X94A 5BR8B 2F4VB 1RBMA 1FS4A 2W58A 4DMFA 5IYZF 4OSOA 3SZOA 3PHHA 2EDCA 4QU5A 4EJ0A 4BO1A 4O8ZA 4LV6A 2RKBA 5A06A 5I3ZA 3KQNA 4FJ0A 1VHLA 4H0FA 1I7PA 1JG2A 1QF9A 1S2LA 2OCGA 3ZYCA 4XVHA 3MLBA 3GZJA 5BT9A 3IQGX 4QJBA 4EFNA 2D8MA 1GY8A 3GJ0A 4KAXA 2F1HA 2G7ZA 2Z2ZA 2O50A 3KE9A 5B37A 4HFJA 4BWFB 3WTBA 5H4HA 4ZAXA 4CPDA 1U28A 4QJ4A 2CK3A 3PKIA 2YV2A 3HYRA 3PD0A 5G1OA 3OE7A 3WRYA 4CV0A 3FOCA 2OBXA 3V4OA 2INGX 4G89A 5CPFA 4BMYA 3QU5A 1JIQA 2VBIA 4NBNA 4EB0A 1FP1D 2V1XA 2GD0A 5WRFA 1VKOA 3CXUA 1LLFA 5EMHA 4IKOA 3ZE8A 5IC4A 2I3GA 5AVZA 1BNCA 2H4WA 3DDZX 5KNCH 3FHOA 4IG4A 5FPPA 1TGVA 2QS9A 2PX4A 2OV1A 2WYVA 3BTVA 3GG2A 3MTAA 1YS6A 4BZQA 4EO4A 1VDMA 3D4BA 3HN2A 3JYHA 2IYUA 4IH4A 4R3NA 5LU9A 1ETHA 1P91A 4D9MA 5FBLB 1QUFA 3AHDA 3GUHA 2LUOA 1QTQA 4QUDA 5BUSA 5TC4A 2B7CA 1E9FA 4NHEA 5MN6A 4QOSA 4GPAA 5TGTA 2HI0A 4S24A 1A5ZA 1L8AA 2IPMA 4TYQA 4YAWA 3IOYA 1XCOA 3QI7A 4DR7B 1Y89A 4EW2A 5DM4A 3TTUA 3Q6NA 2AYYA 3IDQA 4G65A 1ISRA 5IN4A 4J9VA 5HQTA 1A2BA 2LXNA 5HF8A 4S1WA 1YJBA 5JE8A 4FR5A 3WYCA 1QYVA 1UXOA 1VECA 3KKQA 3L7DA 1PG2A 3PA8A 1XTBA 5DYIA 2RK3A 3QVVA 4RLHA 2G8LA 4IKPA 1N5MA 1VBFA 1DDGA 2REBA 1XD9A 3MXTA 4QDTA 3QLJA 3WGMA 3ZVLA 3Q8KA 1UM8A 3D3JA 4UUPA 5E1DA 1BD4A 5LQAA 2FH5B 4TT8A 2R1TA 3I76A 4KXLA 3L93A 3MTQA 1KORA 4I3GA 5TT1A 1T5DX 2NZUG 3WNVA 3OOEA 4Q48A 5DM1A 1CERA 1IHOA 3KHTA 1C9MA 4X0EA 4AIRA 4E2ZA 5KAPA 4KAFA 3EIOA 3FUCA 5BUZA 1V4BA 2AG6A 2DH5A 4XJSA 1O1YA 2ECFA 2Q0XA 2V5UA 1AUXA 1Y33E 1Y3AA 1GAWA 1OLXA 1OWLA 1CQPA 5CG2A 3P5BA 4DLPA 4AP9A 3IFSA 2DECA 2HADA 1MB0A 1M7GA 1RMTA 3QVTA 3IKJA 3VQTA 5KPJA 4M9XA 2DJIA 3D7SA 1A4IA 4BAZA 2BTQB 3GRPA 3QP9A 4NK4A 4QELA 4WL0A 2C9MA 4FCWA 1A04A 4R84A 1CX9B 1MV5A 4QTUB 1X9HA 1EK1A 5CW2A 4FB4A 5AVYA 3WL4A 5A2GA 3M1LA 1E0KA 2CLCX 4R9NA 4HX9A 1MABA 1KP9A 1JDZA 1OWMA 2JHCA 4IGEA 4XX0A 4KDEA 3IERA 2LP4Y 3JSAA 3N0VA 4CG0A 1HDCA 1U6IA 3TNYA 1B0AA 3EK2A 4PXSA 4MITA 2B4YA 3SJUA 3PC6A 5T4HA 5GV8A 1BDHA 1X19A 4BYMA 4RVNA 1J39A 5AW8A 4PLYA 4PHFA 1DAEA 1XLTA 5CCEA 2EL7A 1MJFA 3PXUA 1ZGCA 1N33B 2XYRA 4V39A 3AETA 4ZZ1A 1RC8A 4F2HA 5JQGA 4LY0A 3T8YA 4XDHA 2H00A 5E7MA 1AQUA 3TX2A 3ANSA 2IHYA 1SG6A 4TYMA 3QH4A 4ANFA 4C05A 2VYND 3KOXA 3WWDA 5CB6A 3S0JA 4BLUA 1P1RA 3D3NA 4FYPA 1R6TA 2ZTSA 4BCBA 2J9YB 1B4DA 4KQCA 5FKJA 5JG7A 1T9ZA 4O1HA 3WHLA 3O74A 4CM8A 3GEBA 3O8OB 5LN1A 4PAMA 4R1NA 5DI3A 1BYUA 4OSPA 1M0SA 1X13A 1MAAA 4CCSA 1UIRA 3ZI7A 3C5WP 4JN6B 2H2FA 4NBUA 3V8VA 2WWTA 1K6JA 3IT1A 3W3AD 3P2MA 4ZQCB 1TM5E 1P4GA 3I2GA 3KETA 3W90A 2QN1A 3HA2A 1Z7BA 1JR3D 2RGEA 2O8DA 4F3RA 1EM8B 2XX3A 3VYVA 1T4CB 1QKKA 4F4HA 5JAHA 2X0IA 4OHOA 3MMZA 3JWHA 4QUJA 1Q12A 1LTQA 4CUKA 2IV3A 1T2VA 5EUQB 3G89A 4W5NA 5KTMA 4QT4A 1CP2A 2G71A 2BAGA 1KR5A 1VPVA 2J6CA 1DTWA 2Q6KA 5TVKA 2M32A 3RFVA 2ONCA 5F7ZA 4UM5A 3UKDA 2X6RA 8OHMA 5L45A 5JS1A 3KWLA 3O1LA 1CNMA 4XM2A 1AO3A 1ONOA 4KLRA 2O2HA 4R2XA 5BSRA 3VPCA 1KDPA 1QZXA 4DCPA 2Y1FA 2AG5A 1QRUA 4HRXA 3QVGA 3KDPA 2J9RA 2IPXA 5ALKA 1VE6A 3ZQUA 1T9GR 1W96A 3AGQA 3HWRA 5HE8A 5FBWB 4EEXA 3AEUA 3ZWNA 1N5IA 3O8DA 3Q9UA 4ZVNA 2ZRLA 2RI6A 3AI3A 5EPOA 3O4VA 1NL3A 2OHXA 4QUKA 2G9QA 5IAGA 5ITWA 1Z06A 5HQ3A 3QXHA 4ZVRA 3RH0A 1Y7TA 4HP8A 3W2FA 2VQ3A 5CCDA 4QARA 3VA7A 2GR9A 4KX3A 3O8NA 4QLBA 3DFKA 4FFBB 1DRUA 2JKVA 2BEUB 4OG2A 4CDMA 1YQTA 4F5DA 1LBIA 3WGJA 1V6SA 4I4NA 2JGNA 4BFXA 5LMCA 1EP3B 3JRNA 3NG1A 1NG1A 3RS4A 4I8XA 5JAOA 3R6WA 1W5EA 3I9LA 4FD2A 1Q3KA 1DKQA 1YIDA 4RFSB 2OP0A 3V8MA 3RYCA 3K9FC 1VIMA 3BCUA 2XCUA 1LC0A 3BJEA 4DSZA 4LF5B 4R0NA 6GPBA 4RPIA 4RUKA 1OXUA 8AT1A 1H9AA 3K2EA 1K68A 1YJCA 4JU8A 3IJPA 3KEMA 2VXCA 1OZHA 1J9GA 1UZNA 4WD3A 2PRYA 3RUDA 4YV0A 3EVFA 1UKBA 1FDOA 2R00A 3D6HA 4Z3DA 1NI4B 3GFBA 3HB0A 4RACA 5CFRA 2WV9A 4HEJA 1YZYA 3FIJA 4HDNB 1G3MA 1YFZA 2RB5A 3E4DA 5SZIA 1E0JA 3KM0A 2Q41A 1VPTA 4JVLA 3PFHA 3L43A 2M6LA 4C29A 5G0WA 1R8YA 2DERA 4MVJF 1SCKA 4FLEA 1OH5A 2XNKA 2VH2A 2ZRFA 4M4SA 4GAEA 4P5PA 5CNIA 4E5PA 4LTMA 1FTQA 4MW6A 1I5RA 1PEDA 3VV3A 1J2YA 3OCXA 4WZAE 3LNTA 4IIGA 1K92A 4O6VA 2Z3WA 2JAHA 2XQIA 3IJRA 5DGIA 1S3GA 1P44A 1N0UA 2PZBA 5C8XA 2AOWA 2WSSA 4G1FA 1FJ2A 2IXAA 4CETA 5MFPA 3KDSE 1IHXA 2W93A 5EN4A 5JNRA 3I3OA 2AZXA 4A6PA 4L9WA 3BXGA 1GDTA 1ZJWA 4C20A 4WKCA 2ZJZA 5DNEA 4IH1A 2HC9A 2PA3A 3C6QA 1B23P 2B7LA 3VPDA 4IUDS 1WUKS 4EF4A 2J4FA 1TO6A 5FYDA 1YF3A 5D7NA 1AKQA 4MVJM 2NUAA 4M89A 4X6UA 3TIXB 4L0CA 2UV8A 1Y1SA 1TADA 2H57A 5TS2A 1DRWA 1TRKA 2X14A 1ORRA 1TTPB 1BX1A 4GQAA 1ECGA 5TGDA 1VXRA 2HLDA 1O87A 5DP2A 3SEFA 3PQ2A 1VFNA 3MB8A 4JS0A 4IOLA 2QSUA 3DFMA 4TVSA 3PNBA 5I48A 1QM5A 3OQHA 4FZ3A 3CRW1 1GPKA 3HB5X 3OFVA 1QIKA 5IWAB 3OVMA 3K9LA 3OFND 5HEKA 1QYWA 1I2MA 4DDTA 2YS7A 2UXDB 1OTXA 2PZ8A 4TQAA 2YICA 5KVQA 4YT2A 5LLDA 4N01A 2FG5A 1G8SA 1T4MA 1VSBA 5A71A 4CKYA 1M6VB 3FMFA 1AS3A 1F6DA 4Q4AA 1ML3A 3ZZ0A 5AVRA 1P0MA 4H7PA 3TOSA 4BOYA 1ZK1A 3F1LA 4E6PA 3QXSA 4QOIA 2FPIB 3VBEA 4MMZB 4DLXA 3GFOA 5CDHA 1TFUA 4V2UA 3EISA 1PFKA 3RVPA 5I7EA 1T1GA 2FEPA 3ZR4B 5EESA 3JATB 3K5HA 1K86A 5AW5A 3KBBA 1P2FA 2FN9A 3H5VA 5MHTA 3KAKA 5HK8A 4CW7A 5LWQA 4RTMA 2H54A 4II2A 4P0QB 2XUOA 4L4UA 5L7TA 2ZXUA 1CRZA 2I3AA 5D5HA 1G64A 1M8KA 1XRQA 1H0KA 2O4CA 1T8UA 5EYPA 3SQDA 4LJKA 3LK7A 1DXQA 1E1YA 4G26A 4U02A 4MW7A 2H51A 1E77A 1CY7A 3ZEIA 3NANA 1LY1A 4DARA 1F6WA 2W8BB 3QEKA 1YFKA 4D3XA 4PG4A 3CXRA 4XPIA 3SGLA 4O5OA 4Y2YA 4RPLA 1OU0A 1S7GA 4PS0A 1I80A 3ZU4A 4HDSB 1C9DB 3C1UA 1RYZA 2BCJQ 1Y9EA 5TF4A 1AK1A 1ZN7A 3RRZA 3HJAA 1SBNE 1BE1A 2C54A 4IS2A 2CJXA 4LJ9A 1O4VA 4M3NA 3U4AA 3I9FA 4OFBA 3N86A 4UDXX 2UUAB 3BIJA 1K7XB 4FINA 3I9JA 4RCVA 4BRUA 3ITNA 2BKVA 3BDAA 3ORHA 1KI6A 4AVYA 1AGNA 3JYQA 5F7JA 5CVJA 3WFIA 1QGUB 1Z15A 1L7XA 1X7GA 3C3XA 4Y2XA 5DN6A 4PO8A 4WZAB 4ZJPA 2JD0A 3WTCA 3NBKA 3IKTA 1URPA 3EZLA 1XMVA 2C9BA 1FNBA 1TPYA 2VWQA 3BSSA 4PO1A 5KQRA 3BFJA 3ZGVA 1M1NB 2B8EA 5DMHA 4M46A 1JJAA 2JL1A 2OXRA 4UMDA 3LBFA 2EQAA 3SJBA 4K88A 1EXMA 3ZDYB 4BP3A 1X77A 1ZONA 2H1FA 2IU4A 4C7KA 4AD8A 1GPBA 1KJIA 3HCWA 3KEFA 2CNOA 2VHEA 3EULA 2IELA 4ZO9A 3TMYA 1ZVQA 4G8JA 2HPHA 5AJVB 1A7JA 2WIAA 1BGXT 3GA5A 3MSCA 2IYRA 3OOYA 3PGJA 3QENA 1Y9JA 3GDHA 1JQEA 2AXNA 2G4VA 3A3NA 3B85A 3O8LA 4PZCA 5TQ0B 3TLEA 2J5QA 1ZRNA 4ECAA 2Y1WA 2WD9A 4F6CA 3FZEA 3P2JA 4ZHQA 1Z5NA 3HK2A 2DKOA 2PJDA 5DYWA 2PMDA 2P2GA 2ABWA 3L1UA 5SY6A 2QYHA 5KZMB 4FGWA 3ZNQA 4LW8A 3SWWA 4NJEA 3DXYA 3KSUA 3KSMA 1IIRA 1AQJA 1QORA 1JG3A 3CWQA 3K9QO 5THXA 4PSUA 4PZPA 2OV4A 4D9KA 2MINA 4JROA 2RC6A 4RAQA 3IPRA 3V55A 1X1EA 1O6CA 1E2HA 1P3DA 4WXPA 5KKCA 3TVYA 2XKKA 3QVMA 5JZSA 2WMDA 1SKBA 1HG0A 1OSNA 4HWRA 2PZGA 4DTIA 3G8DA 1EKXA 1Q0UA 1NBHA 3RCBA 4B44A 3OX1A 3SFTA 4HYYA 3ZH9B 5NLLA 4X62B 2O48X 4Q1FA 1J25A 4R1QA 3IA7A 1UFVA 4GH5A 1US8B 3DF9A 4MYCA 3WOVA 3BMOB 1BRMA 5AUNB 4Q7MB 3TQCA 3P9NA 1RE0A 1NQAO 1X14A 5B3JA 4YXWD 4F38A 4Q93A 3RROA 2B1IA 3BB4A 4CKEB 3I8XA 2ICAA 4AKEA 1L7AA 1ND5A 1I0LA 4ARCA 2HHLA 1M0WA 4MROA 4YV7A 1XMJA 2Z43A 1GNQA 3CIFA 3FNHA 3VPAA 1DB3A 1KJNA 3D6UA 4YLYA 4Z6KA 2Q3JA 3HUEA 4XQEA 1XAJA 1QHHA 3PRYA 4JVNA 2HCJB 1MO6A 3LX5A 1P7VA 3W3AA 1YS7A 3CSSA 1LQUA 4MLDA 5H3CA 1BRTA 1PQUA 1QG2A 1ZVJA 3G9TA 3O4IA 4QDXA 4A8TA 4DCUA 3WK7A 5HIKA 1SK9A 2H31A 2Q0QA 2BSXA 2ZAIA 3TD6A 4HRYA 1GNLA 4LV8B 2G28A 3NBXX 3QQPA 4AULA 4CQLA 3OIFA 4CM9D 3ROFA 2XGOA 1AHPA 1YL7A 3I04A 3AJRA 2ARKA 1N2CB 1UKAA 2WHRA 3SZRA 3TD2A 4UEJA 4D8XA 3RNLA 1YFLA 3FOWA 3S8MA 3CZAA 4XJXA 1D3AA 1TLFA 2OGZA 2P67A 2QROA 4D8UA 1JR6A 1T4DA 3M8KA 3NWBA 2HPZA 2OT3B 1AKUA 5GQSA 2DG2A 3PD7A 4OXXA 5T8KA 1Q95A 4H27A 4CR7A 2G1PA 1PJQA 1A9XB 5IC6A 2GPYA 2UZAA 1HFJA 1P3Y1 2B78A 3ONNA 2YOFA 1CVLA 4NPHA 1AM4D 1KI9A 5A3JA 5AQ1A 1MHTA 1C2TA 3H9GA 4NBRA 3U1BA 4P84A 1I7NA 2WJVA 1HFKA 4Z0PA 3EQ8A 1WBDA 4O02B 1F1BA 1FU8A 1YQWA 3K30A 3PXBA 3A1WA 4D4GA 5C80A 1P5JA 2WJIA 3MWYW 1GZ7A 3GP5A 4RWEA 3MC1A 4RZHA 3DTTA 2BSAA 3IO5A 4L78A 2VG8A 1P4SA 3IPAA 4J0GA 2X22A 3H75A 4AYXA 1B14A 4D8TA 2G4CA 1GQYA 3ILHA 1ECJA 2DSNA 2ZJ6A 4R81A 2B0CA 3RTCA 2CZGA 1JVNA 2G08A 5FRDA 2WJWA 4ZCLA 3SYLA 1JUDA 1E3WB 3WBKA 2O2JA 2VPQA 1J0BA 1FFHA 1SURA 4HWKA 1ZRSA 2J9GA 3OU7A 5F2OA 1YGYA 2OKGA 3N7AA 3O2SB 3P4XA 4YMGA 1Y8RB 1KQ3A 1QFJA 1CWUA 1QUEA 1S9HA 2ZT6A 2OYSA 3M70A 3VR0A 5DYTA 4BJHB 5LP1A 4JI2B 3KU4A 4IIJA 4G81A 1I32A 1KI1A 2YNMD 2JAOA 1QIDA 3ZK8A 5IRCD 1UBGA 3EWSA 3BRWA 3PD1A 1FYVA 1XQ9A 2ATIA 1MPXA 4IIHA 4MDYA 4HXFB 2QLJA 1PG5A 3A32A 3F7MA 3SBDA 3EF1A 1D6NA 1SVNA 1KFJB 4DSNA 4I8IA 2YYSA 1ZNZA 5JO9A 4CDRA 2O0KA 1S8FA 3NTUA 4G23A 4R16A 5AO9A 2R8PA 3V2IA 3QG1A 1EGVB 2IEAA 2V97A 3P9RA 4DPKA 3R8FA 4IEFB 1E99A 2YN2A 3ZZTA 4DWJA 3FD8A 2Z1NA 2NU9A 3PTZA 5DW0A 3TNFA 5ALQA 1ORHA 2BKXA 4WK0B 5I9IA 3AEZA 1QZTA 4GLFA 1PUJA 4LEIA 4ES6A 4AP6A 2OAQ1 1F06A 2ZAMA 2QIOA 3A3OA 4U2EA 4LJ5A 5B1SA 2CXXA 2AZ4A 3N9IA 3ZI0A 2ANBA 4HX5A 4YJ2B 5LJLA 4FEYA 1B6TA 3ET4A 5A4FS 1GD1O 2WVHA 1OQAA 3I83A 4BQFA 4NMLA 2NYVA 5EHNA 3P9PA 1M66A 1WPGA 3O7WA 4NJMB 2VDWB 5EFOA 3FMIA 4URFA 1JKJA 1R6BX 2AQ8A 1AQLA 2QF7A 3H86A 4MS3A 2WY2D 3X1JA 3EMDA 1LDYA 4DW8A 4DKJA 1SUFA 3AR5A 1BX0A 1KKUA 1WXWA 4U39A 5D84A 1F17A 2AN3A 2UZ1A 3HVHA 4EGAA 1LA2A 3MJCA 621PA 3F5QA 4KXQA 4NQZA 1TKCA 4AG6A 2J0QA 4OLAA 1UBLS 2QI9F 3E1KA 3RYIB 3HUTA 3FLBA 5I7UA 1K8RA 2XMGA 3C16C 3ZZ1A 1LXCA 1ZO8A 3IDFA 2Z6QA 4I5IA 2WSIA 2E1RA 1ESEA 3DE2X 3BB1A 4KUHA 5CLFA 1X7WB 1TFRA 3ESZA 3REOA 3VPXA 5KYNA 3K9HA 4WK6A 3NRBA 1RHRA 4JMLA 4OFZA 2QG4A 4LDZA 1J56A 4Q18A 3VRHA 1FU4A 3HJFA 1DELA 3GJXC 4A92A 1KAGA 2FUEA 3RG8A 2EDAA 4R01A 1M73E 5FLKA 1AXGA 2C3OA 2HF8A 3BWXA 4O2BB 3ZLVA 3WLAA 4JWKA 4PG5A 3RHSA 2VT3A 3F3SA 4B46A 4R8KA 3GA7A 2CC2A 1E9VA 2QUAA 4LY3A 3H04A 3ZDAA 1K98A 4KN5A 1JFRA 1RZVA 4RH3A 3RVOA 1R3UA 1YTLA 4C6HA 1CJBA 4LHVA 4JOCA 3GO4A 2FEWB 4NDZA 1C3JA 1CYEA 4EL0A 4QOHA 3W5VA 2OCDA 4E14A 4OFWA 3KUDA 4CNBA 2W5UA 3G1TA 1TCBA 2FZ5A 1KI3A 2HMSA 3LF2A 2HHHB 1ZA2A 2XV1A 3HDJA 4G1VA 1BD3A 3SHOA 4EZEA 5EEGA 1S4QA 3CM0A 1OFVA 1VGVA 3EEFA 3RVDA 3KTAB 4RIGA 3SC4A 1AJEA 5CDSA 4B35A 3QX7A 3WZLA 3QA9A 4UPEA 2W11A 3IQXA 1TK9A 5K09A 4LZJA 4OA5A 1O97C 2DSTA 4RX1A 1O89A 4EKIA 3OPNA 3P9YA 1VFPA 3BD6A 3NBQA 1K8YB 4YJGB 3E18A 1DJQA 4S05A 1K9VF 4F3TA 4D25A 4ZI2A 4UHCA 2FWPA 2BELA 1GGFA 3P8ZA 1SC4A 4C0JA 1BMFA 1OLOA 4P3PA 5AKGA 2BL4A 2GA8A 3AHGA 4PEVA 5EJGA 3HSSA 1BQEA 3U62A 3U1VA 1KMIY 4P7JA 4C1BA 1T9GS 1ZOOA 1O0BA 3VDXA 4OQLA 3AVYA 1ECLA 3AB3A 4HGNA 1MB3A 4UXIA 3NT5A 1J0EA 2C4NA 1H23A 2VJYA 2DWCA 1A4XA 3SP1A 3CO5A 3MNFA 4X3OA 2IS6A 5SY4A 1IZ9A 3ILSA 1VL2A 4MMYB 5JZVA 5A04A 3NTRA 4TQGA 5CIWA 3NP9A 3D6VA 5KNCA 4QWMA 5EUCA 3R8CA 7AT1A 4AF7A 1WQ3A 2HWKA 1ZGJA 1JIKA 1KO1A 1PGJA 2JJMA 4WBNA 4DIOA 5B2FA 5IANA 3LY7A 1NDUA 1X8XA 2HT6A 2YVKA 1FPQA 3EUAA 5CLHA 5CX4A 2P2CA 5B1HA 1Q0TA 1IRIA 1BU5A 1HX7A 1MBZA 2JCYA 3KNZA 1KK1A 3IQWA 3CJRA 1U4NA 3N28A 4G1CA 4LWOA 4X5OA 1J06A 2FAXA 3SNHA 1T5SA 3S5UA 3VNSA 4A8JC 2E4AA 2OGUA 2ZI9A 2JAWA 5I7VA 1LGYA 2QVBA 2ZR8A 4FFVA 5K3FB 4NU5A 3WL8A 3WDSA 4CF4A 2COEA 2CNBA 3LC0A 3PE3A 3EXAA 4FGJA 2ZVDA 4ZYXA 3CLRD 4FSXA 5D8DA 1RM0A 3WIVA 1VKHA 2Q3FA 2HKIA 3IDOA 5LFAA 1R4AA 4U2KA 1QPZA 3AM1A 2G5GX 1FJXA 3VJLA 2VNHA 4JBGA 3TJZA 4E5UA 4F3NA 4F7WA 3RSGA 1AMUA 3N6XA 3ITEA 3B78A 2B4RO 2CUTA 4MV1A 4KGZA 2EFCB 1MOSA 4ZN6A 1RHMA 2H4JA 3RYCB 2WIDA 1D0SA 2W00A 5H9WA 1ZZEA 1IOVA 3G0HA 2PU5A 2ASEA 3AONB 5JC1A 2G5TA 5TF0A 4DZZA 1EJBA 1RYNA 4OXNA 1QFXA 3RVKA 4XB2A 4D74A 3GJTA 1VJGA 4K1LA 2HFJA 3ADOA 2CHGA 4KN8A 1A8IA 2O14A 1F8FA 2WHXA 1T5BA 3ABQB 2AKAB 3GLRA 4KKVA 4DUPA 2VF7A 4XGRA 3R5KA 3RUAA 1HTWA 1OROA 3GGCA 4Q21A 4CMCA 3MT0A 2N3ZA 1NKTA 5ADUS 4LFBB 2IYZA 3BRSA 3UJBA 1YR6A 2NZVG 2V54A 4CIBA 1E9BA 3TLMA 4C4RA 5HILA 3G5AA 1ABEA 4HYQA 2XXAB 2PSEA 1RWQA 2FLVA 4LRSB 2OCLA 5H0IA 2RK4A 3QXCA 3WKCA 3ZE7A 5AW0A 3E5HA 3HU3A 4UQOA 2D00A 3ER6A 2IIPA 3PVZA 4DRZA 2FE1A 1XLVA 3BTSA 5C3MA 4D92A 2JI9A 3E2IA 3IPYA 2OUIA 2QRMA 1J42A 1TQ4A 1MB4A 1L7RA 3ABSB 2PGAA 3PUWA 4HFNA 2XCOA 4ND4A 3I1YA 1OX4B 2C5FA 3BULA 2BPOA 3LBNA 4H6XA 4HDMB 2YWBA 2NAFA 3DYIA 2QRGA 3EASA 3T99A 4WBNF 1IONA 2A1TR 3R77A 2X4GA 1QR6A 4ROSA 3TDNA 2OSVA 1G21A 2KWIA 2AYZA 2XRMA 1AA9A 2XJ9A 3HLYA 5JT1A 2BMAA 3OT1A 1S2DA 2WWRA 3KLBA 4HH0A 3W7AA 1VGQA 3DV0A 1G20B 1XXHB 4GGMX 4QC2A 4KGVA 4OHMA 4RMGA 4JDUA 2PUEA 2MTBA 1J2JA 1ZOLA 2BZGA 5FORA 3N53A 4KL8S 3JQ7B 5E95A 5F78A 3EODA 3ZK7A 4O4LA 2O7QA 5BQXA 5KSWB 4R5HA 1WTAA 2RAPA 3VO9A 4TKUA 3P9KA 1I2AA 3L6DA 4CF3A 1FTSA 2M2IA 1WSWA 3WGOA 1WJGA 4ED9A 3BQMB 2E85A 4GVLA 4S12A 4P5DA 4OK5A 1QDEA 1EH5A 1XLWA 2XWQA 1T8TA 4UUBA 4YJFA 3P45A 2QU8A 5BT8A 4IW3B 3AM4A 3ND8A 2P41A 4YACA 2CL5A 3PHLA 1FVOA 1QGAA 4JUCA 4XUEA 3WMWA 3FYUB 4GOND 4EG7A 3OEED 1KERA 3AY0A 5CYFA 2HMUA 2WTMA 3PR2B 1LSSA 3RAPR 3TLZA 2G82A 4PGAA 4Q3AA 2E49A 2NSDA 4QVGA 1E3JA 4R4JA 1CZUA 4XH9B 3CLVA 2QV0A 4G4GA 2A30A 4MRMA 3BMQA 1BE0A 1P3JA 1VG0B 1NJ1A 2CVPA 2P3QA 2WK1A 3D6FA 3OA0A 3HEAA 3P0HA 3RFTA 3UJPA 1BMTA 2GK3A 2P11A 1Z68A 3OTGA 3CUEF 4D8YA 2FZ4A 1WSDA 3HP4A 4S1NA 5AI4A 5EINA 2ZBGA 521PA 1O08A 2P2SA 4HNTA 4Q1EA 5E6UB 2DUJA 3QELB 4RXUA 5AIAA 3RBXA 3ZGXA 2JFZA 4EUNA 2Q2OA 1FMJA 1QH8A 2R4UA 3C5HA 3ICCA 4TTAA 2PUCA 1I8TA 1ST3A 1U8EA 1Z8HA 3EGEA 3ASUA 3FGZA 4BVKA 1D5WA 4DQ0A 3OX2A 1S4MA 5I7WA 2NTYC 2C94A 1C9JA 1QLWA 1GUZA 3CG4A 1SIOA 4DA7A 5TRTA 4D5GA 3DTVD 4YRPA 1GV1A 4UVHA 3ADCA 4LXUA 4ER0A 4XWYA 3T34A 4PLGA 2VVTA 5L7YA 4MW0A 4MVJP 4D82A 2UYGA 4DR6B 1I6WA 1XQ1A 1YRHA 3NVAA 4ZCQA 1U98A 4V0ME 4ZYVA 3I2FA 1ZY2A 5DBIA 1L8LA 4IPTA 5DB4A 2BR5A 2P4UA 4QPDA 4FHGA 2XT0A 3UXYA 3IESA 4Q4CA 3Q1KA 1JPNA 4M9RA 4DS3A 4NC9A 5JYEA 3ZLUA 4PZLA 1KSGA 4WACA 5I9BA 4H6PA 3SHFA 3JX9A 3F3MA 3GN1A 5K0EA 1GRCA 1WDTA 4TKMA 1XTSA 3M9WA 1M7BA 1QV6A 2H9IA 5DEOA 4DZTA 3I6YA 4QICA 2PUVA 1T29A 4OJYA 2VEDA 3LT5A 4M55A 5CJJA 3ZWYA 4BRZA 4FSDA 1MW8X 4R1MA 1M6YA 4UOEA 2GAOA 7MHTA 2OCYC 2OZPA 4ZVPA 5J2UB 4AXBA 1BEUB 1MJNA 1I6LA 5AD1A 2I54A 2RBGA 3EZFA 3QV1A 1M2FA 3JASA 3QKTA 4PQGA 4CGYA 1SHKA 4S04A 2WHEA 3A1NA 4TLAA 1DAOA 2IIVA 3AFGA 3PF9A 1S2MA 1SBQA 1QAQA 1O97D 3RE1A 3TZBA 4EAAA 5JSZA 5KYTA 5IT9A 2XXJA 4LBYA 4OPMA 4PLZA 3AI2A 1EZZA 2D4AA 3CIOA 1CJTC 3GDOA 5EC8A 3ZGNA 3ZXIA 2NXNA 4OSEA 2EW8A 2G9ZA 4Q3KA 4ALKA 1SHJA 1VIVA 3AUTA 3AT1A 2EGGA 3FZNA 4ZVUA 1N6LA 3ZGLA 4RENA 3D5EA 2XMPA 1NT2A 4M53A 4QRHA 5CLQA 5EMLA 3VR1A 2HF2A 1DS6A 3R44A 1XSEA 2QENA 1GTVA 1TJ5A 1OFIA 1SCJA 3BCRA 2J7PD 1DFIA 5IJZA 1CNFA 3CNBA 4Q9JA 3UJNA 4E33A 1XMIA 3NOVA 1TJNA 3DMDA 1OR8A 3LH5A 4LRWA 4D4LA 1CE8A 2G72A 1JEJA 4EKDA 1E9EA 3VBCA 2FF5A 4D46A 4YV1A 3LDFA 3BXPA 4Y8VA 2AEEA 2WZQA 2JASA 3BSWA 5JC8A 1DRJA 4AP5A 2WAAA 3M1AA 4BB9A 3A37A 3Q11A 4BMOB 4B74A 4NE9A 4WDRA 2VH1A 1LSUA 3QOYA 4PXYA 5LUBA 4RMNA 3WLRA 1RNLA 3DWGA 1RW4A 1WW2A 2ZVPX 1SZJG 1V6AA 2NUPB 2RHCA 4E2FA 4R2KA 5LWHA 5AM4A 1T5HX 5EIOA 4CM4A 1Z0SA 4MQ5A 4MHSA 4XDGA 1RAFA 3UH0A 4WOBA 4Q19A 3MQ2A 2IX3A 1EX1A 5GZ1A 4M49A 5F52A 5BW5A 5IJXA 1IJKA 9ABPA 1E3MA 1OKKD 3J81k 4FEEA 1QNLA 5EKDA 3VO2A 5IULC 2YWHA 2F67A 4IF4A 4J2TA 4ZYTA 2DFNA 2QNRA 3C74A 3BGDA 1N9KA 2CBZA 4CMEA 2H5JA 1HMPA 1KKMA 2R3SA 1PJSA 4GNRA 4WBXC 3SX2A 1CUXA 2NO6A 4QYSA 1R8QA 2GCNA 3AHFA 2YQ4A 1IEXA 4EG8A 3K09A 3L0PA 4ENTA 4HH4A 4ITRC 2QDXA 2CK3D 3A0RB 3GFRA 3ROMA 4YX9A 5KOIA 3ODPA 2JI4A 1BEZA 4XM0A 5EKSA 5KTRA 3Q6MA 4KXYA 3DO8A 1L9XA 4ZQBA 1TZMA 5A62A 4OK6A 4BO6A 4ZEVA 4CKWA 3EXFA 4WJKB 3GEGA 3SHQA 3K6SB 3KQHA 2CDRA 5E3JA 4R51A 3C70A 3CWZA 3DKVA 4KWEA 4R5MA 4TKVB 5JBQA 2FSUA 3CX8A 4X95A 4UTPA 1W4RA 2AFHA 3G59A 3M6IA 4YRKA 5C35A 3ZTYA 1JTVA 1A88A 3MLAA 4JGGA 1B15A 3W3ZB 3WKBA 5K2OA 1LH0A 3AEQA 3PC8C 2A9PA 1D7OA 4HX2A 2O07A 5DBGA 3IHKA 5K3SA 4CQMB 1EFRA 2ETVA 3QOWA 3UT5A 2HDHA 4TTIA 3TS1A 5EJMA 2B5VA 3QZUA 4ZO7A 2YIMA 3FPBA 4HNGA 4YWJA 4BNLA 2I80A 1Y1RA 4M99A 5CNMA 3REGA 5AK6A 4AC9A 5FH9A 1VCIA 1EE2A 1ND6A 1VKZA 3U4QB 4I5DA 4QYXA 3OOJA 2X8AA 2ECPA 1MJHA 1Q7RA 4YRZA 1RMYA 1NNSA 1S3FA 2QTWB 1RI5A 4TM7A 5TPWA 2D6FA 3KXDA 3RC1A 3TZ6A 1SU8A 1MP0A 2HA2A 5KHLB 4LS3A 1EU1A 5BRAA 2AQKA 1QG4A 2EQ5A 1XAGA 4FN4A 4HY3A 5EWLB 1HYGA 4YFVA 1C1HA 5DULA 2LWIA 4KX5A 1NX9A 3KWJA 1CRLA 1WMAA 3D31A 1KEUA 1XCPA 3EFBA 2F3QA 2Q1UA 4MUNA 1KK2A 4RS3A 4PC6A 2Q8NA 3NYRA 4PAQA 4X1IA 2X5KO 2XCTB 2QUBA 2ZITA 4M8LA 2HWYA 1GXSA 2ZATA 3A9WA 3NBZC 2UVQA 2ZBPA 4UZSA 5T8KC 2OQVA 1QO0D 2Q29A 2B37A 4YPVA 1G60A 2ZSFA 1YQXA 1HZZC 5K51A 2WFAA 3DH0A 4I1IA 5A4JA 3ZGYA 1ADBA 3DZCA 4FMDF 2FK7A 2EP8A 5KSZA 3QFTA 1Y63A 4Y2GA 2QSZA 2GD1O 5LVAA 5F3WB 1JE0A 1UPTA 1ZJ6A 3CNLA 4YDHB 1G21E 1JHRA 1YR9A 3G2NA 3L6OO 4QBGB 5EQJB 3HKDA 3WNQA 5KNLA 1H2RS 2QD5A 2RBKA 1V8FA 4GMGA 1HQKA 3T7IA 3EBOA 1NVWQ 4L08A 3IHTA 3L0OA 3MWJA 3SJAA 3SFZA 4B7ZA 1R2QA 1N8KA 1ZGAA 2FYTA 4QJIA 1VI5A 1R0LA 3KP1A 4YCAA 5DWDA 3ENZA 1HTTA 3DKKA 3ILVA 5DGTA 4P3KA 3UKJA 3PQCA 4Y30A 4AO8A 1P19A 3VHLB 4UE3S 1EMDA 5G41A 4K6GA 1XQYA 3FFAA 4PSKA 2MCFA 5BQPA 5SV2A 5AKEA 2NQTA 3F5DA 4FQ5A 2O5EA 3V8EA 3I9KA 1MJGA 4M83A 1X92A 2COUA 2ZJ0A 4G8CA 2E89A 5K8IA 2JARA 3GELA 3WLHA 4BFZA 1WVGA 4IV8A 4X90A 5D01A 1HYHA 3L84A 2P62A 5SYAA 1C9NA 4L7QA 2VA9A 5I47A 5B3AA 1E9DA 2PJRA 4GI3A 4O2LA 4AUEA 1R64A 1KU6A 3NUGA 2J7KA 4XSHA 1AUVA 3FTQA 4L8YA 4PPGA 2Q8PA 2X9NA 4Q7JB 2AE2A 5EMMA 5JQGB 1WCIB 2PFGA 3KK0A 3QJ5A 4OM8A 5COBA 5AVOA 4ZZ2A 3DEHA 2Z08A 3LPDA 1GP2A 4MVWA 3T41A 3D6AA 3G7SA 1X80B 3BD8A 3L7JA 3VH4A 2G8NA 3CZCA 3VKFA 3VO1A 4O1IA 1N9GB 2ROQA 2Q9UA 2F00A 2P6UA 4GMFA 2FR1A 5LZ9A 4YALA 2L19A 3OZAA 2DKNA 2XHZA 2GD6A 3FF4A 4G1BA 4NJOA 5AESA 3PC8A 5CU7A 3TW8A 3TRJA 5K0TA 2C59A 4J16C 3UK1A 3RRYA 2GRAA 1SUDA 2WWWA 3A3KA 3FLEA 2EJUA 4N5IX 5J1TB 3X1YA 4AMYA 1YCGA 4DCTA 1U0TA 2GZHA 4MAFA 2CMFA 2XE7A 3OCCA 3DVAA 3BWYA 3I01M 1T4CA 2QBYA 1U0EA 1WAMA 1FMLA 3FYUC 1NJ2A 1OZ0A 3ISJA 3PNOA 1JEQA 1AO0A 4DG9A 2V03A 1BE8A 1PGQA 4QATA 3M82A 1PR6A 1QFYA 2QW8A 1H0SA 3ZXSA 1C1DA 4IZHA 4QQKA 4WV3A 1QVVA 3DAPA 4KH1A 3UAZA 4Q03A 4GUAA 4WSOA 2VYVA 3GGOA 4OHBA 3NHFA 1IQ0A 2XUKA 3G9UA 4PPFA 4TLLB 1XQVA 1JMKC 4UZFA 5CMLA 3VZRA 3IP5A 1RHUA 5T6MA 4PZ9A 4DYHA 4R69A 2VF8A 3VR4A 4AKTA 2ZIZA 4XYLA 4JUDX 4MYHA 4L9AA 3WLKX 3PZRA 3KR1A 4LN1A 3VC2A 4QO8A 2QLNA 4KR2A 3OIGA 4REOA 1AGXA 1COZA 1LBTA 3E1SA 3RW9A 3QGMA 3TLJA 2PO7A 4IFBA 2WTNA 3OG9A 2QLTA 4B3HA 2CL0X 1XBTA 5C9ZA 1GQQA 1QCZA 3L6BA 3TM5A 1L4BA 1VI2A