1K7TA

Crystal structure analysis of crosslinked-wga3/glcnacbeta1,6gal complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
171
structure length
171
Chain Sequence
ERCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords agglutinin isolectin 3
publication title Interactions of wheat-germ agglutinin with GlcNAc beta 1,6Gal sequence
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 40
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7tA02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7tA03
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7tA01
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7tA04
2LB7A 2CWGA 1P9ZA 2X52A 1ULMA 4WP4A 2WGCA 9WGAA 1K7UA 2DKVA 1ULKA 1K7TA 1UHAA 1WKXA 1ULNA 2X3TA 1Q9BA 2UVOA 1WGTA 1HEVA 7WGAA 4MPIA 1K7VA 1P9GA 1WGCA 4AMLA
chains in the Genus database with same CATH superfamily
1FY7A 2LB7A 1TIHA 2CWGA 2SGPI 1P9ZA 1Y8FA 2NU4I 4OVOA 4WP4A 1MJAA 1SGDI 3FSXA 3SEKC 3FC3A 1CT0I 1CT4I 2GKTI 3QWPA 1M8CA 1PTQA 1V1IA 2L7XA 1LR9A 3PDNA 3QTLD 1CGJI 2QQ0A 4UXIA 1ULNA 3OXFA 1H0ZA 1Q9BA 2A20A 1R79A 5EX0A 2ORWA 5FUWA 2QQDA 2JW6A 5J8CA 2NU3I 1M8BA 4HGUA 3R5CA 3OXLA 1Z7KB 2JA1A 2GKVA 2ENZA 5EX3A 5FUXA 4DNCA 2JZMA 2GKRI 4UXJA 3UOEA 1MT1A 4MPIA 1K7VA 1HPTA 1X74A 4JCVE 2LEOA 1TBNA 4AMLA 1LR8A 1OYVI 2ARPF 2VRWB 1OMUA 3UGLA 1KBFA 1V1HA 1KMAA 1PPFI 1Z2IA 2M5XA 2NU2I 2B0UC 3TO7A 1K7UA 2KMQA 1SGPI 2UZ3A 3KY9A 1XX6A 5E3RA 2V1CA 3VE5A 2JYYA 2E73A 3E2IA 3OXGA 4UXHA 1TBQR 2N17A 2OD1A 2QPOA 2NU1I 1FYBA 2GVIA 3VDPA 1TUSA 1DS2I 1BUSA 2OVOA 1TGSI 1SGRI 1VDDA 4FKDA 3TO6A 1S20A 2BUSA 2N1AB 3OL0A 1XBTA 2CJSC 2L8EA 2N71A 2J9RA 3B4VC 2UVOA 1IY5A 1NXUA 2WVJA 1SGYI 2W0TA 1TBRR 5CCMA 1CSOI 1MJBA 1R0RI 2KMOA 2ENNA 3UEJA 5HQ8A 1CE3A 1P9GA 1WGCA 1XA6A 2Y0MA 3SGBI 1RFHA 2SGDI 1UVGA 3UFFA 5E3PA 3E59A 1ULMA 5CCLA 2DB6A 1W3SA 9WGAA 2DKVA 3UGDA 1ULKA 2KCXA 1OMTA 1CGII 1UHAA 2ORVA 2F3CI 1BMOA 3D00A 1WKXA 2ELIA 2FNFX 2KMPA 2YQPA 5HI7A 1HDLA 2WCYA 1YU6C 1Y1BA 2ERWA 4SGBI 3R5DA 4E1RA 2J87A 3SGQI 1CT2I 3UEYA 1YTPA 2JXDA 1WGTA 3MEKA 3QAHA 1IY6A 1HEVA 2NU0I 1CHOI 7WGAA 3VDUA 2V53A 1IW4A 1U5KA 1AN1I 2QQEA 3TOAA 2QQCA 1PJUA 1UUCA 1SGEI 4A24A 1OVOA 2X52A 1Y1CA 2PQ8A 3GOXA 2B8TA 4GI3C 2WGCA 1TURA 1UVFA 1WTJA 3CXLA 5E3QA 2RC4A 5J8FA 3TO9A 1X4SA 2K9HA 2SGEI 3TJQA 2KMRA 1K7TA 2GIVA 1KBEA 2V1CC 2YUUA 3R5BA 1NUBA 1HJAI 3UGIA 5JHWC 3OVOA 1LR7A 3RU0A 2P6AC 2SGFI 3TOBA 2OZUA 2X3TA 5FUYA 1W4RA 1MJ9A 5FUVA 2ODDA 3HH2C 2RIJA 4B6DA 2DIPA 3BJIA 2CWFA 2XRCA 1DS3I 3R5AA 2LUYA 4L9MA 4E1PA 2E5RA 1PCEA 2N52A 1TBOA 2OU2A 2SGQI 1FARA 1N13A 1TOTA 2ROWA 1SGNI 5DAEA 1SGQI 1PTRA 2CWHA 1FAQA 3FSYA
chains in the Genus database with same CATH topology
2LB7A 2CWGA 1P9ZA 2X52A 1ULMA 4WP4A 2WGCA 9WGAA 1K7UA 2DKVA 1ULKA 1K7TA 1UHAA 1WKXA 1ULNA 2X3TA 1Q9BA 2UVOA 1WGTA 1HEVA 7WGAA 4MPIA 1K7VA 1P9GA 1WGCA 4AMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LB7 A;  2CWG A;  1P9Z A;  2X52 A;  1ULM A;  4WP4 A;  2WGC A;  9WGA A;  1K7U A;  2DKV A;  1ULK A;  1K7T A;  1UHA A;  1WKX A;  1ULN A;  2X3T A;  1Q9B A;  2UVO A;  1WGT A;  1HEV A;  7WGA A;  4MPI A;  1K7V A;  1P9G A;  1WGC A;  4AML A; 
#chains in the Genus database with same CATH topology
 1FY7 A;  2LB7 A;  1TIH A;  2CWG A;  2SGP I;  1P9Z A;  1Y8F A;  2NU4 I;  4OVO A;  4WP4 A;  1MJA A;  1SGD I;  3FSX A;  3SEK C;  3FC3 A;  1CT0 I;  1CT4 I;  2GKT I;  3QWP A;  1M8C A;  1PTQ A;  1V1I A;  2L7X A;  1LR9 A;  3PDN A;  3QTL D;  1CGJ I;  2QQ0 A;  4UXI A;  1ULN A;  3OXF A;  1H0Z A;  1Q9B A;  2A20 A;  1R79 A;  5EX0 A;  2ORW A;  5FUW A;  2QQD A;  2JW6 A;  5J8C A;  2NU3 I;  1M8B A;  4HGU A;  3R5C A;  3OXL A;  1Z7K B;  2JA1 A;  2GKV A;  2ENZ A;  5EX3 A;  5FUX A;  4DNC A;  2JZM A;  2GKR I;  4UXJ A;  3UOE A;  1MT1 A;  4MPI A;  1K7V A;  1HPT A;  1X74 A;  4JCV E;  2LEO A;  1TBN A;  4AML A;  1LR8 A;  1OYV I;  2ARP F;  2VRW B;  1OMU A;  3UGL A;  1KBF A;  1V1H A;  1KMA A;  1PPF I;  1Z2I A;  2M5X A;  2NU2 I;  2B0U C;  3TO7 A;  1K7U A;  2KMQ A;  1SGP I;  2UZ3 A;  3KY9 A;  1XX6 A;  5E3R A;  2V1C A;  3VE5 A;  2JYY A;  2E73 A;  3E2I A;  3OXG A;  4UXH A;  1TBQ R;  2N17 A;  2OD1 A;  2QPO A;  2NU1 I;  1FYB A;  2GVI A;  3VDP A;  1TUS A;  1DS2 I;  1BUS A;  2OVO A;  1TGS I;  1SGR I;  1VDD A;  4FKD A;  3TO6 A;  1S20 A;  2BUS A;  2N1A B;  3OL0 A;  1XBT A;  2CJS C;  2L8E A;  2N71 A;  2J9R A;  3B4V C;  2UVO A;  1IY5 A;  1NXU A;  2WVJ A;  1SGY I;  2W0T A;  1TBR R;  5CCM A;  1CSO I;  1MJB A;  1R0R I;  2KMO A;  2ENN A;  3UEJ A;  5HQ8 A;  1CE3 A;  1P9G A;  1WGC A;  1XA6 A;  2Y0M A;  3SGB I;  1RFH A;  2SGD I;  1UVG A;  3UFF A;  5E3P A;  3E59 A;  1ULM A;  5CCL A;  2DB6 A;  1W3S A;  9WGA A;  2DKV A;  3UGD A;  1ULK A;  2KCX A;  1OMT A;  1CGI I;  1UHA A;  2ORV A;  2F3C I;  1BMO A;  3D00 A;  1WKX A;  2ELI A;  2FNF X;  2KMP A;  2YQP A;  5HI7 A;  1HDL A;  2WCY A;  1YU6 C;  1Y1B A;  2ERW A;  4SGB I;  3R5D A;  4E1R A;  2J87 A;  3SGQ I;  1CT2 I;  3UEY A;  1YTP A;  2JXD A;  1WGT A;  3MEK A;  3QAH A;  1IY6 A;  1HEV A;  2NU0 I;  1CHO I;  7WGA A;  3VDU A;  2V53 A;  1IW4 A;  1U5K A;  1AN1 I;  2QQE A;  3TOA A;  2QQC A;  1PJU A;  1UUC A;  1SGE I;  4A24 A;  1OVO A;  2X52 A;  1Y1C A;  2PQ8 A;  3GOX A;  2B8T A;  4GI3 C;  2WGC A;  1TUR A;  1UVF A;  1WTJ A;  3CXL A;  5E3Q A;  2RC4 A;  5J8F A;  3TO9 A;  1X4S A;  2K9H A;  2SGE I;  3TJQ A;  2KMR A;  1K7T A;  2GIV A;  1KBE A;  2V1C C;  2YUU A;  3R5B A;  1NUB A;  1HJA I;  3UGI A;  5JHW C;  3OVO A;  1LR7 A;  3RU0 A;  2P6A C;  2SGF I;  3TOB A;  2OZU A;  2X3T A;  5FUY A;  1W4R A;  1MJ9 A;  5FUV A;  2ODD A;  3HH2 C;  2RIJ A;  4B6D A;  2DIP A;  3BJI A;  2CWF A;  2XRC A;  1DS3 I;  3R5A A;  2LUY A;  4L9M A;  4E1P A;  2E5R A;  1PCE A;  2N52 A;  1TBO A;  2OU2 A;  2SGQ I;  1FAR A;  1N13 A;  1TOT A;  2ROW A;  1SGN I;  5DAE A;  1SGQ I;  1PTR A;  2CWH A;  1FAQ A;  3FSY A; 
#chains in the Genus database with same CATH homology
 2LB7 A;  2CWG A;  1P9Z A;  2X52 A;  1ULM A;  4WP4 A;  2WGC A;  9WGA A;  1K7U A;  2DKV A;  1ULK A;  1K7T A;  1UHA A;  1WKX A;  1ULN A;  2X3T A;  1Q9B A;  2UVO A;  1WGT A;  1HEV A;  7WGA A;  4MPI A;  1K7V A;  1P9G A;  1WGC A;  4AML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...