1K7TA

Crystal structure analysis of crosslinked-wga3/glcnacbeta1,6gal complex
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
171
structure length
171
Chain Sequence
b'ERCGEQGSGMECPNNLCCSQYGYCGMGGDYCGKGCQNGACWTSKRCGSQAGGKTCPNNHCCSQYGHCGFGAEYCGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQNGACSTDKPCGKDAGGRVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords agglutinin isolectin 3
publication title Interactions of wheat-germ agglutinin with GlcNAc beta 1,6Gal sequence
pubmed doi rcsb
molecule tags Sugar binding protein
total genus 40
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00187 Chitin_bind_1 Chitin recognition protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7tA02
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7tA03
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7tA01
3.30.60.10 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Endochitinase-like 1k7tA04
1P9GA 1WGCA 2X3TA 1ULNA 2UVOA 1WKXA 1UHAA 1K7TA 1ULMA 1K7UA 1WGTA 1Q9BA 2X52A 2LB7A 1ULKA 1K7VA 9WGAA 2DKVA 2CWGA 1P9ZA 4MPIA 7WGAA 4WP4A 2WGCA 4AMLA 1HEVA
chains in the Genus database with same CATH superfamily
2N71A 1VDDA 1H0ZA 2WCYA 2V1CC 3UFFA 2X3TA 4UXHA 2NU0I 3KY9A 2SGFI 2YUUA 2GIVA 1SGYI 4B6DA 1HDLA 2SGQI 1KBEA 2V53A 1S20A 1K7UA 2VRWB 1OMTA 2KMPA 1YTPA 2ENNA 3QWPA 4HGUA 1PCEA 2LEOA 3UOEA 3OL0A 1NUBA 1UVGA 2N1AB 1TBOA 2QQEA 2J9RA 2NU1I 2JA1A 1PPFI 3PDNA 3QTLD 2CWFA 9WGAA 2DKVA 1BUSA 1R0RI 2CJSC 1U5KA 2JYYA 3OXLA 1MT1A 2JW6A 1UUCA 2WGCA 1YU6C 3OVOA 1FYBA 2QQ0A 2JZMA 1IY6A 2F3CI 1AN1I 4AMLA 5JHWC 2SGDI 2SGPI 1P9GA 3TOBA 2NU4I 3R5BA 4A24A 2ELIA 2ORWA 1UHAA 1K7TA 2KCXA 2GKVA 3HH2C 3FSYA 3R5CA 4JCVE 1M8BA 2JXDA 3VDPA 5J8CA 1WGTA 2DIPA 3SEKC 4L9MA 2LB7A 1ULKA 2GKTI 3UGLA 3QAHA 2QPOA 1PTRA 1KMAA 1MJ9A 1TIHA 3SGBI 1FARA 5E3PA 4GI3C 5FUXA 2ORVA 3RU0A 3R5AA 2ODDA 3OXFA 1DS2I 1X4SA 2K9HA 1TBNA 1CGII 1R79A 2E73A 3E2IA 2J87A 2A20A 1FY7A 5HQ8A 4E1RA 1LR8A 1OVOA 1Z2IA 1HEVA 2CWHA 1TGSI 2KMOA 1TOTA 2QQCA 1CGJI 5FUYA 1ULNA 1PJUA 2ENZA 4E1PA 2SGEI 2OVOA 2QQDA 3TJQA 1Y8FA 5HI7A 1DS3I 1ULMA 2B8TA 2RC4A 3MEKA 3TO9A 1SGQI 1TURA 1SGDI 3GOXA 3R5DA 1Q9BA 2GVIA 1WTJA 2OD1A 1MJAA 3VE5A 1LR7A 2KMQA 2W0TA 5EX3A 2V1CA 1V1IA 2XRCA 3E59A 4FKDA 4UXJA 5FUVA 2PQ8A 1CT0I 1TBQR 2YQPA 2ROWA 5CCMA 5FUWA 5E3RA 2GKRI 1P9ZA 4UXIA 3FSXA 1Y1BA 2OU2A 4MPIA 2RIJA 4WP4A 3TO7A 3UEJA 1CSOI 3CXLA 1V1HA 1W3SA 1CE3A 1HPTA 2B0UC 1Y1CA 1OMUA 2NU2I 1N13A 1NXUA 1BMOA 1WGCA 5CCLA 1X74A 2N17A 2ERWA 1SGNI 2LUYA 1Z7KB 1CHOI 2DB6A 1MJBA 1WKXA 2FNFX 1XA6A 2UVOA 4SGBI 3UGDA 1PTQA 2Y0MA 3TOAA 1SGEI 3UGIA 2L7XA 1CT4I 1XX6A 4OVOA 1W4RA 2X52A 3OXGA 3D00A 1LR9A 1SGPI 3BJIA 1CT2I 1UVFA 1HJAI 2E5RA 2L8EA 1TUSA 1K7VA 1OYVI 1RFHA 1SGRI 2WVJA 3B4VC 5E3QA 3SGQI 1FAQA 1TBRR 1M8CA 2CWGA 1KBFA 3UEYA 3FC3A 2P6AC 2NU3I 5EX0A 3VDUA 3TO6A 7WGAA 2KMRA 1IY5A 2OZUA 2N52A 4DNCA 2ARPF 5J8FA 2BUSA 5DAEA 1IW4A 2M5XA 1XBTA 2UZ3A
chains in the Genus database with same CATH topology
1P9GA 1WGCA 2X3TA 1ULNA 2UVOA 1WKXA 1UHAA 1K7TA 1ULMA 1K7UA 1WGTA 1Q9BA 2X52A 2LB7A 1ULKA 1K7VA 9WGAA 2DKVA 2CWGA 1P9ZA 4MPIA 7WGAA 4WP4A 2WGCA 4AMLA 1HEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P9G A;  1WGC A;  2X3T A;  1ULN A;  2UVO A;  1WKX A;  1UHA A;  1K7T A;  1ULM A;  1K7U A;  1WGT A;  1Q9B A;  2X52 A;  2LB7 A;  1ULK A;  1K7V A;  9WGA A;  2DKV A;  2CWG A;  1P9Z A;  4MPI A;  7WGA A;  4WP4 A;  2WGC A;  4AML A;  1HEV A; 
#chains in the Genus database with same CATH topology
 2N71 A;  1VDD A;  1H0Z A;  2WCY A;  2V1C C;  3UFF A;  2X3T A;  4UXH A;  2NU0 I;  3KY9 A;  2SGF I;  2YUU A;  2GIV A;  1SGY I;  4B6D A;  1HDL A;  2SGQ I;  1KBE A;  2V53 A;  1S20 A;  1K7U A;  2VRW B;  1OMT A;  2KMP A;  1YTP A;  2ENN A;  3QWP A;  4HGU A;  1PCE A;  2LEO A;  3UOE A;  3OL0 A;  1NUB A;  1UVG A;  2N1A B;  1TBO A;  2QQE A;  2J9R A;  2NU1 I;  2JA1 A;  1PPF I;  3PDN A;  3QTL D;  2CWF A;  9WGA A;  2DKV A;  1BUS A;  1R0R I;  2CJS C;  1U5K A;  2JYY A;  3OXL A;  1MT1 A;  2JW6 A;  1UUC A;  2WGC A;  1YU6 C;  3OVO A;  1FYB A;  2QQ0 A;  2JZM A;  1IY6 A;  2F3C I;  1AN1 I;  4AML A;  5JHW C;  2SGD I;  2SGP I;  1P9G A;  3TOB A;  2NU4 I;  3R5B A;  4A24 A;  2ELI A;  2ORW A;  1UHA A;  1K7T A;  2KCX A;  2GKV A;  3HH2 C;  3FSY A;  3R5C A;  4JCV E;  1M8B A;  2JXD A;  3VDP A;  5J8C A;  1WGT A;  2DIP A;  3SEK C;  4L9M A;  2LB7 A;  1ULK A;  2GKT I;  3UGL A;  3QAH A;  2QPO A;  1PTR A;  1KMA A;  1MJ9 A;  1TIH A;  3SGB I;  1FAR A;  5E3P A;  4GI3 C;  5FUX A;  2ORV A;  3RU0 A;  3R5A A;  2ODD A;  3OXF A;  1DS2 I;  1X4S A;  2K9H A;  1TBN A;  1CGI I;  1R79 A;  2E73 A;  3E2I A;  2J87 A;  2A20 A;  1FY7 A;  5HQ8 A;  4E1R A;  1LR8 A;  1OVO A;  1Z2I A;  1HEV A;  2CWH A;  1TGS I;  2KMO A;  1TOT A;  2QQC A;  1CGJ I;  5FUY A;  1ULN A;  1PJU A;  2ENZ A;  4E1P A;  2SGE I;  2OVO A;  2QQD A;  3TJQ A;  1Y8F A;  5HI7 A;  1DS3 I;  1ULM A;  2B8T A;  2RC4 A;  3MEK A;  3TO9 A;  1SGQ I;  1TUR A;  1SGD I;  3GOX A;  3R5D A;  1Q9B A;  2GVI A;  1WTJ A;  2OD1 A;  1MJA A;  3VE5 A;  1LR7 A;  2KMQ A;  2W0T A;  5EX3 A;  2V1C A;  1V1I A;  2XRC A;  3E59 A;  4FKD A;  4UXJ A;  5FUV A;  2PQ8 A;  1CT0 I;  1TBQ R;  2YQP A;  2ROW A;  5CCM A;  5FUW A;  5E3R A;  2GKR I;  1P9Z A;  4UXI A;  3FSX A;  1Y1B A;  2OU2 A;  4MPI A;  2RIJ A;  4WP4 A;  3TO7 A;  3UEJ A;  1CSO I;  3CXL A;  1V1H A;  1W3S A;  1CE3 A;  1HPT A;  2B0U C;  1Y1C A;  1OMU A;  2NU2 I;  1N13 A;  1NXU A;  1BMO A;  1WGC A;  5CCL A;  1X74 A;  2N17 A;  2ERW A;  1SGN I;  2LUY A;  1Z7K B;  1CHO I;  2DB6 A;  1MJB A;  1WKX A;  2FNF X;  1XA6 A;  2UVO A;  4SGB I;  3UGD A;  1PTQ A;  2Y0M A;  3TOA A;  1SGE I;  3UGI A;  2L7X A;  1CT4 I;  1XX6 A;  4OVO A;  1W4R A;  2X52 A;  3OXG A;  3D00 A;  1LR9 A;  1SGP I;  3BJI A;  1CT2 I;  1UVF A;  1HJA I;  2E5R A;  2L8E A;  1TUS A;  1K7V A;  1OYV I;  1RFH A;  1SGR I;  2WVJ A;  3B4V C;  5E3Q A;  3SGQ I;  1FAQ A;  1TBR R;  1M8C A;  2CWG A;  1KBF A;  3UEY A;  3FC3 A;  2P6A C;  2NU3 I;  5EX0 A;  3VDU A;  3TO6 A;  7WGA A;  2KMR A;  1IY5 A;  2OZU A;  2N52 A;  4DNC A;  2ARP F;  5J8F A;  2BUS A;  5DAE A;  1IW4 A;  2M5X A;  1XBT A;  2UZ3 A; 
#chains in the Genus database with same CATH homology
 1P9G A;  1WGC A;  2X3T A;  1ULN A;  2UVO A;  1WKX A;  1UHA A;  1K7T A;  1ULM A;  1K7U A;  1WGT A;  1Q9B A;  2X52 A;  2LB7 A;  1ULK A;  1K7V A;  9WGA A;  2DKV A;  2CWG A;  1P9Z A;  4MPI A;  7WGA A;  4WP4 A;  2WGC A;  4AML A;  1HEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...