1K83K

Crystal structure of yeast rna polymerase ii complexed with the inhibitor alpha amanitin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Transcription: Alpha-Amanitin-RNA Polymerase II Cocrystal at 2.8 A Resolution.
pubmed doi rcsb
molecule tags Transcription/toxin
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1k83K00
3M3YC 4X6AC 5TMCA 1YNNA 3FKIC 2WAQL 3S1MC 4KN4A 2JA7C 4BBSK 2JA6C 4YFNA 3PO2K 3M4OK 4NOIA 1SFOK 3I4MC 1IW7A 2JA7K 1TWAC 1TWGK 2Y0SL 3HOYK 2R92K 2JA5C 4A3KK 1TWHC 3GTOK 3S17C 4A3GK 2NVXK 1TWCK 4XLNA 4A3IC 4LK1A 4YFXA 5M3MK 4QIWD 3RZDC 2B63K 2BE5A 2NVQC 4LK0A 3GTKK 2NVTK 2R7ZK 1I6HC 4BBRC 5M3FK 5IYCK 2YU9C 1Y1VC 4KN7A 3HOVC 5IP7K 3M4OC 2PMZL 3HOWC 3HOXC 3EQLA 3GTLK 2CW0A 2JA5K 3PO3K 2O5JA 4YFKA 3HOXK 4JK1A 4G7ZA 4BY1C 2VUMC 3K7AK 5IYDC 5C3EK 5FLMC 3HOZK 1I6VA 3S1NK 2VUMK 4BY7K 4A3BC 3S17K 3H3VL 3CQZC 3GTQK 4A3DC 3PO3C 1SMYA 5C44K 3S15C 1TWAK 2WB1L 3S16C 4Y7NC 4A3JC 4A3FK 5FJ8K 2A69A 2Y0SD 3DXJA 3GTKC 3H3VD 1TWFK 2E2IC 4BBRK 1XPPA 4BY7C 2A6HA 3S1RC 1TWGC 3HOYC 4QJVA 4A93K 3K7AC 5C44C 4MEYA 4A3GC 4C3HK 4AYBL 3GTMC 3S2HC 2A68A 4LLGA 4OINA 3HOUC 2NVYK 5M5XK 3I4NK 4A3DK 3GTPK 4A3KC 3S2DC 4BXXC 4OIQA 4BBSC 3S16K 5C4JC 4OIRA 1SFOC 2PMZD 2PPBA 3I4MK 4A3MK 1R9TC 5C4XC 3M3YK 2WB1D 3CQZK 3H0GK 2E2JC 1TWHK 3HKZL 4A3MC 2E2HK 4ZH4A 3WODA 5FLMK 4Y7NK 4A3JK 4C3JK 2WAQD 5IYCC 4G7HA 4BXXK 1HQMA 2PA8L 3S1QC 3HOVK 3GTQC 5TMFA 1K83C 1I50C 3FKIK 3HKZD 4XLPA 2JA8K 1R9TK 1I3QK 3GTJK 3HOUK 1I6HK 3HOZC 4C2MK 1BDFA 4KMUA 1TWCC 4A3IK 3GTGC 4G7OA 4OIPA 2A6EA 4BY1K 3S1MK 4GZYA 1WCMC 2NVTC 3H0GC 2E2JK 1Y1WC 2JA8C 3GTOC 1WCMK 5IP7C 3S2HK 5C4JK 3S14K 4Y52C 2R93C 5IYDK 3S15K 3S1RK 3GTGK 2JA6K 2NVXC 2R7ZC 4A3CC 4A3LK 4A3BK 1I3QC 2PA8D 4X6AK 2R92C 5M5WK 3RZOC 3HOWK 5C3EC 4XSZA 3PO2C 3GTPC 3S14C 3RZOK 3S2DK 2R93K 2YU9K 2E2HC 3GTJC 4OIOA 1TWFC 3GTMK 1Y1WK 4A3CK 4Q5SA 5IYBK 4QJVB 3RZDK 5C4XK 5IP9K 4AYBD 4A3FC 4A93C 4Y52K 4MQ9A 5IYBC 1Y1VK 4MEXA 5IP9C 1ZYRA 4A3EC 2E2IK 4XSXA 5D4DA 2B63C 2NVQK 2NVYC 3I4NC 3S1QK 4A3EK 2O5IA 4QIWL 4Q4ZA 3GTLC 1I50K 1K83K 3S1NC 4C3IK 4YG2A 1YNJA 5M5YK 4LJZA 4A3LC
chains in the Genus database with same CATH superfamily
3ADAC 3BUEA 5TMCA 1O27A 4KN4A 4M1XA 4YFNA 1SFOK 2JA7K 1EQRA 2R92K 1TWHC 5EGEA 1VJEA 1KQ4A 5IOQA 1TWCK 4A3IC 4YFXA 3G4CA 3MMLB 2NVQC 4LK0A 1I6HC 2R7ZK 3HXAA 2E2HA 4P9SA 1I50A 1VGXA 5IP7K 3M4OC 3OEPA 2O5JA 3PO3K 2EBBA 3TFIA 3HOXK 3GTPA 3K7AK 1PJ5A 5FLMC 1I6VA 1O2BA 4LQYA 3T00A 2VUMK 4XCHA 4A3BC 3CQZC 3GTQK 1JOEA 3PO3C 1TWAK 2W7VA 3V4GA 4A3FK 3QX3A 4AH6A 1L0WA 3GTKC 2A6HA 4QJVA 3GTKA 4GTAA 2E2IA 2P8TA 3N0CA 2A68A 3HOUC 1C0AA 4LOWA 4A3KC 5IOTA 3GTPK 4KMAA 4KATA 4GTLA 1SFOC 1WSVA 4A3MK 1R9TC 5EGHA 5C4XC 3HKZL 1V5VA 2E2HK 5FLMK 4Y7NK 4A3JK 1O2AA 4PAAA 4C3JK 2WAQD 5IYCC 4LR2A 4G0WA 3GTOK 1I50C 3FKIK 4XLPA 1R9TK 4KC6A 5CHPA 3GTJK 1I6HK 2P5MA 1PJ7A 3LAJA 3FOEA 2A6EA 3H0GC 3GEIA 2E2JK 3AQOA 2JA8C 1B4BA 1WOSA 3S14K 1DCOA 1ISEA 3S1RK 3S15K 2R92A 4A3BK 2JH3A 1UV7A 3HOWK 5C3EC 1INNA 4KB4A 2YU9K 2VUMA 1ZBSA 4GT9A 2E2HC 4Q5SA 3GTMK 2PHCB 4A93C 4Y52K 5IYBC 3Q3QA 4C2MC 2NVQK 3S1QK 3GTLC 3S1NC 1XXBA 3A8KA 3FKIA 5M5YK 3HKZD 4A3LC 3GDZA 3M3YC 4X6AC 1YNNA 1TWAA 2WAQL 3S1MC 2JA7C 4KM9A 1IW7A 2Y0SL 2JA5C 4A3GK 3VA7A 4XLNA 5M3MK 3GTOA 2GAHC 4KM8A 3L4JA 5JFEA 1J6VA 4BBRC 5M3FK 5IYCK 2RGRA 4GFQA 3TFHA 4KASA 1EH1A 3HOXC 1YX2A 4YFKA 4BY1C 5IYDC 5C3EK 4ILDA 1EK8A 3HOZK 1DCHA 4BY7K 3N0BA 2R93A 3H3VL 3GEHA 5C44K 3S15C 4GTBA 2Y0SD 1WSRA 1TWFK 4BY7C 4WJ3M 4P5AA 1TWHA 4C45A 3K7AC 1ZVUA 4AYBL 3GTMC 4LLGA 3LAPA 3I4NK 4BBSC 3S16K 1WOOA 5C4JC 3I4MK 4A3MC 4ZH4A 3WODA 2KWAA 4G7HA 4BXXK 2ZUFA 3AD7C 1K83C 1Y1VA 4PABA 3GTGA 3HOUK 3AH5A 1TWCC 4A3IK 1Y1WA 3CQZA 4G0VA 3S1MK 4GZYA 2NVTC 2XCRB 1Y1WC 2RH6A 2NVXA 1F9NA 3S2HK 2R93C 4Y52C 1I3QA 5IYDK 4A3CC 2XCOA 2PA8D 3FHZA 5M5WK 3PO2C 3GTPC 2R93K 3CAGA 1TWFC 1F7VA 4A3CK 5JVOA 5C4XK 2V6UA 2V6SA 5IP9K 4MEXA 3NUHA 4A3EC 1ZXOA 1GE9A 2V6TA 1WIHA 4WJ4A 4YG2A 1RU0A 1IBAA 3FKIC 1TWAC 1J6XA 1TWGK 3HOYK 1TWCA 1SFOA 2NVXK 4C3IC 1X31C 2CFAB 1G51A 2YU9A 3TTGA 1BS2A 2B63K 2BE5A 2NVTK 4FZBA 1WQHA 2YU9C 4KN7A 4FM9A 1O26A 3HOVC 1B4AA 2PMZL 3HOWC 1XZPB 2JA5K 4WILA 5HL8A 4G7ZA 3GEEA 3H0GA 2FQTA 4GTFA 3A8JA 3S1NK 1BGWA 1VRQC 2CFAA 3S17K 4A3DC 1SMYA 2WB1L 3S16C 4KMHA 5FJ8K 4KDDA 2A69A 3DXJA 3G4AA 1XZQB 4BBRK 2E2IC 1XPPA 5IORA 4A93K 4A3GC 1TWGA 4C3HK 2NVYK 5E68A 3S2DC 4OIQA 3GTJA 3LPXA 1ZQ1C 2PMZD 3M3YK 1TWHK 1USOA 1HQMA 2PA8L 3GTQC 5TMFA 2JA8K 3HOZC 4C2MK 1WCMA 1O29A 1IS1A 3GTGC 1XZQA 4BY1K 1XXCA 3GTOC 1WCMK 4C3HC 5C4JK 4G0UA 5CJ9A 3GTGK 2JA6K 2NVXC 2R7ZC 2FQOA 1I3QC 3GSIA 3SZZA 4XSZA 1J6WA 3S14C 3RZOK 1VLOA 3AD9C 3L4KA 1Y1WK 3RZDK 4KAWX 2GSNA 4MQ9A 1Y1VK 5IP9C 1ZYRA 3IPJA 5D4DA 2B63C 2GSUA 2NVYC 4A3EK 5L46A 4Q4ZA 1K83K 4C3IK 3SZYA 1YNJA 2JA6A 1J98A 4LJZA 4KB2A 3OPFA 4DDQA 3BP3A 4BBSK 2JA6C 3PO2K 3M4OK 4NOIA 3I4MC 2Y3PA 4C3JC 4A3KK 2JA7A 3S17C 2XCQA 4LK1A 3FOFA 3ERED 4QIWD 3RZDC 1F7UA 3GTKK 3OREA 1Y1VC 1K83A 1R9TA 3A8IA 1IQ0A 3EQLA 3GTLK 2CW0A 5IOSA 4JK1A 4RMFA 2VUMC 1DCPA 1JQWA 1IE0A 1EFWA 2ZFZA 4Y7NC 4A3JC 2B63A 3H3VD 4BLAA 1HI9A 4KMDA 3S1RC 1TWGC 2GAGC 3HOYC 1O28A 1USMA 3TFJA 1TWFA 4MEYA 1O25A 5C44C 4GTCA 3S2HC 1DD5A 4OINA 5M5XK 4A3DK 3GIRA 3T02A 1AB4A 4BXXC 2JA5A 4OIRA 2PPBA 1XXAA 2WB1D 3CQZK 3S0XA 3H0GK 2E2JC 1VH2A 4O2DA 1F93A 1WOPA 4BKWA 1XZPA 3S1QC 3HOVK 4GTEA 1I3QK 1PJ6A 3BP8C 4KMUA 1BDFA 3GTQA 1YCLA 4P5BA 1O24A 4G7OA 4OIPA 1WCMC 4GTDA 1JVIA 3AQPA 4BLBA 5IP7C 3T01A 2D6FC 4A3LK 4X6AK 5TJ3A 2R92C 1WQGA 3RZOC 2R7ZA 1IL2A 3S2DK 3GTJC 4OIOA 2ZUEA 5IYBK 2GSOA 3AD8C 4QJVB 3GTMA 4AYBD 4A3FC 3N3YA 2NVYA 3GTLA 1EI6A 1WQFA 2E2IK 4XSXA 3I4NC 1WORA 2O5IA 4J3NA 4QIWL 1O2FB 1I50K 1BJTA 3JSTA 4KARA
chains in the Genus database with same CATH topology
3M3YC 4X6AC 5TMCA 1YNNA 3FKIC 2WAQL 3S1MC 4KN4A 2JA7C 4BBSK 2JA6C 4YFNA 3PO2K 3M4OK 4NOIA 1SFOK 3I4MC 1IW7A 2JA7K 1TWAC 1TWGK 2Y0SL 3HOYK 2R92K 2JA5C 4A3KK 1TWHC 3GTOK 3S17C 4A3GK 2NVXK 1TWCK 4XLNA 4A3IC 4LK1A 4YFXA 5M3MK 4QIWD 3RZDC 2B63K 2BE5A 2NVQC 4LK0A 3GTKK 2NVTK 2R7ZK 1I6HC 4BBRC 5M3FK 5IYCK 2YU9C 1Y1VC 4KN7A 3HOVC 5IP7K 3M4OC 2PMZL 3HOWC 3HOXC 3EQLA 3GTLK 2CW0A 2JA5K 3PO3K 2O5JA 4YFKA 3HOXK 4JK1A 4G7ZA 4BY1C 2VUMC 3K7AK 5IYDC 5C3EK 5FLMC 3HOZK 1I6VA 3S1NK 2VUMK 4BY7K 4A3BC 3S17K 3H3VL 3CQZC 3GTQK 4A3DC 3PO3C 1SMYA 5C44K 3S15C 1TWAK 2WB1L 3S16C 4Y7NC 4A3JC 4A3FK 5FJ8K 2A69A 2Y0SD 3DXJA 3GTKC 3H3VD 1TWFK 2E2IC 4BBRK 1XPPA 4BY7C 2A6HA 3S1RC 1TWGC 3HOYC 4QJVA 4A93K 3K7AC 5C44C 4MEYA 4A3GC 4C3HK 4AYBL 3GTMC 3S2HC 2A68A 4LLGA 4OINA 3HOUC 2NVYK 5M5XK 3I4NK 4A3DK 3GTPK 4A3KC 3S2DC 4BXXC 4OIQA 4BBSC 3S16K 5C4JC 4OIRA 1SFOC 2PMZD 2PPBA 3I4MK 4A3MK 1R9TC 5C4XC 3M3YK 2WB1D 3CQZK 3H0GK 2E2JC 1TWHK 3HKZL 4A3MC 2E2HK 4ZH4A 3WODA 5FLMK 4Y7NK 4A3JK 4C3JK 2WAQD 5IYCC 4G7HA 4BXXK 1HQMA 2PA8L 3S1QC 3HOVK 3GTQC 5TMFA 1K83C 1I50C 3FKIK 3HKZD 4XLPA 2JA8K 1R9TK 1I3QK 3GTJK 3HOUK 1I6HK 3HOZC 4C2MK 1BDFA 4KMUA 1TWCC 4A3IK 3GTGC 4G7OA 4OIPA 2A6EA 4BY1K 3S1MK 4GZYA 1WCMC 2NVTC 3H0GC 2E2JK 1Y1WC 2JA8C 3GTOC 1WCMK 5IP7C 3S2HK 5C4JK 3S14K 4Y52C 2R93C 5IYDK 3S15K 3S1RK 3GTGK 2JA6K 2NVXC 2R7ZC 4A3CC 4A3LK 4A3BK 1I3QC 2PA8D 4X6AK 2R92C 5M5WK 3RZOC 3HOWK 5C3EC 4XSZA 3PO2C 3GTPC 3S14C 3RZOK 3S2DK 2R93K 2YU9K 2E2HC 3GTJC 4OIOA 1TWFC 3GTMK 1Y1WK 4A3CK 4Q5SA 5IYBK 4QJVB 3RZDK 5C4XK 5IP9K 4AYBD 4A3FC 4A93C 4Y52K 4MQ9A 5IYBC 1Y1VK 4MEXA 5IP9C 1ZYRA 4A3EC 2E2IK 4XSXA 5D4DA 2B63C 2NVQK 2NVYC 3I4NC 3S1QK 4A3EK 2O5IA 4QIWL 4Q4ZA 3GTLC 1I50K 1K83K 3S1NC 4C3IK 4YG2A 1YNJA 5M5YK 4LJZA 4A3LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3Y C;  4X6A C;  5TMC A;  1YNN A;  3FKI C;  2WAQ L;  3S1M C;  4KN4 A;  2JA7 C;  4BBS K;  2JA6 C;  4YFN A;  3PO2 K;  3M4O K;  4NOI A;  1SFO K;  3I4M C;  1IW7 A;  2JA7 K;  1TWA C;  1TWG K;  2Y0S L;  3HOY K;  2R92 K;  2JA5 C;  4A3K K;  1TWH C;  3GTO K;  3S17 C;  4A3G K;  2NVX K;  1TWC K;  4XLN A;  4A3I C;  4LK1 A;  4YFX A;  5M3M K;  4QIW D;  3RZD C;  2B63 K;  2BE5 A;  2NVQ C;  4LK0 A;  3GTK K;  2NVT K;  2R7Z K;  1I6H C;  4BBR C;  5M3F K;  5IYC K;  2YU9 C;  1Y1V C;  4KN7 A;  3HOV C;  5IP7 K;  3M4O C;  2PMZ L;  3HOW C;  3HOX C;  3EQL A;  3GTL K;  2CW0 A;  2JA5 K;  3PO3 K;  2O5J A;  4YFK A;  3HOX K;  4JK1 A;  4G7Z A;  4BY1 C;  2VUM C;  3K7A K;  5IYD C;  5C3E K;  5FLM C;  3HOZ K;  1I6V A;  3S1N K;  2VUM K;  4BY7 K;  4A3B C;  3S17 K;  3H3V L;  3CQZ C;  3GTQ K;  4A3D C;  3PO3 C;  1SMY A;  5C44 K;  3S15 C;  1TWA K;  2WB1 L;  3S16 C;  4Y7N C;  4A3J C;  4A3F K;  5FJ8 K;  2A69 A;  2Y0S D;  3DXJ A;  3GTK C;  3H3V D;  1TWF K;  2E2I C;  4BBR K;  1XPP A;  4BY7 C;  2A6H A;  3S1R C;  1TWG C;  3HOY C;  4QJV A;  4A93 K;  3K7A C;  5C44 C;  4MEY A;  4A3G C;  4C3H K;  4AYB L;  3GTM C;  3S2H C;  2A68 A;  4LLG A;  4OIN A;  3HOU C;  2NVY K;  5M5X K;  3I4N K;  4A3D K;  3GTP K;  4A3K C;  3S2D C;  4BXX C;  4OIQ A;  4BBS C;  3S16 K;  5C4J C;  4OIR A;  1SFO C;  2PMZ D;  2PPB A;  3I4M K;  4A3M K;  1R9T C;  5C4X C;  3M3Y K;  2WB1 D;  3CQZ K;  3H0G K;  2E2J C;  1TWH K;  3HKZ L;  4A3M C;  2E2H K;  4ZH4 A;  3WOD A;  5FLM K;  4Y7N K;  4A3J K;  4C3J K;  2WAQ D;  5IYC C;  4G7H A;  4BXX K;  1HQM A;  2PA8 L;  3S1Q C;  3HOV K;  3GTQ C;  5TMF A;  1K83 C;  1I50 C;  3FKI K;  3HKZ D;  4XLP A;  2JA8 K;  1R9T K;  1I3Q K;  3GTJ K;  3HOU K;  1I6H K;  3HOZ C;  4C2M K;  1BDF A;  4KMU A;  1TWC C;  4A3I K;  3GTG C;  4G7O A;  4OIP A;  2A6E A;  4BY1 K;  3S1M K;  4GZY A;  1WCM C;  2NVT C;  3H0G C;  2E2J K;  1Y1W C;  2JA8 C;  3GTO C;  1WCM K;  5IP7 C;  3S2H K;  5C4J K;  3S14 K;  4Y52 C;  2R93 C;  5IYD K;  3S15 K;  3S1R K;  3GTG K;  2JA6 K;  2NVX C;  2R7Z C;  4A3C C;  4A3L K;  4A3B K;  1I3Q C;  2PA8 D;  4X6A K;  2R92 C;  5M5W K;  3RZO C;  3HOW K;  5C3E C;  4XSZ A;  3PO2 C;  3GTP C;  3S14 C;  3RZO K;  3S2D K;  2R93 K;  2YU9 K;  2E2H C;  3GTJ C;  4OIO A;  1TWF C;  3GTM K;  1Y1W K;  4A3C K;  4Q5S A;  5IYB K;  4QJV B;  3RZD K;  5C4X K;  5IP9 K;  4AYB D;  4A3F C;  4A93 C;  4Y52 K;  4MQ9 A;  5IYB C;  1Y1V K;  4MEX A;  5IP9 C;  1ZYR A;  4A3E C;  2E2I K;  4XSX A;  5D4D A;  2B63 C;  2NVQ K;  2NVY C;  3I4N C;  3S1Q K;  4A3E K;  2O5I A;  4QIW L;  4Q4Z A;  3GTL C;  1I50 K;  1K83 K;  3S1N C;  4C3I K;  4YG2 A;  1YNJ A;  5M5Y K;  4LJZ A;  4A3L C; 
#chains in the Genus database with same CATH topology
 3ADA C;  3BUE A;  5TMC A;  1O27 A;  4KN4 A;  4M1X A;  4YFN A;  1SFO K;  2JA7 K;  1EQR A;  2R92 K;  1TWH C;  5EGE A;  1VJE A;  1KQ4 A;  5IOQ A;  1TWC K;  4A3I C;  4YFX A;  3G4C A;  3MML B;  2NVQ C;  4LK0 A;  1I6H C;  2R7Z K;  3HXA A;  2E2H A;  4P9S A;  1I50 A;  1VGX A;  5IP7 K;  3M4O C;  3OEP A;  2O5J A;  3PO3 K;  2EBB A;  3TFI A;  3HOX K;  3GTP A;  3K7A K;  1PJ5 A;  5FLM C;  1I6V A;  1O2B A;  4LQY A;  3T00 A;  2VUM K;  4XCH A;  4A3B C;  3CQZ C;  3GTQ K;  1JOE A;  3PO3 C;  1TWA K;  2W7V A;  3V4G A;  4A3F K;  3QX3 A;  4AH6 A;  1L0W A;  3GTK C;  2A6H A;  4QJV A;  3GTK A;  4GTA A;  2E2I A;  2P8T A;  3N0C A;  2A68 A;  3HOU C;  1C0A A;  4LOW A;  4A3K C;  5IOT A;  3GTP K;  4KMA A;  4KAT A;  4GTL A;  1SFO C;  1WSV A;  4A3M K;  1R9T C;  5EGH A;  5C4X C;  3HKZ L;  1V5V A;  2E2H K;  5FLM K;  4Y7N K;  4A3J K;  1O2A A;  4PAA A;  4C3J K;  2WAQ D;  5IYC C;  4LR2 A;  4G0W A;  3GTO K;  1I50 C;  3FKI K;  4XLP A;  1R9T K;  4KC6 A;  5CHP A;  3GTJ K;  1I6H K;  2P5M A;  1PJ7 A;  3LAJ A;  3FOE A;  2A6E A;  3H0G C;  3GEI A;  2E2J K;  3AQO A;  2JA8 C;  1B4B A;  1WOS A;  3S14 K;  1DCO A;  1ISE A;  3S1R K;  3S15 K;  2R92 A;  4A3B K;  2JH3 A;  1UV7 A;  3HOW K;  5C3E C;  1INN A;  4KB4 A;  2YU9 K;  2VUM A;  1ZBS A;  4GT9 A;  2E2H C;  4Q5S A;  3GTM K;  2PHC B;  4A93 C;  4Y52 K;  5IYB C;  3Q3Q A;  4C2M C;  2NVQ K;  3S1Q K;  3GTL C;  3S1N C;  1XXB A;  3A8K A;  3FKI A;  5M5Y K;  3HKZ D;  4A3L C;  3GDZ A;  3M3Y C;  4X6A C;  1YNN A;  1TWA A;  2WAQ L;  3S1M C;  2JA7 C;  4KM9 A;  1IW7 A;  2Y0S L;  2JA5 C;  4A3G K;  3VA7 A;  4XLN A;  5M3M K;  3GTO A;  2GAH C;  4KM8 A;  3L4J A;  5JFE A;  1J6V A;  4BBR C;  5M3F K;  5IYC K;  2RGR A;  4GFQ A;  3TFH A;  4KAS A;  1EH1 A;  3HOX C;  1YX2 A;  4YFK A;  4BY1 C;  5IYD C;  5C3E K;  4ILD A;  1EK8 A;  3HOZ K;  1DCH A;  4BY7 K;  3N0B A;  2R93 A;  3H3V L;  3GEH A;  5C44 K;  3S15 C;  4GTB A;  2Y0S D;  1WSR A;  1TWF K;  4BY7 C;  4WJ3 M;  4P5A A;  1TWH A;  4C45 A;  3K7A C;  1ZVU A;  4AYB L;  3GTM C;  4LLG A;  3LAP A;  3I4N K;  4BBS C;  3S16 K;  1WOO A;  5C4J C;  3I4M K;  4A3M C;  4ZH4 A;  3WOD A;  2KWA A;  4G7H A;  4BXX K;  2ZUF A;  3AD7 C;  1K83 C;  1Y1V A;  4PAB A;  3GTG A;  3HOU K;  3AH5 A;  1TWC C;  4A3I K;  1Y1W A;  3CQZ A;  4G0V A;  3S1M K;  4GZY A;  2NVT C;  2XCR B;  1Y1W C;  2RH6 A;  2NVX A;  1F9N A;  3S2H K;  2R93 C;  4Y52 C;  1I3Q A;  5IYD K;  4A3C C;  2XCO A;  2PA8 D;  3FHZ A;  5M5W K;  3PO2 C;  3GTP C;  2R93 K;  3CAG A;  1TWF C;  1F7V A;  4A3C K;  5JVO A;  5C4X K;  2V6U A;  2V6S A;  5IP9 K;  4MEX A;  3NUH A;  4A3E C;  1ZXO A;  1GE9 A;  2V6T A;  1WIH A;  4WJ4 A;  4YG2 A;  1RU0 A;  1IBA A;  3FKI C;  1TWA C;  1J6X A;  1TWG K;  3HOY K;  1TWC A;  1SFO A;  2NVX K;  4C3I C;  1X31 C;  2CFA B;  1G51 A;  2YU9 A;  3TTG A;  1BS2 A;  2B63 K;  2BE5 A;  2NVT K;  4FZB A;  1WQH A;  2YU9 C;  4KN7 A;  4FM9 A;  1O26 A;  3HOV C;  1B4A A;  2PMZ L;  3HOW C;  1XZP B;  2JA5 K;  4WIL A;  5HL8 A;  4G7Z A;  3GEE A;  3H0G A;  2FQT A;  4GTF A;  3A8J A;  3S1N K;  1BGW A;  1VRQ C;  2CFA A;  3S17 K;  4A3D C;  1SMY A;  2WB1 L;  3S16 C;  4KMH A;  5FJ8 K;  4KDD A;  2A69 A;  3DXJ A;  3G4A A;  1XZQ B;  4BBR K;  2E2I C;  1XPP A;  5IOR A;  4A93 K;  4A3G C;  1TWG A;  4C3H K;  2NVY K;  5E68 A;  3S2D C;  4OIQ A;  3GTJ A;  3LPX A;  1ZQ1 C;  2PMZ D;  3M3Y K;  1TWH K;  1USO A;  1HQM A;  2PA8 L;  3GTQ C;  5TMF A;  2JA8 K;  3HOZ C;  4C2M K;  1WCM A;  1O29 A;  1IS1 A;  3GTG C;  1XZQ A;  4BY1 K;  1XXC A;  3GTO C;  1WCM K;  4C3H C;  5C4J K;  4G0U A;  5CJ9 A;  3GTG K;  2JA6 K;  2NVX C;  2R7Z C;  2FQO A;  1I3Q C;  3GSI A;  3SZZ A;  4XSZ A;  1J6W A;  3S14 C;  3RZO K;  1VLO A;  3AD9 C;  3L4K A;  1Y1W K;  3RZD K;  4KAW X;  2GSN A;  4MQ9 A;  1Y1V K;  5IP9 C;  1ZYR A;  3IPJ A;  5D4D A;  2B63 C;  2GSU A;  2NVY C;  4A3E K;  5L46 A;  4Q4Z A;  1K83 K;  4C3I K;  3SZY A;  1YNJ A;  2JA6 A;  1J98 A;  4LJZ A;  4KB2 A;  3OPF A;  4DDQ A;  3BP3 A;  4BBS K;  2JA6 C;  3PO2 K;  3M4O K;  4NOI A;  3I4M C;  2Y3P A;  4C3J C;  4A3K K;  2JA7 A;  3S17 C;  2XCQ A;  4LK1 A;  3FOF A;  3ERE D;  4QIW D;  3RZD C;  1F7U A;  3GTK K;  3ORE A;  1Y1V C;  1K83 A;  1R9T A;  3A8I A;  1IQ0 A;  3EQL A;  3GTL K;  2CW0 A;  5IOS A;  4JK1 A;  4RMF A;  2VUM C;  1DCP A;  1JQW A;  1IE0 A;  1EFW A;  2ZFZ A;  4Y7N C;  4A3J C;  2B63 A;  3H3V D;  4BLA A;  1HI9 A;  4KMD A;  3S1R C;  1TWG C;  2GAG C;  3HOY C;  1O28 A;  1USM A;  3TFJ A;  1TWF A;  4MEY A;  1O25 A;  5C44 C;  4GTC A;  3S2H C;  1DD5 A;  4OIN A;  5M5X K;  4A3D K;  3GIR A;  3T02 A;  1AB4 A;  4BXX C;  2JA5 A;  4OIR A;  2PPB A;  1XXA A;  2WB1 D;  3CQZ K;  3S0X A;  3H0G K;  2E2J C;  1VH2 A;  4O2D A;  1F93 A;  1WOP A;  4BKW A;  1XZP A;  3S1Q C;  3HOV K;  4GTE A;  1I3Q K;  1PJ6 A;  3BP8 C;  4KMU A;  1BDF A;  3GTQ A;  1YCL A;  4P5B A;  1O24 A;  4G7O A;  4OIP A;  1WCM C;  4GTD A;  1JVI A;  3AQP A;  4BLB A;  5IP7 C;  3T01 A;  2D6F C;  4A3L K;  4X6A K;  5TJ3 A;  2R92 C;  1WQG A;  3RZO C;  2R7Z A;  1IL2 A;  3S2D K;  3GTJ C;  4OIO A;  2ZUE A;  5IYB K;  2GSO A;  3AD8 C;  4QJV B;  3GTM A;  4AYB D;  4A3F C;  3N3Y A;  2NVY A;  3GTL A;  1EI6 A;  1WQF A;  2E2I K;  4XSX A;  3I4N C;  1WOR A;  2O5I A;  4J3N A;  4QIW L;  1O2F B;  1I50 K;  1BJT A;  3JST A;  4KAR A; 
#chains in the Genus database with same CATH homology
 3M3Y C;  4X6A C;  5TMC A;  1YNN A;  3FKI C;  2WAQ L;  3S1M C;  4KN4 A;  2JA7 C;  4BBS K;  2JA6 C;  4YFN A;  3PO2 K;  3M4O K;  4NOI A;  1SFO K;  3I4M C;  1IW7 A;  2JA7 K;  1TWA C;  1TWG K;  2Y0S L;  3HOY K;  2R92 K;  2JA5 C;  4A3K K;  1TWH C;  3GTO K;  3S17 C;  4A3G K;  2NVX K;  1TWC K;  4XLN A;  4A3I C;  4LK1 A;  4YFX A;  5M3M K;  4QIW D;  3RZD C;  2B63 K;  2BE5 A;  2NVQ C;  4LK0 A;  3GTK K;  2NVT K;  2R7Z K;  1I6H C;  4BBR C;  5M3F K;  5IYC K;  2YU9 C;  1Y1V C;  4KN7 A;  3HOV C;  5IP7 K;  3M4O C;  2PMZ L;  3HOW C;  3HOX C;  3EQL A;  3GTL K;  2CW0 A;  2JA5 K;  3PO3 K;  2O5J A;  4YFK A;  3HOX K;  4JK1 A;  4G7Z A;  4BY1 C;  2VUM C;  3K7A K;  5IYD C;  5C3E K;  5FLM C;  3HOZ K;  1I6V A;  3S1N K;  2VUM K;  4BY7 K;  4A3B C;  3S17 K;  3H3V L;  3CQZ C;  3GTQ K;  4A3D C;  3PO3 C;  1SMY A;  5C44 K;  3S15 C;  1TWA K;  2WB1 L;  3S16 C;  4Y7N C;  4A3J C;  4A3F K;  5FJ8 K;  2A69 A;  2Y0S D;  3DXJ A;  3GTK C;  3H3V D;  1TWF K;  2E2I C;  4BBR K;  1XPP A;  4BY7 C;  2A6H A;  3S1R C;  1TWG C;  3HOY C;  4QJV A;  4A93 K;  3K7A C;  5C44 C;  4MEY A;  4A3G C;  4C3H K;  4AYB L;  3GTM C;  3S2H C;  2A68 A;  4LLG A;  4OIN A;  3HOU C;  2NVY K;  5M5X K;  3I4N K;  4A3D K;  3GTP K;  4A3K C;  3S2D C;  4BXX C;  4OIQ A;  4BBS C;  3S16 K;  5C4J C;  4OIR A;  1SFO C;  2PMZ D;  2PPB A;  3I4M K;  4A3M K;  1R9T C;  5C4X C;  3M3Y K;  2WB1 D;  3CQZ K;  3H0G K;  2E2J C;  1TWH K;  3HKZ L;  4A3M C;  2E2H K;  4ZH4 A;  3WOD A;  5FLM K;  4Y7N K;  4A3J K;  4C3J K;  2WAQ D;  5IYC C;  4G7H A;  4BXX K;  1HQM A;  2PA8 L;  3S1Q C;  3HOV K;  3GTQ C;  5TMF A;  1K83 C;  1I50 C;  3FKI K;  3HKZ D;  4XLP A;  2JA8 K;  1R9T K;  1I3Q K;  3GTJ K;  3HOU K;  1I6H K;  3HOZ C;  4C2M K;  1BDF A;  4KMU A;  1TWC C;  4A3I K;  3GTG C;  4G7O A;  4OIP A;  2A6E A;  4BY1 K;  3S1M K;  4GZY A;  1WCM C;  2NVT C;  3H0G C;  2E2J K;  1Y1W C;  2JA8 C;  3GTO C;  1WCM K;  5IP7 C;  3S2H K;  5C4J K;  3S14 K;  4Y52 C;  2R93 C;  5IYD K;  3S15 K;  3S1R K;  3GTG K;  2JA6 K;  2NVX C;  2R7Z C;  4A3C C;  4A3L K;  4A3B K;  1I3Q C;  2PA8 D;  4X6A K;  2R92 C;  5M5W K;  3RZO C;  3HOW K;  5C3E C;  4XSZ A;  3PO2 C;  3GTP C;  3S14 C;  3RZO K;  3S2D K;  2R93 K;  2YU9 K;  2E2H C;  3GTJ C;  4OIO A;  1TWF C;  3GTM K;  1Y1W K;  4A3C K;  4Q5S A;  5IYB K;  4QJV B;  3RZD K;  5C4X K;  5IP9 K;  4AYB D;  4A3F C;  4A93 C;  4Y52 K;  4MQ9 A;  5IYB C;  1Y1V K;  4MEX A;  5IP9 C;  1ZYR A;  4A3E C;  2E2I K;  4XSX A;  5D4D A;  2B63 C;  2NVQ K;  2NVY C;  3I4N C;  3S1Q K;  4A3E K;  2O5I A;  4QIW L;  4Q4Z A;  3GTL C;  1I50 K;  1K83 K;  3S1N C;  4C3I K;  4YG2 A;  1YNJ A;  5M5Y K;  4LJZ A;  4A3L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...