1K83K

Crystal structure of yeast rna polymerase ii complexed with the inhibitor alpha amanitin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Transcription: Alpha-Amanitin-RNA Polymerase II Cocrystal at 2.8 A Resolution.
pubmed doi rcsb
molecule tags Transcription/toxin
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1k83K00
4BY1K 4A3KK 5D4DA 2YU9C 3CQZC 4A3JC 4MEYA 1Y1WK 3HOYK 3GTKK 3CQZK 4A3JK 3S1MK 4A3EC 2VUMC 2B63K 3GTMC 5M3FK 4BY1C 5M5XK 4QIWD 2NVYK 4OIRA 3HOWC 2JA7C 3I4MC 5C44C 5C44K 4YFXA 4A3FK 4XSZA 4A3FC 2PA8D 3HOWK 5IYCC 2NVXC 3K7AK 4BBSC 3EQLA 5C3EK 5C3EC 2PA8L 5IP7K 1I3QK 3S14K 4BXXK 4C3HK 3S1QK 3GTGK 4A3KC 3S1NC 4Q5SA 4LK1A 5IYDC 4A3LC 4QJVA 4Y7NC 2NVYC 3PO3K 4YFKA 3FKIC 1SMYA 1TWFC 3GTPC 4C2MK 3S1RK 3HOYC 2PMZL 5FLMC 3HOXK 4ZH4A 2JA5K 2PPBA 2NVTC 1YNJA 2R92K 2R92C 1TWHC 4A93C 3S2DC 2JA8C 5C4XC 3GTJK 1I6VA 5M5WK 4X6AK 3GTLK 4YFNA 1R9TK 4QIWL 1WCMC 5M5YK 2PMZD 5IYBC 4BBRK 4G7ZA 1I50C 3GTLC 3H3VD 4A3BC 3H0GC 5C4XK 3RZDK 2E2HK 2CW0A 3S14C 3RZDC 2E2HC 3HOZK 2R93K 3HKZD 1I50K 4Y52K 1TWFK 3GTPK 4BY7K 1TWAC 3M3YC 3FKIK 5FLMK 2A68A 4Q4ZA 4A3LK 4YG2A 4KN4A 3HOVC 3S15C 2Y0SL 2JA8K 4A3GK 1I6HK 4OIQA 2JA6C 4A3DK 1TWGK 5TMCA 4KMUA 2NVQC 4MEXA 3I4NK 2NVTK 1YNNA 1ZYRA 2BE5A 4JK1A 4XSXA 4AYBL 4C3JK 5IP7C 5FJ8K 4OINA 5TMFA 4A3MK 1TWGC 2NVQK 1K83C 3K7AC 2JA5C 3PO2C 3GTQK 3PO3C 4BBSK 5IYDK 4KN7A 3GTOK 3S2HC 4G7HA 4XLPA 3GTGC 3S1NK 2B63C 2O5IA 4C3IK 3HOUK 3GTKC 4A3MC 3PO2K 4A3EK 3GTMK 1HQMA 1Y1WC 3S1MC 2O5JA 4XLNA 3S17C 1I6HC 3HOUC 3I4NC 3HOVK 4LJZA 2JA6K 3I4MK 2JA7K 3S15K 2R7ZK 2WAQD 4A3DC 4A3GC 5C4JK 1TWCC 2VUMK 4MQ9A 2A6EA 5IP9C 4BY7C 4A3CC 2YU9K 3HKZL 1IW7A 3HOZC 3S16C 2R93C 3RZOK 4LK0A 3M4OK 1BDFA 2E2IC 3H0GK 2WB1D 1SFOC 3DXJA 2E2JK 4BXXC 2E2IK 4OIOA 3H3VL 1TWAK 5C4JC 3M3YK 4OIPA 4Y52C 1Y1VC 2E2JC 4A93K 4AYBD 4A3IK 3S2DK 4GZYA 1TWHK 4A3IC 3WODA 5IP9K 3S16K 4A3BK 3S1RC 4G7OA 1Y1VK 4A3CK 2A69A 1TWCK 2WB1L 4BBRC 1WCMK 5IYBK 3HOXC 4LLGA 1R9TC 1XPPA 5IYCK 2NVXK 5M3MK 2R7ZC 1SFOK 3GTJC 4X6AC 2Y0SD 3M4OC 3GTOC 2A6HA 4NOIA 3S2HK 4Y7NK 2WAQL 4QJVB 3GTQC 3S17K 3RZOC 3S1QC 1K83K 1I3QC
chains in the Genus database with same CATH superfamily
4BY1K 5D4DA 2YU9C 3CQZC 3G4CA 2R92A 1Y1WK 1WOSA 3GTKK 4A3JK 3GTMC 5M5XK 4QIWD 3VA7A 3GTJA 4OIRA 2W7VA 4YFXA 4XSZA 3HOWK 1O29A 1XZPB 2EBBA 5IP7K 3S14K 2R93A 3T01A 1EQRA 1Y1VA 3AH5A 3TFJA 1G51A 4XCHA 4Y7NC 4FZBA 3FKIC 1WOPA 1TWFC 1USMA 4C2MK 3S1RK 2PPBA 3L4JA 3SZYA 4G0VA 3GEIA 2JA8C 2V6UA 3GTLK 4YFNA 3GIRA 4ILDA 1X31C 4BBRK 3H0GC 1J6VA 1DD5A 1RU0A 3RZDK 5IOSA 2CW0A 1WQGA 2ZUEA 1I3QA 3LAPA 1I50K 4Y52K 3GTGA 3AD8C 3FKIK 5FLMK 2A68A 2R7ZA 4Q4ZA 4KN4A 5HL8A 1JOEA 1BGWA 1O2BA 1YNNA 4JK1A 4AYBL 4GTBA 4OINA 3K7AC 4C3IC 2E2IA 2B63C 3GTKC 4A3EK 1ISEA 1F9NA 4XLNA 3JSTA 4GTFA 1F7UA 1TWCA 1AB4A 1ZQ1C 5IP9C 4BY7C 4A3CC 4GTDA 1IW7A 1XXAA 3RZOK 3A8KA 1VRQC 2WB1D 2NVYA 4G0UA 3DXJA 2E2JK 1PJ6A 2E2IK 1TWAK 1WQHA 3M3YK 4OIPA 5E68A 4A3IC 4KASA 4KM8A 4A3BK 2A69A 4BBRC 3HOXC 1R9TC 2JA7A 4X6AC 2Y0SD 3GTOC 5IOQA 1ZVUA 1K83K 2JA5K 3S14C 1XZQB 1O25A 4A3JC 1L0WA 5EGHA 1UV7A 1ZBSA 3HOWC 2JA7C 1R9TA 1C0AA 2D6FC 4FM9A 1WQFA 2PA8D 2NVXC 4BKWA 2PA8L 4C3JC 4KAWX 1I3QK 1O27A 1VH2A 3S1QK 1VLOA 5IYDC 4A3LC 2NVYC 5CHPA 3HOYC 4P9SA 3FOFA 3S2DC 5C4XC 4X6AK 1I6VA 3GTQA 1R9TK 4QIWL 1XZPA 3H3VD 4AH6A 4G7ZA 4KMAA 2JH3A 3GTPK 2RGRA 1IL2A 4A3LK 2V6TA 4YG2A 3HOVC 1V5VA 3GDZA 4A3DK 2NVQC 5TMCA 3AQOA 1J6WA 2GSUA 1B4AA 5TMFA 4KMDA 3PO2C 1TWGC 1K83C 4LOWA 2JA5C 3S2HC 4G7HA 3GTGC 3S1NK 4C3HC 3HOUK 4A3MC 3HXAA 4P5AA 3LAJA 3GTMK 4PABA 3HOVK 4LJZA 3V4GA 2JA6K 2R7ZK 4KARA 1TWCC 2VUMK 1WOOA 2A6EA 4MQ9A 1K83A 1O2FB 1TWGA 4GTLA 1EFWA 2JA5A 3BUEA 3HKZL 3GTKA 3IPJA 4GTCA 4KATA 2B63A 2XCQA 2E2IC 3H0GK 3G4AA 2P5MA 3NUHA 1Y1VC 4A3IK 3S2DK 3WODA 3S16K 1F93A 1DCHA 2NVXK 2R7ZC 4BLBA 1SFOK 3GTJC 3M4OC 3S2HK 3GTQC 1I3QC 4A3KK 2YU9A 3N0CA 1IBAA 1JVIA 5EGEA 2B63K 1GE9A 3AD7C 4BY1C 3T00A 2NVYK 2GAGC 1XXCA 5C44C 4A3FC 1IS1A 4BBSC 2P8TA 3OREA 5C3EK 1YX2A 4BXXK 1JQWA 4C3HK 1TWFA 1WIHA 4Q5SA 3FKIA 4LK1A 2NVXA 4QJVA 1SMYA 1XZQA 5FLMC 4O2DA 3HOXK 4ZH4A 2R92K 3GTJK 3GSIA 3GTOA 1USOA 1WCMC 5IYBC 2PMZD 1I50C 4A3BC 2FQOA 2PHCB 2E2HC 3TFHA 3HOZK 2R93K 1PJ5A 1B4BA 3HKZD 1TWFK 1O2AA 3Q3QA 1TWAC 5L46A 3M3YC 2Y0SL 3A8JA 5JVOA 4A3GK 1I6HK 3L4KA 3ERED 4KMUA 1J6XA 4C45A 4MEXA 1ZYRA 1O26A 1BJTA 5IP7C 5IOTA 4KC6A 1DCOA 3H0GA 3GTOK 1ZXOA 1YCLA 2O5IA 4WILA 3S1MC 3S0XA 2O5JA 2V6SA 3S17C 3I4NC 1IE0A 1DCPA 3LPXA 4GFQA 2JA7K 3I4MK 2WAQD 4A3GC 2ZUFA 3N3YA 3FHZA 2XCRB 3HOZC 3S16C 2R93C 3M4OK 1BDFA 1SFOC 2CFAB 4OIOA 5C4JC 4KDDA 3GTMA 4GZYA 1TWHK 1VJEA 5JFEA 3S1RC 5TJ3A 1WSRA 4NOIA 3S1QC 2VUMA 2WAQL 4QJVB 3RZOC 4BXXC 3GEHA 1HI9A 2FQTA 3BP3A 4P5BA 3QX3A 4MEYA 3S1MK 3HOYK 3CQZK 2KWAA 3GEEA 4C2MC 4A3EC 1INNA 2VUMC 5M3FK 2Y3PA 3BP8C 3I4MC 5C44K 4A3FK 5IYCC 3K7AK 3MMLB 3EQLA 5C3EC 4G0WA 3OEPA 2GSOA 4DDQA 3GTPA 3GTGK 4GTAA 4A3KC 3S1NC 1SFOA 4KB2A 3AD9C 4YFKA 3PO3K 3GTPC 2PMZL 2NVTC 1YNJA 2RH6A 3SZZA 2R92C 1TWHC 1Y1WA 4A93C 3CQZA 2GSNA 4BLAA 1WORA 5M5WK 1XXBA 5M5YK 1BS2A 3GTLC 3A8IA 1EI6A 5C4XK 2E2HK 3N0BA 4KMHA 1EH1A 4WJ3M 3RZDC 2ZFZA 4WJ4A 5CJ9A 4BY7K 3TTGA 2JA6A 4GT9A 3S15C 2JA8K 4PAAA 4OIQA 2JA6C 1TWGK 4GTEA 3I4NK 2NVTK 2BE5A 1EK8A 4XSXA 4C3JK 5FJ8K 4A3MK 2NVQK 4BBSK 3PO3C 3GTQK 3GTLA 5IYDK 4LQYA 4KN7A 1TWAA 4XLPA 4C3IK 3PO2K 1IQ0A 2E2HA 1HQMA 4LR2A 1TWHA 2XCOA 3OPFA 1Y1WC 3CAGA 3T02A 1I6HC 1I50A 3HOUC 1WCMA 3S15K 5IORA 4A3DC 4J3NA 5C4JK 1VGXA 1J98A 1PJ7A 2YU9K 1KQ4A 4LK0A 4M1XA 4KB4A 4KM9A 1O24A 3TFIA 1F7VA 2GAHC 3H3VL 3FOEA 4Y52C 2E2JC 4A93K 1O28A 2CFAA 4RMFA 4AYBD 1WSVA 5IP9K 4G7OA 1Y1VK 4A3CK 1TWCK 2WB1L 1WCMK 3AQPA 5IYBK 4LLGA 1XPPA 5IYCK 5M3MK 2A6HA 3ADAC 4Y7NK 3S17K
chains in the Genus database with same CATH topology
4BY1K 4A3KK 5D4DA 2YU9C 3CQZC 4A3JC 4MEYA 1Y1WK 3HOYK 3GTKK 3CQZK 4A3JK 3S1MK 4A3EC 2VUMC 2B63K 3GTMC 5M3FK 4BY1C 5M5XK 4QIWD 2NVYK 4OIRA 3HOWC 2JA7C 3I4MC 5C44C 5C44K 4YFXA 4A3FK 4XSZA 4A3FC 2PA8D 3HOWK 5IYCC 2NVXC 3K7AK 4BBSC 3EQLA 5C3EK 5C3EC 2PA8L 5IP7K 1I3QK 3S14K 4BXXK 4C3HK 3S1QK 3GTGK 4A3KC 3S1NC 4Q5SA 4LK1A 5IYDC 4A3LC 4QJVA 4Y7NC 2NVYC 3PO3K 4YFKA 3FKIC 1SMYA 1TWFC 3GTPC 4C2MK 3S1RK 3HOYC 2PMZL 5FLMC 3HOXK 4ZH4A 2JA5K 2PPBA 2NVTC 1YNJA 2R92K 2R92C 1TWHC 4A93C 3S2DC 2JA8C 5C4XC 3GTJK 1I6VA 5M5WK 4X6AK 3GTLK 4YFNA 1R9TK 4QIWL 1WCMC 5M5YK 2PMZD 5IYBC 4BBRK 4G7ZA 1I50C 3GTLC 3H3VD 4A3BC 3H0GC 5C4XK 3RZDK 2E2HK 2CW0A 3S14C 3RZDC 2E2HC 3HOZK 2R93K 3HKZD 1I50K 4Y52K 1TWFK 3GTPK 4BY7K 1TWAC 3M3YC 3FKIK 5FLMK 2A68A 4Q4ZA 4A3LK 4YG2A 4KN4A 3HOVC 3S15C 2Y0SL 2JA8K 4A3GK 1I6HK 4OIQA 2JA6C 4A3DK 1TWGK 5TMCA 4KMUA 2NVQC 4MEXA 3I4NK 2NVTK 1YNNA 1ZYRA 2BE5A 4JK1A 4XSXA 4AYBL 4C3JK 5IP7C 5FJ8K 4OINA 5TMFA 4A3MK 1TWGC 2NVQK 1K83C 3K7AC 2JA5C 3PO2C 3GTQK 3PO3C 4BBSK 5IYDK 4KN7A 3GTOK 3S2HC 4G7HA 4XLPA 3GTGC 3S1NK 2B63C 2O5IA 4C3IK 3HOUK 3GTKC 4A3MC 3PO2K 4A3EK 3GTMK 1HQMA 1Y1WC 3S1MC 2O5JA 4XLNA 3S17C 1I6HC 3HOUC 3I4NC 3HOVK 4LJZA 2JA6K 3I4MK 2JA7K 3S15K 2R7ZK 2WAQD 4A3DC 4A3GC 5C4JK 1TWCC 2VUMK 4MQ9A 2A6EA 5IP9C 4BY7C 4A3CC 2YU9K 3HKZL 1IW7A 3HOZC 3S16C 2R93C 3RZOK 4LK0A 3M4OK 1BDFA 2E2IC 3H0GK 2WB1D 1SFOC 3DXJA 2E2JK 4BXXC 2E2IK 4OIOA 3H3VL 1TWAK 5C4JC 3M3YK 4OIPA 4Y52C 1Y1VC 2E2JC 4A93K 4AYBD 4A3IK 3S2DK 4GZYA 1TWHK 4A3IC 3WODA 5IP9K 3S16K 4A3BK 3S1RC 4G7OA 1Y1VK 4A3CK 2A69A 1TWCK 2WB1L 4BBRC 1WCMK 5IYBK 3HOXC 4LLGA 1R9TC 1XPPA 5IYCK 2NVXK 5M3MK 2R7ZC 1SFOK 3GTJC 4X6AC 2Y0SD 3M4OC 3GTOC 2A6HA 4NOIA 3S2HK 4Y7NK 2WAQL 4QJVB 3GTQC 3S17K 3RZOC 3S1QC 1K83K 1I3QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY1 K;  4A3K K;  5D4D A;  2YU9 C;  3CQZ C;  4A3J C;  4MEY A;  1Y1W K;  3HOY K;  3GTK K;  3CQZ K;  4A3J K;  3S1M K;  4A3E C;  2VUM C;  2B63 K;  3GTM C;  5M3F K;  4BY1 C;  5M5X K;  4QIW D;  2NVY K;  4OIR A;  3HOW C;  2JA7 C;  3I4M C;  5C44 C;  5C44 K;  4YFX A;  4A3F K;  4XSZ A;  4A3F C;  2PA8 D;  3HOW K;  5IYC C;  2NVX C;  3K7A K;  4BBS C;  3EQL A;  5C3E K;  5C3E C;  2PA8 L;  5IP7 K;  1I3Q K;  3S14 K;  4BXX K;  4C3H K;  3S1Q K;  3GTG K;  4A3K C;  3S1N C;  4Q5S A;  4LK1 A;  5IYD C;  4A3L C;  4QJV A;  4Y7N C;  2NVY C;  3PO3 K;  4YFK A;  3FKI C;  1SMY A;  1TWF C;  3GTP C;  4C2M K;  3S1R K;  3HOY C;  2PMZ L;  5FLM C;  3HOX K;  4ZH4 A;  2JA5 K;  2PPB A;  2NVT C;  1YNJ A;  2R92 K;  2R92 C;  1TWH C;  4A93 C;  3S2D C;  2JA8 C;  5C4X C;  3GTJ K;  1I6V A;  5M5W K;  4X6A K;  3GTL K;  4YFN A;  1R9T K;  4QIW L;  1WCM C;  5M5Y K;  2PMZ D;  5IYB C;  4BBR K;  4G7Z A;  1I50 C;  3GTL C;  3H3V D;  4A3B C;  3H0G C;  5C4X K;  3RZD K;  2E2H K;  2CW0 A;  3S14 C;  3RZD C;  2E2H C;  3HOZ K;  2R93 K;  3HKZ D;  1I50 K;  4Y52 K;  1TWF K;  3GTP K;  4BY7 K;  1TWA C;  3M3Y C;  3FKI K;  5FLM K;  2A68 A;  4Q4Z A;  4A3L K;  4YG2 A;  4KN4 A;  3HOV C;  3S15 C;  2Y0S L;  2JA8 K;  4A3G K;  1I6H K;  4OIQ A;  2JA6 C;  4A3D K;  1TWG K;  5TMC A;  4KMU A;  2NVQ C;  4MEX A;  3I4N K;  2NVT K;  1YNN A;  1ZYR A;  2BE5 A;  4JK1 A;  4XSX A;  4AYB L;  4C3J K;  5IP7 C;  5FJ8 K;  4OIN A;  5TMF A;  4A3M K;  1TWG C;  2NVQ K;  1K83 C;  3K7A C;  2JA5 C;  3PO2 C;  3GTQ K;  3PO3 C;  4BBS K;  5IYD K;  4KN7 A;  3GTO K;  3S2H C;  4G7H A;  4XLP A;  3GTG C;  3S1N K;  2B63 C;  2O5I A;  4C3I K;  3HOU K;  3GTK C;  4A3M C;  3PO2 K;  4A3E K;  3GTM K;  1HQM A;  1Y1W C;  3S1M C;  2O5J A;  4XLN A;  3S17 C;  1I6H C;  3HOU C;  3I4N C;  3HOV K;  4LJZ A;  2JA6 K;  3I4M K;  2JA7 K;  3S15 K;  2R7Z K;  2WAQ D;  4A3D C;  4A3G C;  5C4J K;  1TWC C;  2VUM K;  4MQ9 A;  2A6E A;  5IP9 C;  4BY7 C;  4A3C C;  2YU9 K;  3HKZ L;  1IW7 A;  3HOZ C;  3S16 C;  2R93 C;  3RZO K;  4LK0 A;  3M4O K;  1BDF A;  2E2I C;  3H0G K;  2WB1 D;  1SFO C;  3DXJ A;  2E2J K;  4BXX C;  2E2I K;  4OIO A;  3H3V L;  1TWA K;  5C4J C;  3M3Y K;  4OIP A;  4Y52 C;  1Y1V C;  2E2J C;  4A93 K;  4AYB D;  4A3I K;  3S2D K;  4GZY A;  1TWH K;  4A3I C;  3WOD A;  5IP9 K;  3S16 K;  4A3B K;  3S1R C;  4G7O A;  1Y1V K;  4A3C K;  2A69 A;  1TWC K;  2WB1 L;  4BBR C;  1WCM K;  5IYB K;  3HOX C;  4LLG A;  1R9T C;  1XPP A;  5IYC K;  2NVX K;  5M3M K;  2R7Z C;  1SFO K;  3GTJ C;  4X6A C;  2Y0S D;  3M4O C;  3GTO C;  2A6H A;  4NOI A;  3S2H K;  4Y7N K;  2WAQ L;  4QJV B;  3GTQ C;  3S17 K;  3RZO C;  3S1Q C;  1K83 K;  1I3Q C; 
#chains in the Genus database with same CATH topology
 4BY1 K;  5D4D A;  2YU9 C;  3CQZ C;  3G4C A;  2R92 A;  1Y1W K;  1WOS A;  3GTK K;  4A3J K;  3GTM C;  5M5X K;  4QIW D;  3VA7 A;  3GTJ A;  4OIR A;  2W7V A;  4YFX A;  4XSZ A;  3HOW K;  1O29 A;  1XZP B;  2EBB A;  5IP7 K;  3S14 K;  2R93 A;  3T01 A;  1EQR A;  1Y1V A;  3AH5 A;  3TFJ A;  1G51 A;  4XCH A;  4Y7N C;  4FZB A;  3FKI C;  1WOP A;  1TWF C;  1USM A;  4C2M K;  3S1R K;  2PPB A;  3L4J A;  3SZY A;  4G0V A;  3GEI A;  2JA8 C;  2V6U A;  3GTL K;  4YFN A;  3GIR A;  4ILD A;  1X31 C;  4BBR K;  3H0G C;  1J6V A;  1DD5 A;  1RU0 A;  3RZD K;  5IOS A;  2CW0 A;  1WQG A;  2ZUE A;  1I3Q A;  3LAP A;  1I50 K;  4Y52 K;  3GTG A;  3AD8 C;  3FKI K;  5FLM K;  2A68 A;  2R7Z A;  4Q4Z A;  4KN4 A;  5HL8 A;  1JOE A;  1BGW A;  1O2B A;  1YNN A;  4JK1 A;  4AYB L;  4GTB A;  4OIN A;  3K7A C;  4C3I C;  2E2I A;  2B63 C;  3GTK C;  4A3E K;  1ISE A;  1F9N A;  4XLN A;  3JST A;  4GTF A;  1F7U A;  1TWC A;  1AB4 A;  1ZQ1 C;  5IP9 C;  4BY7 C;  4A3C C;  4GTD A;  1IW7 A;  1XXA A;  3RZO K;  3A8K A;  1VRQ C;  2WB1 D;  2NVY A;  4G0U A;  3DXJ A;  2E2J K;  1PJ6 A;  2E2I K;  1TWA K;  1WQH A;  3M3Y K;  4OIP A;  5E68 A;  4A3I C;  4KAS A;  4KM8 A;  4A3B K;  2A69 A;  4BBR C;  3HOX C;  1R9T C;  2JA7 A;  4X6A C;  2Y0S D;  3GTO C;  5IOQ A;  1ZVU A;  1K83 K;  2JA5 K;  3S14 C;  1XZQ B;  1O25 A;  4A3J C;  1L0W A;  5EGH A;  1UV7 A;  1ZBS A;  3HOW C;  2JA7 C;  1R9T A;  1C0A A;  2D6F C;  4FM9 A;  1WQF A;  2PA8 D;  2NVX C;  4BKW A;  2PA8 L;  4C3J C;  4KAW X;  1I3Q K;  1O27 A;  1VH2 A;  3S1Q K;  1VLO A;  5IYD C;  4A3L C;  2NVY C;  5CHP A;  3HOY C;  4P9S A;  3FOF A;  3S2D C;  5C4X C;  4X6A K;  1I6V A;  3GTQ A;  1R9T K;  4QIW L;  1XZP A;  3H3V D;  4AH6 A;  4G7Z A;  4KMA A;  2JH3 A;  3GTP K;  2RGR A;  1IL2 A;  4A3L K;  2V6T A;  4YG2 A;  3HOV C;  1V5V A;  3GDZ A;  4A3D K;  2NVQ C;  5TMC A;  3AQO A;  1J6W A;  2GSU A;  1B4A A;  5TMF A;  4KMD A;  3PO2 C;  1TWG C;  1K83 C;  4LOW A;  2JA5 C;  3S2H C;  4G7H A;  3GTG C;  3S1N K;  4C3H C;  3HOU K;  4A3M C;  3HXA A;  4P5A A;  3LAJ A;  3GTM K;  4PAB A;  3HOV K;  4LJZ A;  3V4G A;  2JA6 K;  2R7Z K;  4KAR A;  1TWC C;  2VUM K;  1WOO A;  2A6E A;  4MQ9 A;  1K83 A;  1O2F B;  1TWG A;  4GTL A;  1EFW A;  2JA5 A;  3BUE A;  3HKZ L;  3GTK A;  3IPJ A;  4GTC A;  4KAT A;  2B63 A;  2XCQ A;  2E2I C;  3H0G K;  3G4A A;  2P5M A;  3NUH A;  1Y1V C;  4A3I K;  3S2D K;  3WOD A;  3S16 K;  1F93 A;  1DCH A;  2NVX K;  2R7Z C;  4BLB A;  1SFO K;  3GTJ C;  3M4O C;  3S2H K;  3GTQ C;  1I3Q C;  4A3K K;  2YU9 A;  3N0C A;  1IBA A;  1JVI A;  5EGE A;  2B63 K;  1GE9 A;  3AD7 C;  4BY1 C;  3T00 A;  2NVY K;  2GAG C;  1XXC A;  5C44 C;  4A3F C;  1IS1 A;  4BBS C;  2P8T A;  3ORE A;  5C3E K;  1YX2 A;  4BXX K;  1JQW A;  4C3H K;  1TWF A;  1WIH A;  4Q5S A;  3FKI A;  4LK1 A;  2NVX A;  4QJV A;  1SMY A;  1XZQ A;  5FLM C;  4O2D A;  3HOX K;  4ZH4 A;  2R92 K;  3GTJ K;  3GSI A;  3GTO A;  1USO A;  1WCM C;  5IYB C;  2PMZ D;  1I50 C;  4A3B C;  2FQO A;  2PHC B;  2E2H C;  3TFH A;  3HOZ K;  2R93 K;  1PJ5 A;  1B4B A;  3HKZ D;  1TWF K;  1O2A A;  3Q3Q A;  1TWA C;  5L46 A;  3M3Y C;  2Y0S L;  3A8J A;  5JVO A;  4A3G K;  1I6H K;  3L4K A;  3ERE D;  4KMU A;  1J6X A;  4C45 A;  4MEX A;  1ZYR A;  1O26 A;  1BJT A;  5IP7 C;  5IOT A;  4KC6 A;  1DCO A;  3H0G A;  3GTO K;  1ZXO A;  1YCL A;  2O5I A;  4WIL A;  3S1M C;  3S0X A;  2O5J A;  2V6S A;  3S17 C;  3I4N C;  1IE0 A;  1DCP A;  3LPX A;  4GFQ A;  2JA7 K;  3I4M K;  2WAQ D;  4A3G C;  2ZUF A;  3N3Y A;  3FHZ A;  2XCR B;  3HOZ C;  3S16 C;  2R93 C;  3M4O K;  1BDF A;  1SFO C;  2CFA B;  4OIO A;  5C4J C;  4KDD A;  3GTM A;  4GZY A;  1TWH K;  1VJE A;  5JFE A;  3S1R C;  5TJ3 A;  1WSR A;  4NOI A;  3S1Q C;  2VUM A;  2WAQ L;  4QJV B;  3RZO C;  4BXX C;  3GEH A;  1HI9 A;  2FQT A;  3BP3 A;  4P5B A;  3QX3 A;  4MEY A;  3S1M K;  3HOY K;  3CQZ K;  2KWA A;  3GEE A;  4C2M C;  4A3E C;  1INN A;  2VUM C;  5M3F K;  2Y3P A;  3BP8 C;  3I4M C;  5C44 K;  4A3F K;  5IYC C;  3K7A K;  3MML B;  3EQL A;  5C3E C;  4G0W A;  3OEP A;  2GSO A;  4DDQ A;  3GTP A;  3GTG K;  4GTA A;  4A3K C;  3S1N C;  1SFO A;  4KB2 A;  3AD9 C;  4YFK A;  3PO3 K;  3GTP C;  2PMZ L;  2NVT C;  1YNJ A;  2RH6 A;  3SZZ A;  2R92 C;  1TWH C;  1Y1W A;  4A93 C;  3CQZ A;  2GSN A;  4BLA A;  1WOR A;  5M5W K;  1XXB A;  5M5Y K;  1BS2 A;  3GTL C;  3A8I A;  1EI6 A;  5C4X K;  2E2H K;  3N0B A;  4KMH A;  1EH1 A;  4WJ3 M;  3RZD C;  2ZFZ A;  4WJ4 A;  5CJ9 A;  4BY7 K;  3TTG A;  2JA6 A;  4GT9 A;  3S15 C;  2JA8 K;  4PAA A;  4OIQ A;  2JA6 C;  1TWG K;  4GTE A;  3I4N K;  2NVT K;  2BE5 A;  1EK8 A;  4XSX A;  4C3J K;  5FJ8 K;  4A3M K;  2NVQ K;  4BBS K;  3PO3 C;  3GTQ K;  3GTL A;  5IYD K;  4LQY A;  4KN7 A;  1TWA A;  4XLP A;  4C3I K;  3PO2 K;  1IQ0 A;  2E2H A;  1HQM A;  4LR2 A;  1TWH A;  2XCO A;  3OPF A;  1Y1W C;  3CAG A;  3T02 A;  1I6H C;  1I50 A;  3HOU C;  1WCM A;  3S15 K;  5IOR A;  4A3D C;  4J3N A;  5C4J K;  1VGX A;  1J98 A;  1PJ7 A;  2YU9 K;  1KQ4 A;  4LK0 A;  4M1X A;  4KB4 A;  4KM9 A;  1O24 A;  3TFI A;  1F7V A;  2GAH C;  3H3V L;  3FOE A;  4Y52 C;  2E2J C;  4A93 K;  1O28 A;  2CFA A;  4RMF A;  4AYB D;  1WSV A;  5IP9 K;  4G7O A;  1Y1V K;  4A3C K;  1TWC K;  2WB1 L;  1WCM K;  3AQP A;  5IYB K;  4LLG A;  1XPP A;  5IYC K;  5M3M K;  2A6H A;  3ADA C;  4Y7N K;  3S17 K; 
#chains in the Genus database with same CATH homology
 4BY1 K;  4A3K K;  5D4D A;  2YU9 C;  3CQZ C;  4A3J C;  4MEY A;  1Y1W K;  3HOY K;  3GTK K;  3CQZ K;  4A3J K;  3S1M K;  4A3E C;  2VUM C;  2B63 K;  3GTM C;  5M3F K;  4BY1 C;  5M5X K;  4QIW D;  2NVY K;  4OIR A;  3HOW C;  2JA7 C;  3I4M C;  5C44 C;  5C44 K;  4YFX A;  4A3F K;  4XSZ A;  4A3F C;  2PA8 D;  3HOW K;  5IYC C;  2NVX C;  3K7A K;  4BBS C;  3EQL A;  5C3E K;  5C3E C;  2PA8 L;  5IP7 K;  1I3Q K;  3S14 K;  4BXX K;  4C3H K;  3S1Q K;  3GTG K;  4A3K C;  3S1N C;  4Q5S A;  4LK1 A;  5IYD C;  4A3L C;  4QJV A;  4Y7N C;  2NVY C;  3PO3 K;  4YFK A;  3FKI C;  1SMY A;  1TWF C;  3GTP C;  4C2M K;  3S1R K;  3HOY C;  2PMZ L;  5FLM C;  3HOX K;  4ZH4 A;  2JA5 K;  2PPB A;  2NVT C;  1YNJ A;  2R92 K;  2R92 C;  1TWH C;  4A93 C;  3S2D C;  2JA8 C;  5C4X C;  3GTJ K;  1I6V A;  5M5W K;  4X6A K;  3GTL K;  4YFN A;  1R9T K;  4QIW L;  1WCM C;  5M5Y K;  2PMZ D;  5IYB C;  4BBR K;  4G7Z A;  1I50 C;  3GTL C;  3H3V D;  4A3B C;  3H0G C;  5C4X K;  3RZD K;  2E2H K;  2CW0 A;  3S14 C;  3RZD C;  2E2H C;  3HOZ K;  2R93 K;  3HKZ D;  1I50 K;  4Y52 K;  1TWF K;  3GTP K;  4BY7 K;  1TWA C;  3M3Y C;  3FKI K;  5FLM K;  2A68 A;  4Q4Z A;  4A3L K;  4YG2 A;  4KN4 A;  3HOV C;  3S15 C;  2Y0S L;  2JA8 K;  4A3G K;  1I6H K;  4OIQ A;  2JA6 C;  4A3D K;  1TWG K;  5TMC A;  4KMU A;  2NVQ C;  4MEX A;  3I4N K;  2NVT K;  1YNN A;  1ZYR A;  2BE5 A;  4JK1 A;  4XSX A;  4AYB L;  4C3J K;  5IP7 C;  5FJ8 K;  4OIN A;  5TMF A;  4A3M K;  1TWG C;  2NVQ K;  1K83 C;  3K7A C;  2JA5 C;  3PO2 C;  3GTQ K;  3PO3 C;  4BBS K;  5IYD K;  4KN7 A;  3GTO K;  3S2H C;  4G7H A;  4XLP A;  3GTG C;  3S1N K;  2B63 C;  2O5I A;  4C3I K;  3HOU K;  3GTK C;  4A3M C;  3PO2 K;  4A3E K;  3GTM K;  1HQM A;  1Y1W C;  3S1M C;  2O5J A;  4XLN A;  3S17 C;  1I6H C;  3HOU C;  3I4N C;  3HOV K;  4LJZ A;  2JA6 K;  3I4M K;  2JA7 K;  3S15 K;  2R7Z K;  2WAQ D;  4A3D C;  4A3G C;  5C4J K;  1TWC C;  2VUM K;  4MQ9 A;  2A6E A;  5IP9 C;  4BY7 C;  4A3C C;  2YU9 K;  3HKZ L;  1IW7 A;  3HOZ C;  3S16 C;  2R93 C;  3RZO K;  4LK0 A;  3M4O K;  1BDF A;  2E2I C;  3H0G K;  2WB1 D;  1SFO C;  3DXJ A;  2E2J K;  4BXX C;  2E2I K;  4OIO A;  3H3V L;  1TWA K;  5C4J C;  3M3Y K;  4OIP A;  4Y52 C;  1Y1V C;  2E2J C;  4A93 K;  4AYB D;  4A3I K;  3S2D K;  4GZY A;  1TWH K;  4A3I C;  3WOD A;  5IP9 K;  3S16 K;  4A3B K;  3S1R C;  4G7O A;  1Y1V K;  4A3C K;  2A69 A;  1TWC K;  2WB1 L;  4BBR C;  1WCM K;  5IYB K;  3HOX C;  4LLG A;  1R9T C;  1XPP A;  5IYC K;  2NVX K;  5M3M K;  2R7Z C;  1SFO K;  3GTJ C;  4X6A C;  2Y0S D;  3M4O C;  3GTO C;  2A6H A;  4NOI A;  3S2H K;  4Y7N K;  2WAQ L;  4QJV B;  3GTQ C;  3S17 K;  3RZO C;  3S1Q C;  1K83 K;  1I3Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...