1K83K

Crystal structure of yeast rna polymerase ii complexed with the inhibitor alpha amanitin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural Basis of Transcription: Alpha-Amanitin-RNA Polymerase II Cocrystal at 2.8 A Resolution.
pubmed doi rcsb
molecule tags Transcription/toxin
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1k83K00
4A3MC 3GTMC 4QIWD 4XSXA 5IP7K 4A3IK 3S1MC 1HQMA 1TWGK 3GTPC 5C4XK 3PO2C 2R92C 3S2HK 2WAQD 4XSZA 4YFKA 5C4JC 4A3EK 5IYBC 2NVTC 1TWCC 1XPPA 1I3QK 2R7ZC 2JA7C 3S17C 3S14C 4OIRA 5M3FK 2PA8L 4C3IK 1I50C 3H0GC 3H3VL 3HKZL 4LLGA 5M5XK 5C3EC 4YFNA 2JA5C 2NVQK 4A3CC 3RZOC 3I4NC 4A3GC 4G7HA 4A3KC 2A69A 2E2IC 3CQZK 4A3DC 4A3LC 4Y52K 2R93C 2VUMC 3GTQC 3HOXK 1I6HK 4X6AK 5TMCA 4NOIA 4G7ZA 1YNNA 3RZDC 5FLMC 5IYCC 5D4DA 4QJVB 4A3JK 5FJ8K 2E2JC 4BXXK 3S16C 1Y1WK 1K83K 2B63K 5IP9C 4OINA 4BBRK 1R9TC 4LJZA 3GTKC 4G7OA 3HOWC 4A3BC 1TWAK 3K7AK 1TWFK 2YU9K 2A68A 2PA8D 5C44C 3HOYC 4C2MK 3GTJC 3GTGC 4BY7K 5IP7C 1I6VA 1TWGC 4MEYA 4AYBD 3M4OK 3HOUK 3HOVK 3S15K 2E2HK 4A3EC 4A3FK 1IW7A 3GTPK 4C3JK 2NVTK 4LK0A 4A93K 4BY1K 4ZH4A 2BE5A 3GTLK 2A6HA 2NVXK 3HOZK 4Y7NK 2JA6K 2NVQC 2O5JA 1WCMK 1Y1VK 3S1NK 1TWHK 5C3EK 4Y52C 2NVYK 4QIWL 3HOXC 2CW0A 1I6HC 3I4MC 3S2DK 3FKIK 4X6AC 4XLPA 4BBSK 4A3LK 4OIQA 1SFOK 2JA8K 4GZYA 4A3JC 3S1QC 2PPBA 4BXXC 1Y1WC 3H3VD 3HKZD 5IYDK 1K83C 3DXJA 2B63C 4BBRC 5M5YK 3PO3K 4A3IC 3GTOK 4YG2A 2PMZL 3S16K 3S1RK 5C4XC 2O5IA 3M3YK 4A3MK 3GTMK 3S2HC 3K7AC 2YU9C 4XLNA 3S1MK 2WB1L 3PO2K 1I3QC 4BY7C 2R92K 5C4JK 4QJVA 5IYBK 1TWCK 4Q4ZA 3M4OC 3HOUC 3HOVC 2R7ZK 2E2HC 2JA7K 3S14K 3S17K 3S15C 2Y0SL 4A3FC 1I50K 3CQZC 3H0GK 2JA5K 4A3CK 3I4NK 3RZOK 4A93C 2E2IK 4A3KK 4A3GK 4KN7A 4C3HK 5M3MK 4BY1C 3GTLC 4A3DK 3WODA 2NVXC 3HOZC 4Y7NC 2JA6C 2WAQL 4KMUA 1WCMC 2VUMK 1Y1VC 3GTQK 3S1NC 2R93K 4OIPA 1YNJA 2PMZD 4MEXA 1SMYA 1TWHC 2NVYC 3RZDK 5FLMK 5IYCK 4AYBL 2E2JK 3S2DC 3FKIC 3EQLA 2WB1D 4OIOA 4YFXA 5M5WK 4BBSC 2A6EA 5IP9K 1TWAC 4KN4A 1SFOC 2JA8C 1R9TK 4MQ9A 1TWFC 4LK1A 3I4MK 1BDFA 5IYDC 3GTKK 3HOWK 4A3BK 4Q5SA 1ZYRA 4JK1A 3PO3C 5TMFA 2Y0SD 3GTOC 3S1QK 5C44K 3HOYK 3S1RC 3M3YC 3GTJK 3GTGK
chains in the Genus database with same CATH superfamily
3GTMC 3GTPA 4QIWD 4A3IK 3BP8C 3GTPC 1VGXA 4YFKA 5C4JC 4A3EK 2JA7A 3SZZA 2JA7C 3H0GA 4OIRA 3H0GC 4BLBA 2JA5A 2GAHC 5C3EC 4KMHA 2JA5C 3I4NC 4A3GC 4KAWX 4A3DC 3GTQA 3GTQC 3HOXK 1O2AA 4X6AK 3JSTA 3GTMA 5TMCA 5IYCC 5D4DA 4BXXK 3S16C 5E68A 4BBRK 1WQFA 2GSNA 1WOPA 4GTEA 3HOWC 3K7AK 1BGWA 1TWFK 2YU9K 4LR2A 4C2MK 1USMA 1ZQ1C 3GSIA 1DCOA 4AYBD 1X31C 3HOVK 2E2HK 1ZBSA 1O24A 1IW7A 3T01A 3FOFA 2Y3PA 4KB4A 2NVTK 4GTBA 4LK0A 4A93K 4BY1K 3NUHA 3HOZK 4Y7NK 5JFEA 1TWHK 4M1XA 2NVYK 3OPFA 1J98A 1O2FB 1SFOK 3AQPA 1GE9A 2JH3A 1F7VA 3T02A 5EGEA 5M5YK 4A3IC 5IORA 5IOTA 3GTMK 5L46A 5C4JK 4Q4ZA 3G4CA 3S15C 1DD5A 2JA7K 4XCHA 3H0GK 1KQ4A 2JA5K 3I4NK 3VA7A 4A3GK 1J6WA 2NVXA 4A3DK 2NVXC 1WSRA 4GT9A 3GTQK 2PMZD 5IYCK 1WOSA 1J6VA 3TFHA 1G51A 1O27A 1TWFA 4KN4A 2RGRA 4MQ9A 1TWFC 3ERED 3I4MK 1BDFA 4PAAA 1IQ0A 3HOWK 3A8IA 4GTDA 1F9NA 2Y0SD 2XCQA 1IS1A 2RH6A 4XSXA 1HQMA 3PO2C 2ZUFA 1DCHA 3ADAC 4PABA 2WAQD 2P8TA 4XSZA 2NVTC 1C0AA 5IYBC 4KARA 1XPPA 4DDQA 3S14C 5M3FK 1O26A 3HKZL 4LLGA 1WOOA 3RZOC 4A3KC 2A69A 4AH6A 3V4GA 2R93A 2R93C 4GTAA 4J3NA 4LOWA 1XXAA 4BKWA 5TJ3A 1YNNA 4QJVB 4FZBA 5FJ8K 1WQGA 3Q3QA 4G7OA 3BUEA 5C44C 1TWGA 5IP7C 1I6VA 1TWGC 4MEYA 3S15K 4RMFA 3AQOA 3BP3A 2NVXK 3AD9C 1UV7A 2O5JA 1XZPB 2V6SA 4G0VA 3T00A 4QIWL 1I6HC 3I4MC 1XXCA 2V6UA 2FQOA 4KMDA 3FOEA 4GZYA 1Y1WA 2PPBA 1K83A 1Y1WC 3H3VD 1K83C 4YG2A 5EGHA 4ILDA 4WJ4A 5CHPA 4WILA 1ZXOA 2ZFZA 3PO2K 4BY7C 5CJ9A 1YX2A 4QJVA 5IYBK 2PHCB 3S0XA 3S14K 4A3FC 1IBAA 2D6FC 2V6TA 3RZOK 3SZYA 4A3KK 4KN7A 2JA6A 1IE0A 1Y1VA 2JA6C 2R93K 2CFAA 1B4AA 1EK8A 1Y1VC 3S1NC 1XXBA 2P5MA 4AYBL 4KM9A 2JA8C 4WJ3M 2W7VA 5IYDC 4Q5SA 3PO3C 1XZPA 3S1QK 5C44K 3M3YC 4LQYA 4A3MC 1ISEA 5IP7K 3S1MC 1TWGK 2XCOA 5C4XK 4KDDA 3S2HK 3AD8C 2R7ZA 2R7ZC 2XCRB 3S17C 2PA8L 4YFNA 2E2IA 4A3CC 2E2IC 2VUMA 5HL8A 4BLAA 2VUMC 1I6HK 1F93A 4O2DA 3N0BA 2GSUA 4P5BA 4G7ZA 3RZDC 3GDZA 2GAGC 1Y1WK 1K83K 3TFJA 1R9TA 4OINA 1PJ7A 1R9TC 1WSVA 4A3BC 1TWAK 2A68A 3HOYC 1PJ5A 4BY7K 4KASA 1JVIA 1AB4A 1JOEA 4A3FK 3OEPA 3GEIA 1USOA 4C3IC 4ZH4A 1O28A 2A6HA 4KM8A 2JA6K 2FQTA 3TTGA 2NVQC 1Y1VK 3S1NK 1BJTA 4Y52C 2CW0A 4XLPA 4A3LK 4KATA 4OIQA 1V5VA 2JA8K 4A3JC 1XZQA 3S1QC 4KMAA 2B63A 5IYDK 2B63C 3DXJA 2CFAB 3PO3K 5C4XC 2O5IA 3M3YK 1O29A 4A3MK 4GTFA 3S2HC 2KWAA 1J6XA 4XLNA 3S1MK 2WB1L 3LAJA 3M4OC 3HOUC 2R7ZK 3S17K 3LAPA 4FM9A 3L4KA 4C3JC 4A3CK 3GTLA 2E2IK 5M3MK 4GFQA 3GTLC 5JVOA 1WCMA 3G4AA 1WCMC 2VUMK 5IOSA 1EFWA 1YNJA 1SMYA 3RZDK 3FKIA 3S2DC 3FKIC 3EQLA 4BBSC 1TWAA 3GIRA 3AD7C 1TWAC 1R9TK 4A3BK 3GTOA 1ZYRA 5TMFA 3GTOC 3HOYK 1WQHA 3S1RC 2R92A 1YCLA 2R92C 1TWCA 4C45A 1TWCC 1ZVUA 1VJEA 3MMLB 1I3QK 5IOQA 1VLOA 1I50A 4C3IK 1I50C 1BS2A 3H3VL 5M5XK 2NVQK 4G7HA 4C3HC 3CQZK 4A3LC 4Y52K 2EBBA 3N3YA 4NOIA 5FLMC 4A3JK 2E2JC 2B63K 3AH5A 1JQWA 5IP9C 4GTLA 4P5AA 4LJZA 3GTKA 3GTKC 2PA8D 3GTJA 3GTGA 3GTJC 3TFIA 3GTGC 3QX3A 1XZQB 3M4OK 3HOUK 1VRQC 4A3EC 3GTPK 4C3JK 1EQRA 1O2BA 2BE5A 3GTLK 3OREA 1WCMK 3CAGA 5C3EK 3HOXC 3S2DK 3FKIK 4X6AC 4BBSK 3GEEA 4BXXC 3HKZD 3N0CA 1RU0A 4BBRC 3GTOK 4GTCA 3S16K 2PMZL 1HI9A 3S1RK 4G0WA 1EI6A 2YU9A 1INNA 3K7AC 2YU9C 4KB2A 1I3QA 4C2MC 1I3QC 2R92K 4KC6A 1TWCK 1WIHA 2E2HA 3HXAA 3HOVC 2E2HC 4G0UA 1IL2A 3CQZA 2Y0SL 1L0WA 1EH1A 1I50K 3CQZC 4A93C 4C3HK 4BY1C 3WODA 3HOZC 4Y7NC 4P9SA 3FHZA 2WAQL 4KMUA 2ZUEA 4OIPA 1O25A 1TWHA 2NVYA 4MEXA 1TWHC 1B4BA 1DCPA 2NVYC 5FLMK 3LPXA 3A8JA 3A8KA 2E2JK 2WB1D 4OIOA 4YFXA 5M5WK 1SFOA 1F7UA 1WORA 3GEHA 2A6EA 5IP9K 1SFOC 4LK1A 3GTKK 2GSOA 4JK1A 3IPJA 3GTJK 1PJ6A 3L4JA 1VH2A 3GTGK
chains in the Genus database with same CATH topology
4A3MC 3GTMC 4QIWD 4XSXA 5IP7K 4A3IK 3S1MC 1HQMA 1TWGK 3GTPC 5C4XK 3PO2C 2R92C 3S2HK 2WAQD 4XSZA 4YFKA 5C4JC 4A3EK 5IYBC 2NVTC 1TWCC 1XPPA 1I3QK 2R7ZC 2JA7C 3S17C 3S14C 4OIRA 5M3FK 2PA8L 4C3IK 1I50C 3H0GC 3H3VL 3HKZL 4LLGA 5M5XK 5C3EC 4YFNA 2JA5C 2NVQK 4A3CC 3RZOC 3I4NC 4A3GC 4G7HA 4A3KC 2A69A 2E2IC 3CQZK 4A3DC 4A3LC 4Y52K 2R93C 2VUMC 3GTQC 3HOXK 1I6HK 4X6AK 5TMCA 4NOIA 4G7ZA 1YNNA 3RZDC 5FLMC 5IYCC 5D4DA 4QJVB 4A3JK 5FJ8K 2E2JC 4BXXK 3S16C 1Y1WK 1K83K 2B63K 5IP9C 4OINA 4BBRK 1R9TC 4LJZA 3GTKC 4G7OA 3HOWC 4A3BC 1TWAK 3K7AK 1TWFK 2YU9K 2A68A 2PA8D 5C44C 3HOYC 4C2MK 3GTJC 3GTGC 4BY7K 5IP7C 1I6VA 1TWGC 4MEYA 4AYBD 3M4OK 3HOUK 3HOVK 3S15K 2E2HK 4A3EC 4A3FK 1IW7A 3GTPK 4C3JK 2NVTK 4LK0A 4A93K 4BY1K 4ZH4A 2BE5A 3GTLK 2A6HA 2NVXK 3HOZK 4Y7NK 2JA6K 2NVQC 2O5JA 1WCMK 1Y1VK 3S1NK 1TWHK 5C3EK 4Y52C 2NVYK 4QIWL 3HOXC 2CW0A 1I6HC 3I4MC 3S2DK 3FKIK 4X6AC 4XLPA 4BBSK 4A3LK 4OIQA 1SFOK 2JA8K 4GZYA 4A3JC 3S1QC 2PPBA 4BXXC 1Y1WC 3H3VD 3HKZD 5IYDK 1K83C 3DXJA 2B63C 4BBRC 5M5YK 3PO3K 4A3IC 3GTOK 4YG2A 2PMZL 3S16K 3S1RK 5C4XC 2O5IA 3M3YK 4A3MK 3GTMK 3S2HC 3K7AC 2YU9C 4XLNA 3S1MK 2WB1L 3PO2K 1I3QC 4BY7C 2R92K 5C4JK 4QJVA 5IYBK 1TWCK 4Q4ZA 3M4OC 3HOUC 3HOVC 2R7ZK 2E2HC 2JA7K 3S14K 3S17K 3S15C 2Y0SL 4A3FC 1I50K 3CQZC 3H0GK 2JA5K 4A3CK 3I4NK 3RZOK 4A93C 2E2IK 4A3KK 4A3GK 4KN7A 4C3HK 5M3MK 4BY1C 3GTLC 4A3DK 3WODA 2NVXC 3HOZC 4Y7NC 2JA6C 2WAQL 4KMUA 1WCMC 2VUMK 1Y1VC 3GTQK 3S1NC 2R93K 4OIPA 1YNJA 2PMZD 4MEXA 1SMYA 1TWHC 2NVYC 3RZDK 5FLMK 5IYCK 4AYBL 2E2JK 3S2DC 3FKIC 3EQLA 2WB1D 4OIOA 4YFXA 5M5WK 4BBSC 2A6EA 5IP9K 1TWAC 4KN4A 1SFOC 2JA8C 1R9TK 4MQ9A 1TWFC 4LK1A 3I4MK 1BDFA 5IYDC 3GTKK 3HOWK 4A3BK 4Q5SA 1ZYRA 4JK1A 3PO3C 5TMFA 2Y0SD 3GTOC 3S1QK 5C44K 3HOYK 3S1RC 3M3YC 3GTJK 3GTGK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3M C;  3GTM C;  4QIW D;  4XSX A;  5IP7 K;  4A3I K;  3S1M C;  1HQM A;  1TWG K;  3GTP C;  5C4X K;  3PO2 C;  2R92 C;  3S2H K;  2WAQ D;  4XSZ A;  4YFK A;  5C4J C;  4A3E K;  5IYB C;  2NVT C;  1TWC C;  1XPP A;  1I3Q K;  2R7Z C;  2JA7 C;  3S17 C;  3S14 C;  4OIR A;  5M3F K;  2PA8 L;  4C3I K;  1I50 C;  3H0G C;  3H3V L;  3HKZ L;  4LLG A;  5M5X K;  5C3E C;  4YFN A;  2JA5 C;  2NVQ K;  4A3C C;  3RZO C;  3I4N C;  4A3G C;  4G7H A;  4A3K C;  2A69 A;  2E2I C;  3CQZ K;  4A3D C;  4A3L C;  4Y52 K;  2R93 C;  2VUM C;  3GTQ C;  3HOX K;  1I6H K;  4X6A K;  5TMC A;  4NOI A;  4G7Z A;  1YNN A;  3RZD C;  5FLM C;  5IYC C;  5D4D A;  4QJV B;  4A3J K;  5FJ8 K;  2E2J C;  4BXX K;  3S16 C;  1Y1W K;  1K83 K;  2B63 K;  5IP9 C;  4OIN A;  4BBR K;  1R9T C;  4LJZ A;  3GTK C;  4G7O A;  3HOW C;  4A3B C;  1TWA K;  3K7A K;  1TWF K;  2YU9 K;  2A68 A;  2PA8 D;  5C44 C;  3HOY C;  4C2M K;  3GTJ C;  3GTG C;  4BY7 K;  5IP7 C;  1I6V A;  1TWG C;  4MEY A;  4AYB D;  3M4O K;  3HOU K;  3HOV K;  3S15 K;  2E2H K;  4A3E C;  4A3F K;  1IW7 A;  3GTP K;  4C3J K;  2NVT K;  4LK0 A;  4A93 K;  4BY1 K;  4ZH4 A;  2BE5 A;  3GTL K;  2A6H A;  2NVX K;  3HOZ K;  4Y7N K;  2JA6 K;  2NVQ C;  2O5J A;  1WCM K;  1Y1V K;  3S1N K;  1TWH K;  5C3E K;  4Y52 C;  2NVY K;  4QIW L;  3HOX C;  2CW0 A;  1I6H C;  3I4M C;  3S2D K;  3FKI K;  4X6A C;  4XLP A;  4BBS K;  4A3L K;  4OIQ A;  1SFO K;  2JA8 K;  4GZY A;  4A3J C;  3S1Q C;  2PPB A;  4BXX C;  1Y1W C;  3H3V D;  3HKZ D;  5IYD K;  1K83 C;  3DXJ A;  2B63 C;  4BBR C;  5M5Y K;  3PO3 K;  4A3I C;  3GTO K;  4YG2 A;  2PMZ L;  3S16 K;  3S1R K;  5C4X C;  2O5I A;  3M3Y K;  4A3M K;  3GTM K;  3S2H C;  3K7A C;  2YU9 C;  4XLN A;  3S1M K;  2WB1 L;  3PO2 K;  1I3Q C;  4BY7 C;  2R92 K;  5C4J K;  4QJV A;  5IYB K;  1TWC K;  4Q4Z A;  3M4O C;  3HOU C;  3HOV C;  2R7Z K;  2E2H C;  2JA7 K;  3S14 K;  3S17 K;  3S15 C;  2Y0S L;  4A3F C;  1I50 K;  3CQZ C;  3H0G K;  2JA5 K;  4A3C K;  3I4N K;  3RZO K;  4A93 C;  2E2I K;  4A3K K;  4A3G K;  4KN7 A;  4C3H K;  5M3M K;  4BY1 C;  3GTL C;  4A3D K;  3WOD A;  2NVX C;  3HOZ C;  4Y7N C;  2JA6 C;  2WAQ L;  4KMU A;  1WCM C;  2VUM K;  1Y1V C;  3GTQ K;  3S1N C;  2R93 K;  4OIP A;  1YNJ A;  2PMZ D;  4MEX A;  1SMY A;  1TWH C;  2NVY C;  3RZD K;  5FLM K;  5IYC K;  4AYB L;  2E2J K;  3S2D C;  3FKI C;  3EQL A;  2WB1 D;  4OIO A;  4YFX A;  5M5W K;  4BBS C;  2A6E A;  5IP9 K;  1TWA C;  4KN4 A;  1SFO C;  2JA8 C;  1R9T K;  4MQ9 A;  1TWF C;  4LK1 A;  3I4M K;  1BDF A;  5IYD C;  3GTK K;  3HOW K;  4A3B K;  4Q5S A;  1ZYR A;  4JK1 A;  3PO3 C;  5TMF A;  2Y0S D;  3GTO C;  3S1Q K;  5C44 K;  3HOY K;  3S1R C;  3M3Y C;  3GTJ K;  3GTG K; 
#chains in the Genus database with same CATH topology
 3GTM C;  3GTP A;  4QIW D;  4A3I K;  3BP8 C;  3GTP C;  1VGX A;  4YFK A;  5C4J C;  4A3E K;  2JA7 A;  3SZZ A;  2JA7 C;  3H0G A;  4OIR A;  3H0G C;  4BLB A;  2JA5 A;  2GAH C;  5C3E C;  4KMH A;  2JA5 C;  3I4N C;  4A3G C;  4KAW X;  4A3D C;  3GTQ A;  3GTQ C;  3HOX K;  1O2A A;  4X6A K;  3JST A;  3GTM A;  5TMC A;  5IYC C;  5D4D A;  4BXX K;  3S16 C;  5E68 A;  4BBR K;  1WQF A;  2GSN A;  1WOP A;  4GTE A;  3HOW C;  3K7A K;  1BGW A;  1TWF K;  2YU9 K;  4LR2 A;  4C2M K;  1USM A;  1ZQ1 C;  3GSI A;  1DCO A;  4AYB D;  1X31 C;  3HOV K;  2E2H K;  1ZBS A;  1O24 A;  1IW7 A;  3T01 A;  3FOF A;  2Y3P A;  4KB4 A;  2NVT K;  4GTB A;  4LK0 A;  4A93 K;  4BY1 K;  3NUH A;  3HOZ K;  4Y7N K;  5JFE A;  1TWH K;  4M1X A;  2NVY K;  3OPF A;  1J98 A;  1O2F B;  1SFO K;  3AQP A;  1GE9 A;  2JH3 A;  1F7V A;  3T02 A;  5EGE A;  5M5Y K;  4A3I C;  5IOR A;  5IOT A;  3GTM K;  5L46 A;  5C4J K;  4Q4Z A;  3G4C A;  3S15 C;  1DD5 A;  2JA7 K;  4XCH A;  3H0G K;  1KQ4 A;  2JA5 K;  3I4N K;  3VA7 A;  4A3G K;  1J6W A;  2NVX A;  4A3D K;  2NVX C;  1WSR A;  4GT9 A;  3GTQ K;  2PMZ D;  5IYC K;  1WOS A;  1J6V A;  3TFH A;  1G51 A;  1O27 A;  1TWF A;  4KN4 A;  2RGR A;  4MQ9 A;  1TWF C;  3ERE D;  3I4M K;  1BDF A;  4PAA A;  1IQ0 A;  3HOW K;  3A8I A;  4GTD A;  1F9N A;  2Y0S D;  2XCQ A;  1IS1 A;  2RH6 A;  4XSX A;  1HQM A;  3PO2 C;  2ZUF A;  1DCH A;  3ADA C;  4PAB A;  2WAQ D;  2P8T A;  4XSZ A;  2NVT C;  1C0A A;  5IYB C;  4KAR A;  1XPP A;  4DDQ A;  3S14 C;  5M3F K;  1O26 A;  3HKZ L;  4LLG A;  1WOO A;  3RZO C;  4A3K C;  2A69 A;  4AH6 A;  3V4G A;  2R93 A;  2R93 C;  4GTA A;  4J3N A;  4LOW A;  1XXA A;  4BKW A;  5TJ3 A;  1YNN A;  4QJV B;  4FZB A;  5FJ8 K;  1WQG A;  3Q3Q A;  4G7O A;  3BUE A;  5C44 C;  1TWG A;  5IP7 C;  1I6V A;  1TWG C;  4MEY A;  3S15 K;  4RMF A;  3AQO A;  3BP3 A;  2NVX K;  3AD9 C;  1UV7 A;  2O5J A;  1XZP B;  2V6S A;  4G0V A;  3T00 A;  4QIW L;  1I6H C;  3I4M C;  1XXC A;  2V6U A;  2FQO A;  4KMD A;  3FOE A;  4GZY A;  1Y1W A;  2PPB A;  1K83 A;  1Y1W C;  3H3V D;  1K83 C;  4YG2 A;  5EGH A;  4ILD A;  4WJ4 A;  5CHP A;  4WIL A;  1ZXO A;  2ZFZ A;  3PO2 K;  4BY7 C;  5CJ9 A;  1YX2 A;  4QJV A;  5IYB K;  2PHC B;  3S0X A;  3S14 K;  4A3F C;  1IBA A;  2D6F C;  2V6T A;  3RZO K;  3SZY A;  4A3K K;  4KN7 A;  2JA6 A;  1IE0 A;  1Y1V A;  2JA6 C;  2R93 K;  2CFA A;  1B4A A;  1EK8 A;  1Y1V C;  3S1N C;  1XXB A;  2P5M A;  4AYB L;  4KM9 A;  2JA8 C;  4WJ3 M;  2W7V A;  5IYD C;  4Q5S A;  3PO3 C;  1XZP A;  3S1Q K;  5C44 K;  3M3Y C;  4LQY A;  4A3M C;  1ISE A;  5IP7 K;  3S1M C;  1TWG K;  2XCO A;  5C4X K;  4KDD A;  3S2H K;  3AD8 C;  2R7Z A;  2R7Z C;  2XCR B;  3S17 C;  2PA8 L;  4YFN A;  2E2I A;  4A3C C;  2E2I C;  2VUM A;  5HL8 A;  4BLA A;  2VUM C;  1I6H K;  1F93 A;  4O2D A;  3N0B A;  2GSU A;  4P5B A;  4G7Z A;  3RZD C;  3GDZ A;  2GAG C;  1Y1W K;  1K83 K;  3TFJ A;  1R9T A;  4OIN A;  1PJ7 A;  1R9T C;  1WSV A;  4A3B C;  1TWA K;  2A68 A;  3HOY C;  1PJ5 A;  4BY7 K;  4KAS A;  1JVI A;  1AB4 A;  1JOE A;  4A3F K;  3OEP A;  3GEI A;  1USO A;  4C3I C;  4ZH4 A;  1O28 A;  2A6H A;  4KM8 A;  2JA6 K;  2FQT A;  3TTG A;  2NVQ C;  1Y1V K;  3S1N K;  1BJT A;  4Y52 C;  2CW0 A;  4XLP A;  4A3L K;  4KAT A;  4OIQ A;  1V5V A;  2JA8 K;  4A3J C;  1XZQ A;  3S1Q C;  4KMA A;  2B63 A;  5IYD K;  2B63 C;  3DXJ A;  2CFA B;  3PO3 K;  5C4X C;  2O5I A;  3M3Y K;  1O29 A;  4A3M K;  4GTF A;  3S2H C;  2KWA A;  1J6X A;  4XLN A;  3S1M K;  2WB1 L;  3LAJ A;  3M4O C;  3HOU C;  2R7Z K;  3S17 K;  3LAP A;  4FM9 A;  3L4K A;  4C3J C;  4A3C K;  3GTL A;  2E2I K;  5M3M K;  4GFQ A;  3GTL C;  5JVO A;  1WCM A;  3G4A A;  1WCM C;  2VUM K;  5IOS A;  1EFW A;  1YNJ A;  1SMY A;  3RZD K;  3FKI A;  3S2D C;  3FKI C;  3EQL A;  4BBS C;  1TWA A;  3GIR A;  3AD7 C;  1TWA C;  1R9T K;  4A3B K;  3GTO A;  1ZYR A;  5TMF A;  3GTO C;  3HOY K;  1WQH A;  3S1R C;  2R92 A;  1YCL A;  2R92 C;  1TWC A;  4C45 A;  1TWC C;  1ZVU A;  1VJE A;  3MML B;  1I3Q K;  5IOQ A;  1VLO A;  1I50 A;  4C3I K;  1I50 C;  1BS2 A;  3H3V L;  5M5X K;  2NVQ K;  4G7H A;  4C3H C;  3CQZ K;  4A3L C;  4Y52 K;  2EBB A;  3N3Y A;  4NOI A;  5FLM C;  4A3J K;  2E2J C;  2B63 K;  3AH5 A;  1JQW A;  5IP9 C;  4GTL A;  4P5A A;  4LJZ A;  3GTK A;  3GTK C;  2PA8 D;  3GTJ A;  3GTG A;  3GTJ C;  3TFI A;  3GTG C;  3QX3 A;  1XZQ B;  3M4O K;  3HOU K;  1VRQ C;  4A3E C;  3GTP K;  4C3J K;  1EQR A;  1O2B A;  2BE5 A;  3GTL K;  3ORE A;  1WCM K;  3CAG A;  5C3E K;  3HOX C;  3S2D K;  3FKI K;  4X6A C;  4BBS K;  3GEE A;  4BXX C;  3HKZ D;  3N0C A;  1RU0 A;  4BBR C;  3GTO K;  4GTC A;  3S16 K;  2PMZ L;  1HI9 A;  3S1R K;  4G0W A;  1EI6 A;  2YU9 A;  1INN A;  3K7A C;  2YU9 C;  4KB2 A;  1I3Q A;  4C2M C;  1I3Q C;  2R92 K;  4KC6 A;  1TWC K;  1WIH A;  2E2H A;  3HXA A;  3HOV C;  2E2H C;  4G0U A;  1IL2 A;  3CQZ A;  2Y0S L;  1L0W A;  1EH1 A;  1I50 K;  3CQZ C;  4A93 C;  4C3H K;  4BY1 C;  3WOD A;  3HOZ C;  4Y7N C;  4P9S A;  3FHZ A;  2WAQ L;  4KMU A;  2ZUE A;  4OIP A;  1O25 A;  1TWH A;  2NVY A;  4MEX A;  1TWH C;  1B4B A;  1DCP A;  2NVY C;  5FLM K;  3LPX A;  3A8J A;  3A8K A;  2E2J K;  2WB1 D;  4OIO A;  4YFX A;  5M5W K;  1SFO A;  1F7U A;  1WOR A;  3GEH A;  2A6E A;  5IP9 K;  1SFO C;  4LK1 A;  3GTK K;  2GSO A;  4JK1 A;  3IPJ A;  3GTJ K;  1PJ6 A;  3L4J A;  1VH2 A;  3GTG K; 
#chains in the Genus database with same CATH homology
 4A3M C;  3GTM C;  4QIW D;  4XSX A;  5IP7 K;  4A3I K;  3S1M C;  1HQM A;  1TWG K;  3GTP C;  5C4X K;  3PO2 C;  2R92 C;  3S2H K;  2WAQ D;  4XSZ A;  4YFK A;  5C4J C;  4A3E K;  5IYB C;  2NVT C;  1TWC C;  1XPP A;  1I3Q K;  2R7Z C;  2JA7 C;  3S17 C;  3S14 C;  4OIR A;  5M3F K;  2PA8 L;  4C3I K;  1I50 C;  3H0G C;  3H3V L;  3HKZ L;  4LLG A;  5M5X K;  5C3E C;  4YFN A;  2JA5 C;  2NVQ K;  4A3C C;  3RZO C;  3I4N C;  4A3G C;  4G7H A;  4A3K C;  2A69 A;  2E2I C;  3CQZ K;  4A3D C;  4A3L C;  4Y52 K;  2R93 C;  2VUM C;  3GTQ C;  3HOX K;  1I6H K;  4X6A K;  5TMC A;  4NOI A;  4G7Z A;  1YNN A;  3RZD C;  5FLM C;  5IYC C;  5D4D A;  4QJV B;  4A3J K;  5FJ8 K;  2E2J C;  4BXX K;  3S16 C;  1Y1W K;  1K83 K;  2B63 K;  5IP9 C;  4OIN A;  4BBR K;  1R9T C;  4LJZ A;  3GTK C;  4G7O A;  3HOW C;  4A3B C;  1TWA K;  3K7A K;  1TWF K;  2YU9 K;  2A68 A;  2PA8 D;  5C44 C;  3HOY C;  4C2M K;  3GTJ C;  3GTG C;  4BY7 K;  5IP7 C;  1I6V A;  1TWG C;  4MEY A;  4AYB D;  3M4O K;  3HOU K;  3HOV K;  3S15 K;  2E2H K;  4A3E C;  4A3F K;  1IW7 A;  3GTP K;  4C3J K;  2NVT K;  4LK0 A;  4A93 K;  4BY1 K;  4ZH4 A;  2BE5 A;  3GTL K;  2A6H A;  2NVX K;  3HOZ K;  4Y7N K;  2JA6 K;  2NVQ C;  2O5J A;  1WCM K;  1Y1V K;  3S1N K;  1TWH K;  5C3E K;  4Y52 C;  2NVY K;  4QIW L;  3HOX C;  2CW0 A;  1I6H C;  3I4M C;  3S2D K;  3FKI K;  4X6A C;  4XLP A;  4BBS K;  4A3L K;  4OIQ A;  1SFO K;  2JA8 K;  4GZY A;  4A3J C;  3S1Q C;  2PPB A;  4BXX C;  1Y1W C;  3H3V D;  3HKZ D;  5IYD K;  1K83 C;  3DXJ A;  2B63 C;  4BBR C;  5M5Y K;  3PO3 K;  4A3I C;  3GTO K;  4YG2 A;  2PMZ L;  3S16 K;  3S1R K;  5C4X C;  2O5I A;  3M3Y K;  4A3M K;  3GTM K;  3S2H C;  3K7A C;  2YU9 C;  4XLN A;  3S1M K;  2WB1 L;  3PO2 K;  1I3Q C;  4BY7 C;  2R92 K;  5C4J K;  4QJV A;  5IYB K;  1TWC K;  4Q4Z A;  3M4O C;  3HOU C;  3HOV C;  2R7Z K;  2E2H C;  2JA7 K;  3S14 K;  3S17 K;  3S15 C;  2Y0S L;  4A3F C;  1I50 K;  3CQZ C;  3H0G K;  2JA5 K;  4A3C K;  3I4N K;  3RZO K;  4A93 C;  2E2I K;  4A3K K;  4A3G K;  4KN7 A;  4C3H K;  5M3M K;  4BY1 C;  3GTL C;  4A3D K;  3WOD A;  2NVX C;  3HOZ C;  4Y7N C;  2JA6 C;  2WAQ L;  4KMU A;  1WCM C;  2VUM K;  1Y1V C;  3GTQ K;  3S1N C;  2R93 K;  4OIP A;  1YNJ A;  2PMZ D;  4MEX A;  1SMY A;  1TWH C;  2NVY C;  3RZD K;  5FLM K;  5IYC K;  4AYB L;  2E2J K;  3S2D C;  3FKI C;  3EQL A;  2WB1 D;  4OIO A;  4YFX A;  5M5W K;  4BBS C;  2A6E A;  5IP9 K;  1TWA C;  4KN4 A;  1SFO C;  2JA8 C;  1R9T K;  4MQ9 A;  1TWF C;  4LK1 A;  3I4M K;  1BDF A;  5IYD C;  3GTK K;  3HOW K;  4A3B K;  4Q5S A;  1ZYR A;  4JK1 A;  3PO3 C;  5TMF A;  2Y0S D;  3GTO C;  3S1Q K;  5C44 K;  3HOY K;  3S1R C;  3M3Y C;  3GTJ K;  3GTG K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...