1K83K

Crystal structure of yeast rna polymerase ii complexed with the inhibitor alpha amanitin
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Transcription: Alpha-Amanitin-RNA Polymerase II Cocrystal at 2.8 A Resolution.
pubmed doi rcsb
molecule tags Transcription/toxin
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 31
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 1k83K00
5IYCC 3GTMK 3GTQC 1TWFK 2PA8D 5IYBK 1Y1WK 2JA7K 4AYBD 2A69A 2E2HK 2NVTK 3M4OC 4X6AK 4KN7A 2JA5K 3S2DC 3HKZD 4MQ9A 1K83C 3RZOK 5M5WK 2CW0A 4BXXC 5C4XC 3S14K 5FLMC 3EQLA 1R9TC 4BY7C 5IYDK 1TWAC 2Y0SL 5M5XK 4BBRK 2R7ZK 3PO2K 4QJVA 3I4NC 4A3KC 4BBSK 3HOZK 3K7AK 2WB1L 4LK0A 5IP9C 5FJ8K 4A3EK 4OIQA 3HOWK 3PO3C 4A3IK 4KMUA 4Y7NC 2E2JK 2R92K 4BBSC 2R93K 1SFOK 4OIRA 3H3VL 4A3CK 3S1MK 3GTKK 3S1QK 3S1RC 2PMZD 4BY1C 4Y52K 4A3FK 1Y1VC 3GTOC 4X6AC 2NVTC 4C3HK 1WCMC 5IYCK 3GTGC 1HQMA 4C2MK 3HOYC 1I6VA 4LLGA 1TWHK 4OIOA 4A3FC 2PMZL 2VUMK 3S17C 4XSXA 3S1QC 2YU9K 4A3GC 1BDFA 3HOUC 4G7ZA 4ZH4A 4A3IC 2E2JC 5C44C 4YG2A 3H0GK 4A3MK 5IP9K 4A3EC 1TWHC 4LK1A 2NVQC 3H3VD 4C3IK 3PO3K 2E2IC 2NVQK 4A3KK 1I6HC 3WODA 3S15C 4BBRC 5FLMK 3PO2C 5IP7K 1TWAK 5M3MK 3HOVK 5TMCA 2A6EA 5C4XK 1R9TK 2WAQL 3GTOK 3RZOC 3S2DK 3GTJC 1K83K 4C3JK 2B63C 4OINA 2VUMC 1Y1WC 3S17K 2WAQD 4G7HA 5C4JC 1SFOC 5IP7C 5C3EC 3HOXC 1WCMK 4JK1A 3GTLK 4A3DK 4YFNA 2A68A 4MEYA 3H0GC 4A3MC 3S14C 1TWGC 3GTKC 4Q4ZA 2PPBA 3HOUK 2YU9C 4A3GK 4Q5SA 3HOYK 1SMYA 1I50K 3HOWC 3GTGK 4MEXA 5C3EK 3HOXK 2JA8K 3S16K 3S2HK 1IW7A 4YFXA 1I3QC 3I4MC 1ZYRA 4QIWL 4GZYA 2B63K 4Y52C 5M3FK 4BY1K 1Y1VK 2PA8L 5D4DA 2JA5C 2JA6K 4XSZA 3M4OK 3CQZK 2BE5A 4QIWD 4XLNA 3S1NC 5IYBC 3S1MC 4A3LC 4A3BK 4QJVB 1I6HK 2A6HA 3M3YC 2R92C 2R93C 3I4NK 2E2IK 4A3DC 2R7ZC 3K7AC 3M3YK 1TWCK 3FKIC 3RZDK 5IYDC 5C44K 4A3CC 2NVYC 2NVXK 5C4JK 2Y0SD 4A3BC 3DXJA 4BXXK 4A93C 4AYBL 3CQZC 1XPPA 5TMFA 3GTJK 4LJZA 2E2HC 3S1NK 2O5JA 2O5IA 3HKZL 4A93K 1I3QK 2WB1D 3HOVC 3GTQK 2JA7C 4G7OA 2JA8C 3S16C 2NVYK 1TWFC 1YNJA 4NOIA 3I4MK 3S15K 4XLPA 3GTMC 4YFKA 3GTPK 1I50C 4BY7K 4KN4A 4A3JC 1YNNA 3S1RK 4A3LK 1TWGK 2JA6C 5M5YK 2NVXC 4Y7NK 1TWCC 3FKIK 4A3JK 3RZDC 3GTLC 3HOZC 4OIPA 3S2HC 3GTPC
chains in the Genus database with same CATH superfamily
3GTMK 2RH6A 3H0GA 1YCLA 2PA8D 1Y1WK 4AYBD 4X6AK 3M4OC 2GSUA 3VA7A 3GTGA 3HKZD 3RZOK 1K83C 1VRQC 3CAGA 2NVXA 2R7ZK 5M5XK 4QJVA 2EBBA 3HOZK 2GAHC 3K7AK 3HOWK 1BJTA 1UV7A 4OIRA 4KMHA 3S1RC 4A3FK 3GTOC 4X6AC 1INNA 4G0UA 1HQMA 4LLGA 1TWHK 4OIOA 3S17C 4GTAA 3FKIA 2GSOA 4KARA 1WCMA 4G7ZA 3HOUC 2V6TA 1HI9A 1O25A 4KB2A 4A3MK 4GFQA 5IP9K 3PO3K 1TWHC 1F93A 3GTJA 4KATA 3WODA 4BBRC 3GTOK 3S2DK 1WQHA 2P5MA 3GTJC 4OINA 3S17K 1TWHA 4GT9A 3T02A 5C4JC 4G7HA 3G4CA 3HOXC 5TJ3A 1XXCA 4P5AA 4JK1A 3GTLK 4G0WA 2JH3A 3H0GC 4ILDA 3L4JA 2YU9C 2CFAA 1IQ0A 1SMYA 3GTOA 3HOWC 3HOXK 1USMA 2JA8K 4YFXA 2FQTA 4Y52C 5M3FK 4GTFA 3M4OK 2FQOA 1ZXOA 3M3YC 3I4NK 1BS2A 3GEHA 3M3YK 1DCOA 2NVXK 3JSTA 4A3BC 3DXJA 3A8KA 5TMFA 1XPPA 3S1NK 4BLAA 4A93K 3HOVC 3GTQK 4RMFA 2JA8C 1X31C 3S15K 3FOFA 4BY7K 4KN4A 4A3JC 3BUEA 1YNNA 3S1RK 4A3LK 1ZQ1C 2PHCB 2ZUEA 1DD5A 1TWAA 1TWCC 3FKIK 3RZDC 3GTLC 3HOZC 3G4AA 3GTPC 3GTQC 1TWFK 5IYBK 1VJEA 2JA7K 2A69A 1J98A 4FZBA 3S2DC 2JA5K 4MQ9A 2CW0A 1EH1A 3S14K 1R9TC 1G51A 1TWAC 4WJ4A 4BBSK 3I4NC 4A3KC 5IP9C 5FJ8K 3PO3C 1ZVUA 1VH2A 4Y7NC 2R92K 1SFOK 4XCHA 3S1MK 1O26A 3SZZA 2PMZD 4Y52K 1WQFA 1Y1VC 1B4BA 2NVTC 2ZFZA 4KC6A 5IYCK 1I6VA 4A3FC 2PMZL 4A3GC 1BDFA 1WSVA 3IPJA 4YG2A 1J6XA 1Y1WA 3AH5A 4C3IK 2E2IC 4C2MC 2NVQK 3TFJA 1XZPA 3PO2C 3AD9C 3RZOC 3N3YA 1Y1WC 4BKWA 2XCQA 5IP7C 5C3EC 4A3DK 2A68A 1L0WA 1PJ5A 2XCOA 3AQPA 1TWGC 3GTKC 2R7ZA 4Q4ZA 3A8JA 2Y3PA 1I50K 2B63A 5EGEA 3BP8C 1AB4A 5IOSA 3S16K 3S2HK 1IW7A 1O24A 3I4MC 1USOA 5D4DA 2JA6K 4XSZA 2BE5A 1XZQB 1TWFA 1J6VA 2A6HA 2R93C 5IOQA 1XZPB 2R7ZC 5C44K 4A3CC 2Y0SD 3GTQA 1XXBA 4AYBL 5CHPA 4LJZA 2O5IA 3HKZL 1EFWA 4G7OA 3GEEA 2NVYK 2JA6A 3I4MK 4XLPA 4YFKA 1XXAA 4DDQA 4KDDA 1ZBSA 2RGRA 1ISEA 1EQRA 4KMDA 1O2FB 2E2HK 1WOSA 1XZQA 4KN7A 5C4XC 5IORA 1VLOA 3OPFA 1O2AA 5IYDK 1EI6A 4P5BA 3PO2K 4Q5SA 4LK0A 4C3IC 3T00A 4A3IK 3SZYA 3A8IA 2R93K 1I3QA 4GTDA 3H3VL 5EGHA 3S1QK 4BY1C 1O28A 1F7VA 1WCMC 4KMAA 1WQGA 4C3HC 1KQ4A 1JVIA 2V6SA 4O2DA 4M1XA 2VUMK 1J6WA 5L46A 1IE0A 1JOEA 1IL2A 4ZH4A 3GTLA 2E2JC 4A3EC 4LK1A 2JA5A 5JFEA 4AH6A 4A3KK 1I6HC 3OREA 5FLMK 5IP7K 1TWAK 5M3MK 3TTGA 4C3JC 5TMCA 2A6EA 1R9TK 1WORA 2WAQL 3V4GA 4GTLA 1PJ6A 1C0AA 2B63C 2VUMC 2WAQD 3AD7C 1WCMK 4G0VA 2W7VA 4MEYA 2NVYA 4WILA 1WSRA 2PPBA 4A3GK 3LAPA 1BGWA 3HOYK 3T01A 3GTGK 4MEXA 4J3NA 3N0BA 1I3QC 4QIWL 2B63K 2KWAA 1DCHA 3ADAC 1Y1VK 3FHZA 4KM8A 3GTMA 3S1NC 4QIWD 2E2IA 3S1MC 4A3BK 1I6HK 2R92C 4GTCA 3CQZA 4A3DC 4LOWA 3S0XA 2NVYC 2V6UA 4KAWX 4BXXK 4GTBA 1YX2A 2O5JA 2R93A 1I3QK 2JA7C 1Y1VA 1TWFC 1YNJA 4LQYA 3GTPK 2JA6C 2XCRB 5IOTA 3Q3QA 4A3JK 3GEIA 2E2HA 4OIPA 4KB4A 3S2HC 3GTKA 4BY7C 5IYCC 3MMLB 5CJ9A 1O2BA 2NVTK 4BXXC 5M5WK 3OEPA 4LR2A 5FLMC 3EQLA 1V5VA 4PABA 2Y0SL 4BBRK 2WB1L 4A3EK 4OIQA 4BBSC 2E2JK 4KMUA 1WOPA 1WOOA 3GTKK 3GDZA 2JA7A 4C3HK 3AQOA 3GIRA 3GTGC 1TWGA 4KASA 4C2MK 3HOYC 4PAAA 5HL8A 1IS1A 4XSXA 4GTEA 3S1QC 2YU9K 1O27A 3LPXA 2ZUFA 3QX3A 4A3IC 5C44C 4A3CK 3H0GK 1RU0A 2NVQC 3H3VD 1F9NA 1WIHA 3LAJA 3S15C 4KM9A 1JQWA 3HOVK 5C4XK 1I50A 4BLBA 1K83K 2CFAB 4C3JK 4C45A 1R9TA 1SFOC 2YU9A 3GSIA 4YFNA 1EK8A 4A3MC 3HXAA 1F7UA 3N0CA 3S14C 3GTPA 3HOUK 1TWCA 2VUMA 5JVOA 5C3EK 3BP3A 1O29A 1IBAA 1ZYRA 4GZYA 4BY1K 1VGXA 3ERED 2GAGC 2JA5C 1DCPA 3CQZK 4XLNA 5IYBC 4A3LC 3NUHA 4QJVB 4FM9A 2E2IK 3AD8C 1B4AA 3K7AC 5E68A 1TWCK 3FKIC 3RZDK 5IYDC 3TFHA 5C4JK 4A93C 1PJ7A 3CQZC 3GTJK 2E2HC 2R92A 1SFOA 2WB1D 3S16C 4NOIA 3GTMC 4WJ3M 1I50C 3L4KA 4P9SA 3FOEA 1TWGK 2GSNA 1GE9A 5M5YK 2NVXC 4Y7NK 2D6FC 2P8TA 2PA8L 1K83A 3TFIA
chains in the Genus database with same CATH topology
5IYCC 3GTMK 3GTQC 1TWFK 2PA8D 5IYBK 1Y1WK 2JA7K 4AYBD 2A69A 2E2HK 2NVTK 3M4OC 4X6AK 4KN7A 2JA5K 3S2DC 3HKZD 4MQ9A 1K83C 3RZOK 5M5WK 2CW0A 4BXXC 5C4XC 3S14K 5FLMC 3EQLA 1R9TC 4BY7C 5IYDK 1TWAC 2Y0SL 5M5XK 4BBRK 2R7ZK 3PO2K 4QJVA 3I4NC 4A3KC 4BBSK 3HOZK 3K7AK 2WB1L 4LK0A 5IP9C 5FJ8K 4A3EK 4OIQA 3HOWK 3PO3C 4A3IK 4KMUA 4Y7NC 2E2JK 2R92K 4BBSC 2R93K 1SFOK 4OIRA 3H3VL 4A3CK 3S1MK 3GTKK 3S1QK 3S1RC 2PMZD 4BY1C 4Y52K 4A3FK 1Y1VC 3GTOC 4X6AC 2NVTC 4C3HK 1WCMC 5IYCK 3GTGC 1HQMA 4C2MK 3HOYC 1I6VA 4LLGA 1TWHK 4OIOA 4A3FC 2PMZL 2VUMK 3S17C 4XSXA 3S1QC 2YU9K 4A3GC 1BDFA 3HOUC 4G7ZA 4ZH4A 4A3IC 2E2JC 5C44C 4YG2A 3H0GK 4A3MK 5IP9K 4A3EC 1TWHC 4LK1A 2NVQC 3H3VD 4C3IK 3PO3K 2E2IC 2NVQK 4A3KK 1I6HC 3WODA 3S15C 4BBRC 5FLMK 3PO2C 5IP7K 1TWAK 5M3MK 3HOVK 5TMCA 2A6EA 5C4XK 1R9TK 2WAQL 3GTOK 3RZOC 3S2DK 3GTJC 1K83K 4C3JK 2B63C 4OINA 2VUMC 1Y1WC 3S17K 2WAQD 4G7HA 5C4JC 1SFOC 5IP7C 5C3EC 3HOXC 1WCMK 4JK1A 3GTLK 4A3DK 4YFNA 2A68A 4MEYA 3H0GC 4A3MC 3S14C 1TWGC 3GTKC 4Q4ZA 2PPBA 3HOUK 2YU9C 4A3GK 4Q5SA 3HOYK 1SMYA 1I50K 3HOWC 3GTGK 4MEXA 5C3EK 3HOXK 2JA8K 3S16K 3S2HK 1IW7A 4YFXA 1I3QC 3I4MC 1ZYRA 4QIWL 4GZYA 2B63K 4Y52C 5M3FK 4BY1K 1Y1VK 2PA8L 5D4DA 2JA5C 2JA6K 4XSZA 3M4OK 3CQZK 2BE5A 4QIWD 4XLNA 3S1NC 5IYBC 3S1MC 4A3LC 4A3BK 4QJVB 1I6HK 2A6HA 3M3YC 2R92C 2R93C 3I4NK 2E2IK 4A3DC 2R7ZC 3K7AC 3M3YK 1TWCK 3FKIC 3RZDK 5IYDC 5C44K 4A3CC 2NVYC 2NVXK 5C4JK 2Y0SD 4A3BC 3DXJA 4BXXK 4A93C 4AYBL 3CQZC 1XPPA 5TMFA 3GTJK 4LJZA 2E2HC 3S1NK 2O5JA 2O5IA 3HKZL 4A93K 1I3QK 2WB1D 3HOVC 3GTQK 2JA7C 4G7OA 2JA8C 3S16C 2NVYK 1TWFC 1YNJA 4NOIA 3I4MK 3S15K 4XLPA 3GTMC 4YFKA 3GTPK 1I50C 4BY7K 4KN4A 4A3JC 1YNNA 3S1RK 4A3LK 1TWGK 2JA6C 5M5YK 2NVXC 4Y7NK 1TWCC 3FKIK 4A3JK 3RZDC 3GTLC 3HOZC 4OIPA 3S2HC 3GTPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYC C;  3GTM K;  3GTQ C;  1TWF K;  2PA8 D;  5IYB K;  1Y1W K;  2JA7 K;  4AYB D;  2A69 A;  2E2H K;  2NVT K;  3M4O C;  4X6A K;  4KN7 A;  2JA5 K;  3S2D C;  3HKZ D;  4MQ9 A;  1K83 C;  3RZO K;  5M5W K;  2CW0 A;  4BXX C;  5C4X C;  3S14 K;  5FLM C;  3EQL A;  1R9T C;  4BY7 C;  5IYD K;  1TWA C;  2Y0S L;  5M5X K;  4BBR K;  2R7Z K;  3PO2 K;  4QJV A;  3I4N C;  4A3K C;  4BBS K;  3HOZ K;  3K7A K;  2WB1 L;  4LK0 A;  5IP9 C;  5FJ8 K;  4A3E K;  4OIQ A;  3HOW K;  3PO3 C;  4A3I K;  4KMU A;  4Y7N C;  2E2J K;  2R92 K;  4BBS C;  2R93 K;  1SFO K;  4OIR A;  3H3V L;  4A3C K;  3S1M K;  3GTK K;  3S1Q K;  3S1R C;  2PMZ D;  4BY1 C;  4Y52 K;  4A3F K;  1Y1V C;  3GTO C;  4X6A C;  2NVT C;  4C3H K;  1WCM C;  5IYC K;  3GTG C;  1HQM A;  4C2M K;  3HOY C;  1I6V A;  4LLG A;  1TWH K;  4OIO A;  4A3F C;  2PMZ L;  2VUM K;  3S17 C;  4XSX A;  3S1Q C;  2YU9 K;  4A3G C;  1BDF A;  3HOU C;  4G7Z A;  4ZH4 A;  4A3I C;  2E2J C;  5C44 C;  4YG2 A;  3H0G K;  4A3M K;  5IP9 K;  4A3E C;  1TWH C;  4LK1 A;  2NVQ C;  3H3V D;  4C3I K;  3PO3 K;  2E2I C;  2NVQ K;  4A3K K;  1I6H C;  3WOD A;  3S15 C;  4BBR C;  5FLM K;  3PO2 C;  5IP7 K;  1TWA K;  5M3M K;  3HOV K;  5TMC A;  2A6E A;  5C4X K;  1R9T K;  2WAQ L;  3GTO K;  3RZO C;  3S2D K;  3GTJ C;  1K83 K;  4C3J K;  2B63 C;  4OIN A;  2VUM C;  1Y1W C;  3S17 K;  2WAQ D;  4G7H A;  5C4J C;  1SFO C;  5IP7 C;  5C3E C;  3HOX C;  1WCM K;  4JK1 A;  3GTL K;  4A3D K;  4YFN A;  2A68 A;  4MEY A;  3H0G C;  4A3M C;  3S14 C;  1TWG C;  3GTK C;  4Q4Z A;  2PPB A;  3HOU K;  2YU9 C;  4A3G K;  4Q5S A;  3HOY K;  1SMY A;  1I50 K;  3HOW C;  3GTG K;  4MEX A;  5C3E K;  3HOX K;  2JA8 K;  3S16 K;  3S2H K;  1IW7 A;  4YFX A;  1I3Q C;  3I4M C;  1ZYR A;  4QIW L;  4GZY A;  2B63 K;  4Y52 C;  5M3F K;  4BY1 K;  1Y1V K;  2PA8 L;  5D4D A;  2JA5 C;  2JA6 K;  4XSZ A;  3M4O K;  3CQZ K;  2BE5 A;  4QIW D;  4XLN A;  3S1N C;  5IYB C;  3S1M C;  4A3L C;  4A3B K;  4QJV B;  1I6H K;  2A6H A;  3M3Y C;  2R92 C;  2R93 C;  3I4N K;  2E2I K;  4A3D C;  2R7Z C;  3K7A C;  3M3Y K;  1TWC K;  3FKI C;  3RZD K;  5IYD C;  5C44 K;  4A3C C;  2NVY C;  2NVX K;  5C4J K;  2Y0S D;  4A3B C;  3DXJ A;  4BXX K;  4A93 C;  4AYB L;  3CQZ C;  1XPP A;  5TMF A;  3GTJ K;  4LJZ A;  2E2H C;  3S1N K;  2O5J A;  2O5I A;  3HKZ L;  4A93 K;  1I3Q K;  2WB1 D;  3HOV C;  3GTQ K;  2JA7 C;  4G7O A;  2JA8 C;  3S16 C;  2NVY K;  1TWF C;  1YNJ A;  4NOI A;  3I4M K;  3S15 K;  4XLP A;  3GTM C;  4YFK A;  3GTP K;  1I50 C;  4BY7 K;  4KN4 A;  4A3J C;  1YNN A;  3S1R K;  4A3L K;  1TWG K;  2JA6 C;  5M5Y K;  2NVX C;  4Y7N K;  1TWC C;  3FKI K;  4A3J K;  3RZD C;  3GTL C;  3HOZ C;  4OIP A;  3S2H C;  3GTP C; 
#chains in the Genus database with same CATH topology
 3GTM K;  2RH6 A;  3H0G A;  1YCL A;  2PA8 D;  1Y1W K;  4AYB D;  4X6A K;  3M4O C;  2GSU A;  3VA7 A;  3GTG A;  3HKZ D;  3RZO K;  1K83 C;  1VRQ C;  3CAG A;  2NVX A;  2R7Z K;  5M5X K;  4QJV A;  2EBB A;  3HOZ K;  2GAH C;  3K7A K;  3HOW K;  1BJT A;  1UV7 A;  4OIR A;  4KMH A;  3S1R C;  4A3F K;  3GTO C;  4X6A C;  1INN A;  4G0U A;  1HQM A;  4LLG A;  1TWH K;  4OIO A;  3S17 C;  4GTA A;  3FKI A;  2GSO A;  4KAR A;  1WCM A;  4G7Z A;  3HOU C;  2V6T A;  1HI9 A;  1O25 A;  4KB2 A;  4A3M K;  4GFQ A;  5IP9 K;  3PO3 K;  1TWH C;  1F93 A;  3GTJ A;  4KAT A;  3WOD A;  4BBR C;  3GTO K;  3S2D K;  1WQH A;  2P5M A;  3GTJ C;  4OIN A;  3S17 K;  1TWH A;  4GT9 A;  3T02 A;  5C4J C;  4G7H A;  3G4C A;  3HOX C;  5TJ3 A;  1XXC A;  4P5A A;  4JK1 A;  3GTL K;  4G0W A;  2JH3 A;  3H0G C;  4ILD A;  3L4J A;  2YU9 C;  2CFA A;  1IQ0 A;  1SMY A;  3GTO A;  3HOW C;  3HOX K;  1USM A;  2JA8 K;  4YFX A;  2FQT A;  4Y52 C;  5M3F K;  4GTF A;  3M4O K;  2FQO A;  1ZXO A;  3M3Y C;  3I4N K;  1BS2 A;  3GEH A;  3M3Y K;  1DCO A;  2NVX K;  3JST A;  4A3B C;  3DXJ A;  3A8K A;  5TMF A;  1XPP A;  3S1N K;  4BLA A;  4A93 K;  3HOV C;  3GTQ K;  4RMF A;  2JA8 C;  1X31 C;  3S15 K;  3FOF A;  4BY7 K;  4KN4 A;  4A3J C;  3BUE A;  1YNN A;  3S1R K;  4A3L K;  1ZQ1 C;  2PHC B;  2ZUE A;  1DD5 A;  1TWA A;  1TWC C;  3FKI K;  3RZD C;  3GTL C;  3HOZ C;  3G4A A;  3GTP C;  3GTQ C;  1TWF K;  5IYB K;  1VJE A;  2JA7 K;  2A69 A;  1J98 A;  4FZB A;  3S2D C;  2JA5 K;  4MQ9 A;  2CW0 A;  1EH1 A;  3S14 K;  1R9T C;  1G51 A;  1TWA C;  4WJ4 A;  4BBS K;  3I4N C;  4A3K C;  5IP9 C;  5FJ8 K;  3PO3 C;  1ZVU A;  1VH2 A;  4Y7N C;  2R92 K;  1SFO K;  4XCH A;  3S1M K;  1O26 A;  3SZZ A;  2PMZ D;  4Y52 K;  1WQF A;  1Y1V C;  1B4B A;  2NVT C;  2ZFZ A;  4KC6 A;  5IYC K;  1I6V A;  4A3F C;  2PMZ L;  4A3G C;  1BDF A;  1WSV A;  3IPJ A;  4YG2 A;  1J6X A;  1Y1W A;  3AH5 A;  4C3I K;  2E2I C;  4C2M C;  2NVQ K;  3TFJ A;  1XZP A;  3PO2 C;  3AD9 C;  3RZO C;  3N3Y A;  1Y1W C;  4BKW A;  2XCQ A;  5IP7 C;  5C3E C;  4A3D K;  2A68 A;  1L0W A;  1PJ5 A;  2XCO A;  3AQP A;  1TWG C;  3GTK C;  2R7Z A;  4Q4Z A;  3A8J A;  2Y3P A;  1I50 K;  2B63 A;  5EGE A;  3BP8 C;  1AB4 A;  5IOS A;  3S16 K;  3S2H K;  1IW7 A;  1O24 A;  3I4M C;  1USO A;  5D4D A;  2JA6 K;  4XSZ A;  2BE5 A;  1XZQ B;  1TWF A;  1J6V A;  2A6H A;  2R93 C;  5IOQ A;  1XZP B;  2R7Z C;  5C44 K;  4A3C C;  2Y0S D;  3GTQ A;  1XXB A;  4AYB L;  5CHP A;  4LJZ A;  2O5I A;  3HKZ L;  1EFW A;  4G7O A;  3GEE A;  2NVY K;  2JA6 A;  3I4M K;  4XLP A;  4YFK A;  1XXA A;  4DDQ A;  4KDD A;  1ZBS A;  2RGR A;  1ISE A;  1EQR A;  4KMD A;  1O2F B;  2E2H K;  1WOS A;  1XZQ A;  4KN7 A;  5C4X C;  5IOR A;  1VLO A;  3OPF A;  1O2A A;  5IYD K;  1EI6 A;  4P5B A;  3PO2 K;  4Q5S A;  4LK0 A;  4C3I C;  3T00 A;  4A3I K;  3SZY A;  3A8I A;  2R93 K;  1I3Q A;  4GTD A;  3H3V L;  5EGH A;  3S1Q K;  4BY1 C;  1O28 A;  1F7V A;  1WCM C;  4KMA A;  1WQG A;  4C3H C;  1KQ4 A;  1JVI A;  2V6S A;  4O2D A;  4M1X A;  2VUM K;  1J6W A;  5L46 A;  1IE0 A;  1JOE A;  1IL2 A;  4ZH4 A;  3GTL A;  2E2J C;  4A3E C;  4LK1 A;  2JA5 A;  5JFE A;  4AH6 A;  4A3K K;  1I6H C;  3ORE A;  5FLM K;  5IP7 K;  1TWA K;  5M3M K;  3TTG A;  4C3J C;  5TMC A;  2A6E A;  1R9T K;  1WOR A;  2WAQ L;  3V4G A;  4GTL A;  1PJ6 A;  1C0A A;  2B63 C;  2VUM C;  2WAQ D;  3AD7 C;  1WCM K;  4G0V A;  2W7V A;  4MEY A;  2NVY A;  4WIL A;  1WSR A;  2PPB A;  4A3G K;  3LAP A;  1BGW A;  3HOY K;  3T01 A;  3GTG K;  4MEX A;  4J3N A;  3N0B A;  1I3Q C;  4QIW L;  2B63 K;  2KWA A;  1DCH A;  3ADA C;  1Y1V K;  3FHZ A;  4KM8 A;  3GTM A;  3S1N C;  4QIW D;  2E2I A;  3S1M C;  4A3B K;  1I6H K;  2R92 C;  4GTC A;  3CQZ A;  4A3D C;  4LOW A;  3S0X A;  2NVY C;  2V6U A;  4KAW X;  4BXX K;  4GTB A;  1YX2 A;  2O5J A;  2R93 A;  1I3Q K;  2JA7 C;  1Y1V A;  1TWF C;  1YNJ A;  4LQY A;  3GTP K;  2JA6 C;  2XCR B;  5IOT A;  3Q3Q A;  4A3J K;  3GEI A;  2E2H A;  4OIP A;  4KB4 A;  3S2H C;  3GTK A;  4BY7 C;  5IYC C;  3MML B;  5CJ9 A;  1O2B A;  2NVT K;  4BXX C;  5M5W K;  3OEP A;  4LR2 A;  5FLM C;  3EQL A;  1V5V A;  4PAB A;  2Y0S L;  4BBR K;  2WB1 L;  4A3E K;  4OIQ A;  4BBS C;  2E2J K;  4KMU A;  1WOP A;  1WOO A;  3GTK K;  3GDZ A;  2JA7 A;  4C3H K;  3AQO A;  3GIR A;  3GTG C;  1TWG A;  4KAS A;  4C2M K;  3HOY C;  4PAA A;  5HL8 A;  1IS1 A;  4XSX A;  4GTE A;  3S1Q C;  2YU9 K;  1O27 A;  3LPX A;  2ZUF A;  3QX3 A;  4A3I C;  5C44 C;  4A3C K;  3H0G K;  1RU0 A;  2NVQ C;  3H3V D;  1F9N A;  1WIH A;  3LAJ A;  3S15 C;  4KM9 A;  1JQW A;  3HOV K;  5C4X K;  1I50 A;  4BLB A;  1K83 K;  2CFA B;  4C3J K;  4C45 A;  1R9T A;  1SFO C;  2YU9 A;  3GSI A;  4YFN A;  1EK8 A;  4A3M C;  3HXA A;  1F7U A;  3N0C A;  3S14 C;  3GTP A;  3HOU K;  1TWC A;  2VUM A;  5JVO A;  5C3E K;  3BP3 A;  1O29 A;  1IBA A;  1ZYR A;  4GZY A;  4BY1 K;  1VGX A;  3ERE D;  2GAG C;  2JA5 C;  1DCP A;  3CQZ K;  4XLN A;  5IYB C;  4A3L C;  3NUH A;  4QJV B;  4FM9 A;  2E2I K;  3AD8 C;  1B4A A;  3K7A C;  5E68 A;  1TWC K;  3FKI C;  3RZD K;  5IYD C;  3TFH A;  5C4J K;  4A93 C;  1PJ7 A;  3CQZ C;  3GTJ K;  2E2H C;  2R92 A;  1SFO A;  2WB1 D;  3S16 C;  4NOI A;  3GTM C;  4WJ3 M;  1I50 C;  3L4K A;  4P9S A;  3FOE A;  1TWG K;  2GSN A;  1GE9 A;  5M5Y K;  2NVX C;  4Y7N K;  2D6F C;  2P8T A;  2PA8 L;  1K83 A;  3TFI A; 
#chains in the Genus database with same CATH homology
 5IYC C;  3GTM K;  3GTQ C;  1TWF K;  2PA8 D;  5IYB K;  1Y1W K;  2JA7 K;  4AYB D;  2A69 A;  2E2H K;  2NVT K;  3M4O C;  4X6A K;  4KN7 A;  2JA5 K;  3S2D C;  3HKZ D;  4MQ9 A;  1K83 C;  3RZO K;  5M5W K;  2CW0 A;  4BXX C;  5C4X C;  3S14 K;  5FLM C;  3EQL A;  1R9T C;  4BY7 C;  5IYD K;  1TWA C;  2Y0S L;  5M5X K;  4BBR K;  2R7Z K;  3PO2 K;  4QJV A;  3I4N C;  4A3K C;  4BBS K;  3HOZ K;  3K7A K;  2WB1 L;  4LK0 A;  5IP9 C;  5FJ8 K;  4A3E K;  4OIQ A;  3HOW K;  3PO3 C;  4A3I K;  4KMU A;  4Y7N C;  2E2J K;  2R92 K;  4BBS C;  2R93 K;  1SFO K;  4OIR A;  3H3V L;  4A3C K;  3S1M K;  3GTK K;  3S1Q K;  3S1R C;  2PMZ D;  4BY1 C;  4Y52 K;  4A3F K;  1Y1V C;  3GTO C;  4X6A C;  2NVT C;  4C3H K;  1WCM C;  5IYC K;  3GTG C;  1HQM A;  4C2M K;  3HOY C;  1I6V A;  4LLG A;  1TWH K;  4OIO A;  4A3F C;  2PMZ L;  2VUM K;  3S17 C;  4XSX A;  3S1Q C;  2YU9 K;  4A3G C;  1BDF A;  3HOU C;  4G7Z A;  4ZH4 A;  4A3I C;  2E2J C;  5C44 C;  4YG2 A;  3H0G K;  4A3M K;  5IP9 K;  4A3E C;  1TWH C;  4LK1 A;  2NVQ C;  3H3V D;  4C3I K;  3PO3 K;  2E2I C;  2NVQ K;  4A3K K;  1I6H C;  3WOD A;  3S15 C;  4BBR C;  5FLM K;  3PO2 C;  5IP7 K;  1TWA K;  5M3M K;  3HOV K;  5TMC A;  2A6E A;  5C4X K;  1R9T K;  2WAQ L;  3GTO K;  3RZO C;  3S2D K;  3GTJ C;  1K83 K;  4C3J K;  2B63 C;  4OIN A;  2VUM C;  1Y1W C;  3S17 K;  2WAQ D;  4G7H A;  5C4J C;  1SFO C;  5IP7 C;  5C3E C;  3HOX C;  1WCM K;  4JK1 A;  3GTL K;  4A3D K;  4YFN A;  2A68 A;  4MEY A;  3H0G C;  4A3M C;  3S14 C;  1TWG C;  3GTK C;  4Q4Z A;  2PPB A;  3HOU K;  2YU9 C;  4A3G K;  4Q5S A;  3HOY K;  1SMY A;  1I50 K;  3HOW C;  3GTG K;  4MEX A;  5C3E K;  3HOX K;  2JA8 K;  3S16 K;  3S2H K;  1IW7 A;  4YFX A;  1I3Q C;  3I4M C;  1ZYR A;  4QIW L;  4GZY A;  2B63 K;  4Y52 C;  5M3F K;  4BY1 K;  1Y1V K;  2PA8 L;  5D4D A;  2JA5 C;  2JA6 K;  4XSZ A;  3M4O K;  3CQZ K;  2BE5 A;  4QIW D;  4XLN A;  3S1N C;  5IYB C;  3S1M C;  4A3L C;  4A3B K;  4QJV B;  1I6H K;  2A6H A;  3M3Y C;  2R92 C;  2R93 C;  3I4N K;  2E2I K;  4A3D C;  2R7Z C;  3K7A C;  3M3Y K;  1TWC K;  3FKI C;  3RZD K;  5IYD C;  5C44 K;  4A3C C;  2NVY C;  2NVX K;  5C4J K;  2Y0S D;  4A3B C;  3DXJ A;  4BXX K;  4A93 C;  4AYB L;  3CQZ C;  1XPP A;  5TMF A;  3GTJ K;  4LJZ A;  2E2H C;  3S1N K;  2O5J A;  2O5I A;  3HKZ L;  4A93 K;  1I3Q K;  2WB1 D;  3HOV C;  3GTQ K;  2JA7 C;  4G7O A;  2JA8 C;  3S16 C;  2NVY K;  1TWF C;  1YNJ A;  4NOI A;  3I4M K;  3S15 K;  4XLP A;  3GTM C;  4YFK A;  3GTP K;  1I50 C;  4BY7 K;  4KN4 A;  4A3J C;  1YNN A;  3S1R K;  4A3L K;  1TWG K;  2JA6 C;  5M5Y K;  2NVX C;  4Y7N K;  1TWC C;  3FKI K;  4A3J K;  3RZD C;  3GTL C;  3HOZ C;  4OIP A;  3S2H C;  3GTP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...