1K85A

Solution structure of the fibronectin type iii domain from bacillus circulans wl-12 chitinase a1.
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
88
structure length
88
Chain Sequence
b'HMAPTAPTNLASTAQTTSSITLSWTASTDNVGVTGYDVYNGTALATTVTGTTATISGLAADTSYTFTVKAKDAAGNVSAASNAVSVKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHITINASE A1
molecule tags Hydrolase
source organism Bacillus circulans
publication title Solution Structure of the Fibronectin Type III Domain from Bacillus circulans WL-12 Chitinase A1
pubmed doi rcsb
total genus 7
structure length 88
sequence length 88
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1k85A00
1I8KB 4Q9BA 1B3JA 1N4XL 2GI7A 3V0AC 4ISVB 4UDTA 4X6EA 1RUML 3WSQL 3LQAH 1KTKE 2XRAL 2R4RL 5SX5K 1JZ8A 1C1EH 4HXAH 4WU5B 5ALCL 3NIGF 2WBJB 1AI1L 4WFEE 5EZOH 5MENE 2LV4A 2GK2A 3HUJE 4JFOB 3MV8B 4LEOA 4OI9A 3MLUL 5CEYB 3MLSH 4HUNB 4QXWA 1NBQA 1T5XA 5JORA 3CJJA 4L8DA 3AB0C 1EVTC 4LCIL 5GRZA 1XIWB 2BXZA 4BFIA 3QXDA 4XXDA 5IK3B 2Q6WB 3INUH 5ERWA 3LSOB 4FFYH 2F74B 4H26B 1CICB 2MNUA 2DD8L 3K46A 5ALBL 2X1OA 5E2VL 3W5NA 4OAWA 1KSRA 1UM5L 5I19H 1DVFD 4CVXA 4YHZH 4N8VB 3VA6A 1EHLL 12E8L 2Q3ZA 1UFUA 1REIA 4X9BA 1VADB 1I7UB 2YD5A 2DQFB 5KSUB 4LF3A 4U6HA 5C70A 2FO4B 2FYYA 3GI8L 5FAAA 3IJHA 4PJXA 1L4IA 3QXUA 3RIFK 3D18B 4C56E 3FQUA 3HE7D 4PTTB 3WXVH 1UENA 3LH2H 1UEMA 1G7LB 4V1DB 1VENA 2J2ZA 4MAYA 5KVGL 3DARA 5L0QC 4LVOC 2VAAB 3U7YL 4PJCF 1AXSB 3C87A 3ISWA 1FIGH 3Q48A 4HK3J 4GKNA 1CFQB 1IQDA 3HI1A 5I1HH 2BOCB 3HLAA 3BRDA 5GGSY 2DOCA 3EKCA 2HT3D 3SKJH 1ZANL 4KAQH 4AL8H 1CFVL 4QCIB 2CK0L 4OJFH 1KTLB 4PGCB 1A6WL 2ENYA 1RAMA 3O6FC 3QI9B 1Y18A 5HHVH 3QCTH 1MI5B 5KOMC 2A77L 3BP6B 1UYWL 4UIMB 4APQC 5I76A 3GMRB 4YBQC 4H8WH 4FQXC 4WI7A 4FXKB 4K3JL 5FV2A 2JJUA 7FABH 4ZTOL 2D3VA 1DUZB 2KL6A 4ODUA 2AXGB 3V0WL 3EO1B 1OSZB 4NJAH 3RJDA 5BV7L 4GXVH 3BZDA 4HGWA 5GZND 5T1KA 3ECBA 5EORL 3QIBD 1EDQA 4I4WB 5IQ7H 1BZ9A 5KBNC 4KHXH 4KTDH 4G80B 2R0KH 4HS6A 3MRIB 1WCBA 3HZYB 4ONHB 5EOTB 4KZEL 2RR3A 4WTZA 1YJDL 2CUIA 2OMBA 4QRUA 2FLRT 5HI5D 4LSPH 4JHAL 4M9OA 3MTRA 3IDIA 1FYHB 1SJEB 1JV5B 3DRTB 3FJTA 3WHE0 3KYOA 5TDOA 3CIQA 1FZOA 4PJAE 3BDYL 2P48B 5HI3C 1PZ5A 1VERA 2Z93A 3O9WC 5FYLE 1QEWA 4X6DA 3E6HA 3RWFB 1Q0YL 2EXYC 4XAWL 1WGOA 3BPOB 1J05B 4WIQA 2D7OA 3V2AR 3QUKB 4W68A 4XMLL 1I9RL 1T1XA 1BX2B 3W9EB 5D96C 3U2SB 4EVNB 2BVOB 1BFVH 4M62L 5JXAH 1UCTA 2C4XA 4DKFH 3SN6N 3VFNA 5KSBA 4LPYA 2I07A 2Y1VA 1TTGA 3S3SA 1I9RH 2HFEA 1LWRA 2VLJB 3B43A 4QRUB 5SWSE 4HIXH 4I9WD 1ZLVH 4Y19B 5FXCH 3RUGB 3WIIL 3CXDL 2VDMH 3GSNH 4WUUA 5HGDA 1ZS8B 3HMXA 4OCRL 4ZFOA 3BIAX 5D5MF 4OZGF 2DTMH 2Y7QA 4DAGL 3FQXB 2GY5A 4O00A 3WL9A 1FDLH 2GCYA 2JB5L 5IR1A 1RZ7L 4R6UA 3NN8B 2HT3C 4QHMA 1ZHLA 3GB7B 1A1MB 2B39A 4U0RC 3VWKA 2X4QB 3FRUB 1GGBL 4CMMB 5L6YH 5EH1A 3W11C 2BP3A 3AREC 3C5ZC 4AIZB 3LKNB 2C1OB 4R7DB 1SEQH 1U36A 4KFZC 2X5PA 1PGRB 4TUOA 1KTDB 5EORH 3VRIA 2GFBA 3QXAA 1PSKL 4UV4H 5IMMB 2Y36L 4NUGL 5CJOL 2CLVA 3RWGB 2I5YL 4FHBD 3ES6B 2FATL 4OCRH 5C09B 2ZUUA 3RA7H 1XGTB 3OKEA 5B8CA 1FYTD 3P4NB 1QEWB 4ZTOH 3WN5C 4E42A 4FN0A 4NQSA 1CLZL 4OLWH 3SGJC 3ALPA 3T4YA 2Z92A 3TNMA 3OJDB 1RZFH 2NMSA 2NZIA 4DZ8B 2VLKD 1CFNB 1S9VB 2BOBB 1BWMA 3JV4B 4PRID 5JLZA 2JK5B 1EVUA 4R7DA 2F53E 1RVFH 4WJ5A 4Q58C 3S36L 2BC4A 1KIPA 3IJSB 3QUZB 1ZHBA 3MACH 1Q0YH 2Q86A 5CEXB 2PNDA 1MVUA 2ZPKL 4ZUTA 1A8JH 5DRZB 5CD5C 1B4JH 4U6HB 4X4MA 2R1YA 3U30B 3GUTA 3FL7A 4RA0C 1K3ZA 4ETQA 4NQVB 3DNKA 3BH8A 2BNRE 5HHOE 1WAAA 1YYLL 1VHPA 4IIQA 3MYJA 2NY2C 5ESQB 2OX5A 1AHWA 5CGYC 3I9GH 3BN9C 1T2JA 4Q6IC 4DW2L 3QQNA 4HHAA 1RZKL 5HVHB 2W9EH 4PS4H 1SM3H 5DVKA 3GKZA 4LNVA 4D0BB 3NA4A 3CDGA 4LCUA 1FGVH 1LMKA 5JNYA 3I50H 1J1XH 4GXVL 3KHOA 4AIOA 4AJ0A 1FFPB 5IMKB 1AY1H 1CGYA 4HJJH 5B4MC 5GS1B 1HI6A 1M7IA 3B3IB 4P3DB 2DIAA 2VABA 1Q1JL 5I19L 4ZUSA 3DMMD 3CLEH 4QGYA 1I1FA 1L0YA 4ZSOB 1FFOB 5DA4A 2NY6C 3CSYB 3VRLF 3OXRA 1QBAA 4J3UA 1RZGA 2R0KL 3I6LE 3VMOA 3ZKMC 4U6XB 3TO4A 2NXYB 2FSEB 4QHLA 1U95B 1KGCD 1V7MH 1FO0B 1N8ZA 3O8XB 2PUQT 3ELAT 5CJXC 1ZGLA 2IANE 3WNLA 3DRQA 2R15A 4L29A 5BV7H 1JZ5A 3T65A 4R97C 5F1NB 1NJ9A 1D5ZA 3IU3A 3H9YA 4GRLA 1QSEB 4PTUA 3DVGB 3MRRB 1MHPH 3GRWH 3MX0A 3PWPB 1NLDL 4OZHB 4NPYA 1FNEA 4HG4K 3L6FA 1OAZH 1ZVSA 1AC0A 4N8CL 3SKNB 3TJEH 4PRHE 5ADPH 3PABB 3GI8H 1UYWH 3QQ9C 3C6SA 5K9KB 5DMGC 1RIHL 5T1MA 4X5LA 2JCCE 4GW1B 2NX5E 1ROWA 2ZUYA 4Q74A 3O6KL 5SWZB 2R4SL 3DWTA 3NCBB 2A6IB 2E9JA 3HB3D 1NBYA 2F15A 4AL8L 3KPNB 4IBLT 1KELL 4XRCB 3EOTL 5SWSB 3O8XD 2CDGB 1ORSB 1Y6MR 4GMSL 3RBGA 2E7CA 4YH6A 3T2NL 5ALBH 4MHHG 2W38A 1ORSA 1EO5A 5FF6A 3RRQA 4OI8A 4FZEL 2WK2A 4AEIL 5D9SB 4UT6L 5HI4C 1JTPA 5E5RB 4ZAKC 2YRLA 1U91A 5DJAB 4LP4A 3MRNB 5D7KE 1JPTH 3HI6H 2CLZB 5GIRA 2AEQL 5HGBA 3G6JB 2EYTA 1PX3A 3MV7E 4YDVA 4GFTB 1F3RB 4PJIE 3IFLH 1NDMB 3DVNA 4QRPD 1HHGB 2MPAL 2C3VA 5J13C 5CP7B 1IBGH 3WFDH 3L3KB 4EI5B 3BKJL 2I9TB 2VZ3A 4JLRB 1QRNE 2EE3A 4YDIL 4EN3B 3MLRH 4JPWL 4JLRA 4XPFL 1BF8A 3VWJB 3P0GB 2QHRL 3FFCB 1QSEA 3P4OB 3IGAB 4LQFL 3A6BL 4F8QA 1CLOL 4NZRH 4WFGE 5FGBA 1M7XA 4GOSA 4OCSH 4OZFB 1IC7H 1G7QB 4RGOH 4X7TB 4S1DC 1QBMH 1Q72H 3P0YL 2B2XL 3LEYH 4F7TB 3G5XA 4XWGH 3IKCA 1Z0NA 4ODHH 2VXTH 3BT2H 5C0AB 1ADQL 4OGZA 5D2LF 1RIUH 2NXZB 4ONOA 4KKCD 1I1YA 5E2WL 1T21A 1F6AB 3NMEA 5IVZA 4HUVB 3HKFA 4WNQB 1LP9F 1OHQA 5EZIH 1WBZB 4U1IA 4U3XA 2C3WA 1VEOA 1Q9KA 3M1BB 3RVTD 2Y4SA 3UJTL 1IC7L 4RGOL 1WTGT 1OAKH 4UV7H 4EVNA 3IDGA 5F7DB 2VITB 1HQ4A 3FB6A 2DL9A 3LKRB 3VW3H 5IBLC 4KZDL 1LK3L 1Q8MA 1ZT7B 2N1KA 4OD3H 4FXGA 4HUUB 2IALB 2BVUA 3B9EA 4X7TA 4G7VL 3RWGA 1XF4B 5HYQA 2CK2A 2DJUA 2YPLB 4G8IA 4NZTL 2NX5A 3OG4B 3QPXH 2BHUA 2H2PC 3EOAB 3HNTH 2AEQH 2NY5L 3BH8B 2D9CA 4EI6B 2D7TH 3CFEB 3KWWA 5IBTL 4Z5RB 4J4PC 4Y8DC 4N90E 2DLIA 5E4IA 3ZKND 4JZJB 3QNZA 4IRSA 5SWQB 5IWLA 1KEGL 4WO4B 2Z35A 2P8MA 4EQ3A 4P9ML 1DQQB 4XCNB 3WD5L 1I1AA 1JI1A 5C3LD 3FN3A 1EV2E 4I2XA 3G9AB 3HPLA 3LIZH 4YIQB 1TVHA 1I7TB 3GSWB 1R0AL 4XP4L 4YC2C 3VGEA 1ZSDA 5A16B 3FZUD 1INDL 1W0WB 4JO4L 4HT1L 3MCKB 4R0LA 1FNSL 4YHPA 1A7QL 2XY2A 1PBYA 1B0RA 4M6NH 2ADFH 1B0RB 3H9SD 4O02H 1G9NC 1KCSH 4HKBB 2XPGB 1OGTB 9CGTA 5MI0C 1MPAL 2AEPH 1D5BB 1TZGH 2FHCA 5DJ0B 4LDOB 1HZHL 3A67L 2FX7H 4EDXB 1J86A 2OMNA 1A6AA 4QOKD 3BO8A 3MACL 2G5RA 3EOBA 4KI5E 4WI9A 3G5ZB 4JQIH 4Y19D 5I1LA 4XP9L 2EDDA 5EWIH 3S7GA 4UTBH 1AC6A 5AAMA 4JFYB 5GS3A 4JB9L 3LN5B 3F7YA 1RZJH 4YXHH 2OJZH 1FG2A 3C08H 5E8OA 4JPVH 4LSVL 1NCNA 4OTXL 5IQ9B 3VA2C 2F58L 4R4BA 1FQ9C 4R2GC 2D03H 3LKQB 5I75B 4LLMB 4R9HA 3Q6GL 1MCSA 1NMBL 3QZWG 1J0IA 2SEBA 4FOMA 4YE4L 4WFED 5MEND 4PJ7E 3RKDC 4DGIL 1F13A 4WO4D 4PS4L 1XF5A 1EBAA 4IRJB 4D8PA 1YEDA 4PYGA 1G9ML 1RUPL 4N1EA 3HZKB 4ACPA 4ZYKB 3DURA 5CSGA 2CLZA 5GIRB 4BSVA 1KENH 2GJZB 3EAKA 5C0CA 1H9VA 1MFAL 1T89A 5DJAA 3NIFE 1IAIH 5FHBL 5FYKL 1M05B 3ARDD 4AT6B 3TA3C 4ENEC 3LPGA 5LQBH 4NBYB 4RFNB 4F7PB 4PJEF 2RGSA 3K7UA 2ZUTA 2KKQA 4FQXA 4HS6B 1XGPA 4KH2A 5LGJA 1QQDB 1S9YA 2ATPB 4G7YL 5I18H 1S78C 3IDXH 5E8NA 3AB0B 2WINA 1IGTB 1NSNH 3LN9A 3S4SG 3LS4L 5IBUG 2DWEA 3MNVB 3HS0A 2LVCA 5D96B 4FXLA 4R96A 2ICWJ 5DT1L 3RNQB 3VXOB 1KACB 2H6PA 2X9YA 1HQRB 5AYUL 1CICC 4PYHA 4I2XE 4MZ2A 2HRLA 3E3QE 5DQJB 4FMFA 4YGVA 1YY9D 4KDTC 1XH3A 5C08A 4Y19A 5MENB 1K6QL 3FQNA 3QFDB 5F88B 2G5BA 4AENA 5T1MB 3SKOA 2WLZA 1W72B 1F97A 1RU9H 1SJXA 3ZDYE 1I9JH 3QJFA 3QULA 3BGFC 1RK1B 1QFWL 3L95A 5LGHL 3RBSA 4POYA 5JHDD 3VXUD 3QEGH 4IOIA 3MV9B 4RMQA 1KIRA 1HSAB 3MCLL 3RU8L 5ID1A 5J9PB 3AREB 1A6UH 5GHWH 5FDWA 2CMRH 4ERSH 2AKRB 3TIDB 1QFOA 3SCMC 1CDYA 4LVNC 4R26L 4X0KB 1U8PA 1MJUL 3S97C 4KK9D 2Q7YA 3KJ6H 2CRMA 3GHEL 4LHJB 1CF8H 1WIUA 4MNHA 5I8KH 1K4CA 2NY3C 2CKBB 5K9QG 4JZOB 4XC3L 3V0WH 1XR8B 2CLRB 3WL9B 2C1OA 4JN1H 1FORH 3CXDH 4YQXH 2FGWL 4HWBH 2Y23A 1S7UB 5GRJH 4FQ1H 1VEPA 3D0LA 1IFHH 3R4DA 4WO4A 5HYSB 5B39G 5E6YA 2QQLL 1W2KT 1YNKL 4KK8C 1T04B 2X4PA 3PP4H 1UVQB 4M62H 2XICA 3ULVF 4MVBC 1OAYH 4MD0A 5DEZA 5EIIB 5L9DH 3HRZB 32C2B 2V2WB 1AJ7L 3T4AB 5F1OB 4F9PC 1AE6L 4P99A 2X4NB 3OAUL 4CDGC 1LO4L 4KK5C 4PJAB 4XAWH 4TRPL 2HRPH 5IHLB 3I6GA 3VFPB 4WEBL 4AYFA 4POZC 3GGWA 4NZDA 3EDEA 2D0FA 3F8UB 3WHXA 2YXMA 4G8GB 3V6FB 2GJ6D 1QACA 3DSNA 2H41A 2AABL 2DAVA 4FFVC 3CSBA 1YECL 2WIIB 2V5SA 4JRXA 2XWBA 1MOEA 4XTRD 3O6FA 1U2CA 3QQ3A 4QOKA 1GSMA 3CU7A 5D70H 1I8IA 4M6MH 4OLVL 4KRPC 4BK5A 1TJGL 2VZSA 2YUZA 4PG2C 3GIZL 1TQBB 3FFCD 4AG4L 2KZWA 1G9EA 4NCDA 4ISVA 3LKSA 4YFEA 4YQXL 3P9LB 3QXTA 3OBAA 1LHZA 1FO0H 4G8GA 3BKYL 4M7JH 4G8FB 3N1PC 2MKLC 2VLJE 3ULSB 3T77A 3I6KB 1QNZL 4K3GA 4X9IA 3O2DL 1XF3B 2GQHA 1E4KA 5EO9A 4PJDB 3W81A 3B9KD 4YBLB 3OGCB 4YFLF 4XAKE 4M5ZL 5GGTL 2GJ6B 2XZZA 1CXHA 3HRZA 4YWGL 3C8DA 3TZVB 4XWGL 2JB6B 4M03A 3DRQB 3DX8A 3F5WA 3V5DB 4KPHL 5DFVD 2HVJB 5D93C 2E7LA 2F74A 1AD0A 1YC7A 3OKNA 3W0WA 3DLQR 5CJXA 5F9OH 5CZVL 3EYFA 3OWEA 4B41A 5I1HL 3DGCR 2EDLA 1AIFB 4HXAL 4HGKC 1XF5B 3RVXD 3U7YH 1D7FA 3MLXH 1OM3H 2YD3A 3DX7A 1KXVC 4NKQB 3ULUC 4GRWE 4Y5VA 2FEEL 1KTLA 4YDIH 3CSYA 4G6FB 5HXMA 5CBAA 1EXUA 3MJ6A 2GJJA 3B2VH 3EO9L 2YBRA 3BD4A 4MJ6B 5AYUH 1AO7B 3T0EA 4PJAF 2M2DA 4GKSB 5JPMA 4OF3A 2IAND 4LMQE 1B0WA 4OCYL 1OT1A 2CRIA 3WFBH 1TQCB 4JFQB 5EUOB 1CBVL 4HCRH 5AEAA 3BSZL 1Y6NR 2VLJA 3BZEB 1P4BL 1ZLWH 4JANB 2IG2L 3OG6B 5DRNA 4EXKA 2FR4A 4ORZC 3I2CL 2ID5A 4KMTH 3ULUE 2XA8H 4PJXF 3VFMA 1XZ0B 2DKSA 3O4LD 3FMGL 3CDYA 3L3DA 4FQJH 3ILPA 1JMZA 3U7WL 5D7IA 3AXLA 3KPSE 3SE3A 1FH5L 2A83B 2OL3L 4JM2D 1IARB 2GUOA 1FAKT 1N59B 4GG8A 1K8IB 4WWKC 5EU7C 4YPGB 2BVPA 4ODHL 1HHKB 3ZDZF 1MI5A 1QR1A 4P2RD 5EU4A 4BA8A 4ZXBC 4M5YH 1FRGL 4WRLA 5EBMA 1EEQA 4GRWH 4N0CC 3DECA 4WEMB 2BNRA 5HHOA 2N56A 4ONFL 5HYSA 4Y5VC 5FGCB 2VQ1A 5EZOL 5I8CB 3MRNA 1I7RB 2D03L 3HNSL 4O51B 1RMFL 1S8DB 4M1GL 4DVBA 1F90L 4K7FB 5ESVB 1UWGH 3NAAL 4TPRL 4HEME 4JY4B 2EDFA 5DZOA 4LU5L 5B3JF 2J7LA 1YEGH 4FQ2L 3TZVD 4RQQB 1K4CB 4JKMA 3LMJH 2APXA 1OP3K 2BNQD 4LLWB 3IFLL 4JN2B 1HH9B 3EO0B 4EQ2A 4LRIC 4OV5A 2UVEA 2CO7B 5D1ZA 1J5OL 1T1YB 3MUHL 1U92B 3MQIA 3RVXC 4Y4FA 3KPPA 4ZD3L 1CDGA 1BGXH 3QPQD 2MCPL 2H45A 4WGVB 5BW7A 3TM6A 1FVEA 1S5HB 1UZ8A 3RUGF 4XZUA 2BNRB 5HHOB 1JYNA 5EUOF 1K8DB 1N3NA 1I7UA 2RQ8A 5CCKH 3A67H 4WTWA 3TBTA 3S98A 3UJJH 2XYCA 3DRTA 4EDWH 2EE2A 1KELH 1MF2L 2VLKE 4PLOB 4H20L 4BZ1H 2BSTB 1YEJL 5FKPB 3WXWH 6FABH 5JIHA 3NCJH 5HDQH 4MQ7A 2ZUSA 1CG9A 3Q3GA 1TPXB 1DJSA 3ILPB 4LVHB 3KDMB 4LRNL 1XF2B 3GSUB 4RWYH 5JQ6L 1YZZA 3PDDA 4UDUA 3I50L 3H3KA 3TO4C 2FEDD 1KT2A 2YS4A 1T03L 3TJEL 5BS0B 5F7EL 2IAMB 1RZKH 1OAZL 4FQPA 3LRHA 2BVYA 3GSQA 1T6VN 1BQLL 1B0GB 3MBXL 3VFWB 4PJHE 2R0ZH 4Z18A 4LQ1A 1QKZL 1JK8B 4GRLC 1I9IH 4HS8L 3GMNA 4RAUA 3MOQA 1G0DA 3GMMB 1QBLH 5L88H 1JGVL 2DMBA 3SDAC 1DP0A 1U3HC 4KRPD 4PB0H 1DLFH 1I8IB 4ZUSB 1LO2H 1AXTH 1QFUH 4BQ6A 3WS3B 5I2IB 1PY4A 5BW7C 2OTWA 5ERWB 4FFVD 2DQIL 1BD2D 1CE6B 4O5LL 1CE6A 4N8VA 2H9GA 1U93B 4L9LC 2X05A 2HG5A 2OYPA 1RIVH 1AGEA 3VJ6B 2X89D 2VDQH 3K2UH 3ZHDA 1LEIB 1QSVA 4U1MB 2R23B 1OW0C 1RZFL 2A1WH 2OS7A 2WQ8A 1OGAD 4YXLL 2FJGB 3G5YA 1F90H 3OKOA 1J8HA 2VISB 3TF7C 1P5VA 4XI5D 3F58H 4V1DA 4ZTPL 5BVPH 3VXUB 1CI5A 2YPKA 5ID0A 1QA9B 4PTTA 4KJYB 5EUKA 5GS0H 3BIBX 4YZFF 4DK3A 1D5XA 4M5YL 4O2FB 3QDJA 5DA0B 1DBJL 5HDBF 1N64H 2XZAL 4IMKA 1IAII 3NIGE 3PHQB 5I30H 3KNBB 2EKJA 2OR9L 3LRSB 1RZGB 5DS8B 3QQ4B 2ZG1A 2IMNA 3U7WH 2DQUH 4OKVB 3BAEH 1M7DA 4WWKB 1ORQA 6FABL 1T3FB 1H15A 1QBML 4TNWK 4JKKA 1FL3A 1C7TA 3IKKA 5TF0A 1EFXD 4PR5A 4Q6YA 4F3FB 4QXGH 1BFSA 3LN4B 2CR3A 5CD3B 1DUYB 1YEEL 4TNVK 3UTSD 3NGBC 4BFIB 4LHQB 3S96A 1GHFH 1KCRL 3MRLA 4NQCA 2QQNL 1TJIL 3FQTA 2WBKA 3RDTB 1MI5E 1RD6A 3MV9E 4LAQH 1D6VL 4JANA 5JIPA 2VZTA 4G6KH 3MJGX 1NQBA 3OF6D 1DQML 4PGEA 3KPSA 4FRWA 1IGJB 5I8OL 4P5KB 2KH2B 5J8OA 1FBIL 1CGTA 1EEUA 1S7SB 4GAFB 4Q97A 1GCFA 3S4SB 1YN7A 3RTQA 4ZOEA 5HHXL 2DWDA 3CDCA 2EIEA 5IG7B 4L3ED 3OR6B 2ARJQ 4WU7A 5EC2A 3QXWA 3EUUA 4M8VA 3O3EA 3WLWC 3KPMA 5F6IB 1ZHKA 1MFDH 4RZCB 2R1XB 1V3KA 3ARBD 4UT7H 4NQED 5T3XE 5AD0B 2DKMA 1AD0B 1J0YA 2X4UB 3MZGB 2WZPD 5I71C 3IDNB 3TJHD 4BSWB 4LLQA 4LVHC 4ODUB 3BRGC 2AVGA 1U6AH 1YMME 3HPJA 4YC2B 3RJQB 4C56B 5KSVB 3DV4A 3DV6A 4W6YB 1HDMB 1I3UA 3CZJA 4ZPTB 4IRSC 5IWLC 1G9NL 2VLRD 2P49B 3QUKA 4AMKL 2DDQH 1C08A 3K8KA 1D3CA 1SJHB 4Y16B 4GRLB 4KKLD 3MOBH 2A6JA 3FO9A 4XT1C 5MI0B 4XNQB 5FGCE 1GGCH 3E6FA 3GIZH 4LSQL 3VMPA 1LEGB 3IDIB 3GMNB 4RAUB 1UJ3A 1OP5H 4YHYB 4PUBH 4P5MA 1CU4L 5D7KD 5JHDA 4AENB 1JF5A 1A7RH 4ETQB 4PJBB 4LVNB 4PLNC 3H7BB 2DKUA 2EEBA 5MENA 3VWKB 3LHPH 1JGEB 4UDTB 5KSAD 1QTYT 2AV1A 1NGQL 2AJ3A 1G6RB 2JELL 1X6NA 2VERN 3O6ML 3CLEL 4NRYB 5C07D 2VZ1A 5D7SH 5E6ZA 1KT2B 5E2TL 2G75B 4HIIA 5T3ZE 1LE5B 5D71H 5C0BE 4ZMAT 4PRPB 4PJGE 3OL2A 3B9KB 2IH1B 5JW3H 1IM9B 1FFPA 2FJGA 4PJ8C 3KLAA 3ZZ1A 2C1PB 1X5XA 5CSBA 3MRDB 3UYPA 2O5ZH 3T3ME 2QSCH 4UQ3B 4MD0B 3K8LA 3ZDXE 2DIBA 4WV1A 1MHCB 1ZEAH 3HTLX 1I1RA 4WW1B 3HUJB 4N0RA 4GUPA 5IJVB 2VAJA 3GSOB 2J88L 2ITCA 4LIQL 3U1SL 2XKUA 4UB0L 5ESQA 5IROC 5KANG 3N1MC 1EX0A 2J1KA 1GRWA 2PXYD 3OZ9L 5FO7B 5HHQA 5TH2B 4K3DL 3BVNA 2AJUH 5GS0D 2O5YL 2F5BH 1JPST 4M3KB 2VSCA 2HJKB 1KYOJ 4P5TD 1KEML 5L2KB 1T6WA 1H3TA 1SBBA 2GITA 3P9MA 5C0GA 3G5XB 3VXTB 5E03A 1XCQB 1SBSH 1ZMYA 3UTTB 3DX6B 3RU8H 2Y7QB 3KVQA 1KB5B 4Q6IB 3Q6FA 3FQUB 2IFFL 1D5IL 1N64L 5C1MB 3WHXB 1T83A 4KGJA 5C0AD 4BUGA 2EDNA 1UZ6F 4DZ8A 4LSQH 2A0LC 3V8CA 3K1KC 1SMOA 2V6HA 1YYMH 2LAAA 1CS6A 2P4AB 2H2PD 1T0NB 1WF5A 3O2VH 3E2HC 3TP4A 5FECA 1TPXC 3D2UB 4CU8A 4J7RA 4RMWA 1PSKH 4UV4L 2DBLH 3EYUH 5I1DA 1Q9LB 3BP6A 2XIDA 3NOIA 5DK2B 5JHDE 1XIWC 3CFCH 3C09B 4P5TA 4NRXB 2ARWA 5FA3B 3QRGH 3IF1B 1DTUA 2FGWH 3IYLW 4NKOB 5DO2C 1MCEA 2NYYD 3D9AH 1DVFA 1EH9A 2JB5H 4G5ZL 3REWA 5C09E 4LCCB 5E2VH 1H3PH 3FO2B 3ETBF 1XGRA 5CEZD 3UO1H 4G9FD 2VDML 3GSNL 4OCLC 4FMKA 3MV8E 4GW1A 2XN9B 1QVOB 3C9NB 4NQDE 4CUCA 3E2HB 5F7HA 3MOAL 5ELIA 2D0HA 1S7TA 4I2XB 5ADOH 4B53A 3MA7B 5LGKA 1C08B 4HSQA 1VFUA 2DQTL 1DBAL 1NANI 1Q9LA 3RQ3A 2NXYC 1FE8L 2GYSA 3VXSA 4OCXH 2BFVH 3REVA 4Y7MA 2OZ4L 3JTTA 1GIGL 2QADD 2OTPA 3UJIH 3QG7H 2NY3B 2OSLA 1IGIH 5FCUL 4MA3B 4IDJL 2PW2A 4I48B 2EZ0D 3U4EB 3F58L 4OZHA 3ARWA 1AKJD 2WNGA 1JFQH 4YHNA 5IUSA 1CGVA 4LLQB 3FQNB 4IRSD 3GMQA 7CGTA 1AR2A 1DBKL 4MXWH 1DQDH 1QSED 3FFDA 4HWUA 1U95A 1YMHA 5F3HB 1P6AB 1E6JL 5I0ZA 5GRVK 1VPOL 3GZKA 3MNWA 4DK6A 4JFZL 3UPCA 1IGTA 2ZUQB 4ZAKD 3W9DA 2WUBH 3HE6D 5JXEA 2IADA 3V52H 1DN2A 3CNKA 3I02A 3LZFH 4M48H 1XFPA 1GOGA 4X9GA 5FF6B 2X4OB 3GBML 2ADJA 1AXTL 3ARDA 4GKZA 3TH3T 4ODSL 1UJ3C 4J3VA 5AZ2H 1WTLA 1H5BA 4PBVC 2JIXB 5C0EB 3ALWA 2W60B 2Z91A 1JHTA 3U9PH 3DXAA 1AFVL 5F7YC 4NQSB 3MV11 3STZA 3ZE1F 3L3IA 3LQMA 3L7FB 3IRPX 1PYWA 1HEZA 4WW1A 5HDBE 4JGUA 3WN5A 1AO7D 3GBNH 5D5MB 4ZUWB 1MFBH 2DYPD 2RIKA 4HC1H 4YPJA 2UYLA 2VDLL 1IEBB 5E2UH 2EZ0C 2DIJA 1D9KA 1FFNA 2DQHL 1SJVA 4OD1H 2A77H 1QFPA 4HH9B 3ZT5A 4P2RA 1KB5H 5GGRA 3GBNL 2X70A 5DMIL 5GGRB 5C0RH 1F11A 4GBXC 3CXHK 4PRPA 3V7MA 4LARH 2P47B 4WTXA 2XTJE 2X4TA 4ZS7H 1RY7B 2R0WH 1MCJA 5CLWA 2QSQA 5IMOB 3WD5H 4LIQE 1XF4A 2HMID 1SY6H 5F72S 5DRWA 5MERA 1NDGB 3DVNB 5IVNA 2Y25A 4N9GA 4P23C 2UZIL 1JGVH 4UTBL 1NUNB 4TSBL 3K0WA 4LPTA 1KLUA 5EWIL 3EO0A 5F7DA 2W91A 2NY6D 5JLZB 1FNGA 1BQLH 2ERJC 5DJZA 1L7IH 2AERT 1KB5L 3VD4A 5EBWB 3GSXA 3JWOH 4FQCH 3DMMC 5IW6A 3MRBA 3WNOA 4NQDA 3KPRE 3FT4B 1OP3H 3HMWH 1LEGA 1PQZB 3GMOB 3LB6C 1YNTB 4JZNA 5E00B 5C09A 1UG9A 3GK8L 5EZJA 2VL4A 2AQ3A 1OQXA 2IC2A 3FTGA 3Q5TA 4NN7B 1PYWB 4EUPG 2YPLE 1FNSH 4UOW0 3EOYG 3PNWB 1K4DB 5FB8B 4LSRL 1S9WA 3RWCA 1QHPA 3KPLA 4WDIA 4MJ5A 1BQSA 4Y5YC 5DURD 1PZUB 3QDGB 4XHQA 3THML 5GGTH 1QHOA 1KTDA 2X4RB 5KW9H 3O6LL 4RDQF 3VFGH 4C56D 3WBDA 1GAFL 4R4BB 1X5HA 1P1ZB 4V1DD 2ITDA 1U3HD 2XNAB 4WVRA 2BSRB 5I1JL 3KR3L 4WUUB 2P5WE 2ZSWB 1CLOH 3RWJA 4GRLD 1NC4D 4HW6A 5LG1A 3GSRB 5FDYA 3HR6A 4MAUH 1JNLL 2AGJL 5I1LB 3MUJA 3HRPA 4Z5RA 4P59H 3HNSH 4HJ0D 1C7SA 3QRGL 3WSQH 4UNUA 5TE6L 1BVKB 4J3TA 3QEUB 5IF0A 3TO4D 2JE8A 4YHNB 5CP3H 4NO0D 4HWEL 1UM4L 4KI5D 5CKGA 4OD1L 5DMJB 5FUZL 5LXGH 2DBLL 1JE6A 3S35X 4OCXL 3AGVA 4Z7UF 3MXWL 3B2VL 1J10A 3S5LA 3UMTA 1TJHH 1QSFE 2XA3A 1OGTA 5DJ8B 1QUNA 2QJDA 8FABA 4OLZL 4I0PA 4QNPF 2A74A 4JREC 4JO2H 1BD2B 4TSCH 4Y5YA 3VFSB 3VFRB 3FO0H 1ZLUK 1FZMA 4H1LB 3PHOA 2BOCA 4KPHH 2J5LB 5DJYB 5DC4B 5DVMA 2EDWA 4OKVA 1JV5A 2R56L 3D0VB 4XXCC 43CAB 4K3HA 4NQEA 3U6RA 5T1DL 5L9DL 1FG2B 2NXZC 3ZDZE 4JRYE 5KSAC 4ODXB 3TPUB 3IXTA 4CN6A 4RMRA 4JFPA 1NGXB 1WBXA 4XNMB 3TO4B 3MJ9L 3EO9H 1NKOA 1F45A 3VWKD 3ZDYF 3Q2CA 1NEZB 1MHPL 3GRWL 4H5SB 3BO8B 1P69B 2VIRA 4KJWC 1MWAB 2P8PA 5E99H 5J1AA 4Z7VE 3DVGA 1QRKA 3MRRA 4X98A 3D69A 2ZCKL 4P4KB 2MCG1 5JW4M 5HGHA 2P1YA 4GKOA 4WWKD 3UJIL 3JV6B 4BQ9A 3KPSB 2BFVL 1HXYB 4I0PC 4GRMA 1A4JB 3E0GA 1MFCL 1JPGB 1R5IB 3HI5L 4OLEA 4N5UA 4DJMA 3TYGH 3LY6A 5FUOL 3BH9A 1SEBA 4S11A 3O3UN 2PTTA 4OZGA 4URTB 2W0LA 3VDCA 1K2DB 3WIHH 1D6EA 1JMXA 2YR3A 3OJMB 4X5XA 5E94B 3MLZL 4Y4FD 5LCVL 4M7JL 2DQGH 1TETH 3ARBC 1GC1H 5FYJE 1XGQA 4CADA 1JNNH 1NFDE 3WDHA 2VR4A 3RWEB 3C5JB 2WV3A 4AEFA 1AO7E 3E8UH 3QIBC 2OK0H 4JHBA 1WEJL 1MHHA 1KPUA 5D7LA 4PUBL 2C26A 3VDAA 4G6ML 4LKXA 4LSUH 4I0CC 3STLB 1LDPH 4MCZA 4MNQB 4E5XA 1II4E 3GI9L 1WV7T 5D1QD 1YPZF 2BXYA 5MEPB 1SYSB 5KN5B 5GZOC 2BZDA 1KIQA 3C5SA 2EIZA 4NN7C 3B8SA 3SDYH 1I4FA 3JUYA 3T04D 1T80A 1RJZB 2Y6SC 1MCOH 2GK0B 4XPGL 3O4LA 1KJMB 3B9KC 3DHJA 4G6FD 3VFTA 3DO3A 3OPZH 3F6IA 3UROR 3TYGL 1T2QH 4L4TD 3LKSB 1FVCA 3D85B 3L3IB 1ZAGA 3GJEB 3K1DA 4XPTH 4NP4H 4I13B 5JOEA 2WBJA 3CK0L 5TDNB 1UB6B 3QZWB 4HUXA 5FGBC 4JQVA 4MDJA 3S5LG 1OP5K 1KJ3L 1S7RA 1TVBB 1WQVT 2VDKL 1NMAH 3B83A 3FT3A 5CEZL 1NCBL 2F5AL 1AGBA 5I75C 1RZJC 5JOFA 1NCWL 5ACMA 5ICYB 1Q94B 4ZS6C 4E42B 4KQ3L 4GXUN 1OL0A 5E95B 5BRZA 4FABL 4AQOA 1NGZA 5INCB 1FGVL 5DYOB 3KR3H 4XX1G 3WLBB 1U58B 1S9XA 5DRWB 4N0FB 5EU5A 5C0IA 3LS4H 4PJ9B 3S3PA 1KPVA 3HC4L 4MJIA 1KIUA 1NEZG 1FN4B 1WISA 5L6YL 1DVFC 3CC5B 3V4PH 4XCYB 3L1OL 4QTHB 4P2QA 5I16A 1QLEL 4A6YA 1VFOA 4EJ1C 1JTOA 4UT7L 5ENWA 5K9OA 2FX7L 2UWEA 3MA9H 1HCFX 4DAGH 4YDLC 3FO0L 3H2WA 4CVUA 1CD1B 2A73B 3EBAA 5FGRA 2X7LB 3HFMH 4ZS6D 3GHBL 4R3SB 1WZKA 1U8IB 4GRWF 1G7MA 4JG1H 4LPWA 1NFDF 5IB4B 4DGIH 1LD9B 4PB9L 3FQRB 4IJ3B 5IB4A 4TVPL 3DMMB 5JXAL 1CFQA 3HI1B 4NNYB 2XQYG 2FEDC 3TCLA 2V9QA 3FB8B 5B3NA 3OJVC 3UYOD 1EXUB 1MJ7L 2B4CH 4UUJA 5J1TC 1YEIL 5IMKA 2NLJA 1KG0B 4LSDA 4U6VH 3D18A 4PJHA 1VACB 4JB9H 1X5GA 4NUGH 3OAZH 5DK2A 1LO3L 4PJ8A 4MWFA 1QR1B 3L3HB 2JF1A 2GJ6A 2PO6B 4AQ1B 1MFAH 2VLLA 3SE3C 2R2HB 2A6DB 4OLXL 1H3UA 3O6LH 5C0IB 1E4WL 3DO7B 3LV3B 4Z0XB 2VIRB 3VFOA 1QP1A 3BE1H 1A7BA 1FN4A 1A2YA 4OF5A 4OFIA 1PW3A 3QCVH 5D7JB 5EO1B 4QHLB 5EOCH 3MZTA 3ULSA 3R0MA 1P4IH 4ODBD 3TPUA 1LEKA 1SQ2N 3FO1A 3LKOB 2IGFH 2XN9A 2NY2B 4P2QE 4XNUH 1M4KA 4GKSA 5JPMB 3SJVD 3B6SA 1H3GA 1C16B 4JFED 4N0UE 3SDCA 4HK3N 3QEQE 4YO0A 2C7UB 2EICA 4JHWL 2FIRT 3P9WB 1NGPH 2ADIB 2EDKA 1L7IL 1I75A 2IADB 5IHZA 4ZXBD 3NCMA 4PRAB 4CU7A 4XNZB 1T7VA 3LIZL 5BRZE 3OHXB 1MLCB 3P40A 1BJ1J 5C71A 1EEZB 2R9HD 1KCRH 4LLVB 3I6LD 2DQCL 1MCBA 2DLGA 4IRJD 4JJ5A 4X6FA 4JJ5B 5KJRH 2VO5A 2G2RA 2AEPL 4DCQB 3MMEB 1N59A 5D2NE 1NC2D 3FRPA 1NC4A 1JWUB 1BBDH 1S9KC 2NY4B 4L3EA 5F1SA 1RQ5A 2H8PA 3B2UD 3C5SB 1MY5A 4QTIL 1MFEH 2DQUL 2BMKA 4P9HC 1JBJA 4H5SA 4RNRB 4LLDA 4WHYH 4M93C 1WZLA 4D9RD 1IC1A 1NGPL 2XI9A 3MRJA 4YO0B 2Y07H 3PWVB 1RUQL 2L7UA 2DQHH 2NY0B 4F7MB 5BQ7A 1FZKB 2HLFD 1DQJB 1FE8H 2DQDL 3BPLB 2PYFB 3F65A 2AXGA 3SPVB 1TCRB 5ADOL 2GEEA 3K4AA 1RULL 1G6RA 3D5OF 3MRFA 3LS5H 3FB7B 2WBJC 4WWID 1T4KB 3I3EA 3SDXE 1WBYA 3MRKB 3UBXI 4TOYL 4L4TA 4FFYL 3T2OA 2NPLX 2EH7L 5TPWH 5JZ7D 3T0EE 4K9EH 4EUPB 3KLHC 4TTDD 5I8CA 2D7TL 2FLBT 3ZHLA 4KTEH 5IOPB 2PXYB 4KI1A 3CDFA 1EAPB 4L3CA 5D6DA 5IMMA 1ZT7A 1U8OB 1MLCA 3MLUH 2GK0A 1A1OB 2VLME 3QP3A 5CHNA 3QWRA 1MFNA 4JFDD 5KSVA 3VE0B 1Y0LA 2GIYA 3AMLA 4NOFA 3RVUD 3U0PB 3I2CH 3WJLA 5F9DC 1YNLH 2BY0A 4U7MA 4Y5XA 1P4BH 3BW9B 3DOSA 4PY8I 1NBVL 5DJZB 1W72A 1KNOB 4TUOB 1I9EA 3X3GH 4MSWB 1KPVB 3VGHA 5TF1L 2IJ0C 4P46B 3RNKA 3T0EC 2HVKB 3GO1H 1FL5B 1I85C 4U1JA 4J3WA 3RX8A 1I7RA 1IAKB 2L0DA 3SGJA 4DQOH 2FB4L 1JUFA 3QEHB 4ODWB 3LKPA 5IEKB 4P3WA 5L2JA 5SX5H 5DUBA 3W2DH 4XP1L 5SV4A 2P45B 4LKCB 4LLYB 4KXZH 4NDMA 4H20H 4KMLB 3WNKA 3T2NH 2D4DA 3ALXA 1YPZB 1FC1A 2DD8H 1MAJA 2RCSL 1KN2H 3PNWA 4PJFF 2DI7A 5T5FL 2PO6C 2DJSA 2CKBL 4P2QB 3BSZH 5FO9B 1ZV5A 3G5VA 4LCIH 5ID1B 2J88H 4JPIA 1CE1H 4KK5D 3G5VB 2Q3AA 1J5OH 4PR5B 4ZOBA 4F3FA 5C6WH 5EZLB 1VGKB 2CUHA 4N8CH 2ICWB 3FB5B 4MLIA 3TZVA 4N1CA 1CVSC 2CIKA 2IH3B 5IVXE 1WCBB 5EOTA 4YX2H 4NFDA 2P5WD 3UTSB 4YDJB 1QSFD 1ND0A 4M3JA 1C5CH 1YNLL 4DUXA 2B1AL 4PJ5D 1RJLB 1HILB 4MA7H 3P30L 4Z6AT 2VE6B 3QDGD 1U3ZA 3ARXA 4X4XB 1N4XH 4ONFH 1MNUL 4P23D 4JPKH 2DQCH 3IFOA 1A5FL 4OLVH 2JELH 4KKCC 2EC8A 2VN4A 3CH1A 5KSUA 3BEVA 1J8HB 4HWNA 3JWNC 2I25N 2LTQC 4UMGA 2DLFL 3H8NA 3HAEB 4HV8B 1NC4B 1JWUA 2VQTA 1T20B 2PO6A 4L1DA 2VDRL 1AR1D 1CFBA 2DS4A 3I3BA 5HJ3A 1UT9A 4OIIH 2P7TA 4HK0A 1ZHNB 4RGMB 4RFNC 4OCWH 1NCDH 1UACL 4NHCH 3ULVE 3EJYC 3N9GH 3WV0A 3MJ7B 3KJ4C 1QLFA 3ESVF 4QGTA 4HJJL 4Q9QH 2FSEA 3CDGB 3GSVA 3STZB 3FB8A 4LIQH 3U1SH 4Y89A 1EERB 4WFFE 5H2BA 1E4XL 3RI5F 5GRXG 1EA9C 3R0NA 1G7JB 1HHIB 4Y1AA 5A2KH 5A43C 3KPNA 4XRCA 3F7RA 4QXTB 5D70L 2XZQL 3UTSE 5ABDE 2FBJH 5T1LA 5GGVY 1D5MA 4HIIB 1JGDB 1XCTB 5D1QA 1GZQA 5MEQB 1X4ZA 4P57B 3SE4A 1RJCA 1S7WA 4I5BB 1YDPB 3VXRD 5E6IB 1QO3B 2B4CC 3SDAB 1IGCL 1A6TB 1TETL 3EO1A 2E6JA 5D7JA 1DQJA 3QIWA 3OX8A 4WV1B 5IV2B 4RFOH 1TMCB 4TRPH 5A2JH 2J6EH 3ARDC 4NYLB 1W0VA 4DZBA 2HFGH 1PKQE 2JKXA 3BP7A 4JZOA 4KVCH 2DWDB 3QHZH 2ATPA 2HT4C 4NGHH 2EDTA 2GHWB 1EJOH 2IANA 1QSFB 2FX8H 4ZNCD 5IB3A 5KVDH 5CP7A 3RX7A 3BP4B 1PKOA 1BM3L 4POUB 4PB9H 3DVFA 2I26N 4W81A 1F2QA 4JG1L 3RKDD 1G1YA 2V5YA 4HJGA 4DW2H 5J6GB 3ULUH 4RGNB 2PW1A 5ESAB 3CFBB 5A40E 3GHBH 1PJ9A 5CEYA 2QQNH 2FZ3A 3CFJB 2W60A 5D8JL 4DUVA 3EDKA 5FKAA 4TQEH 4J12A 2DDQL 1XIWA 3F7VB 4CL7A 3OHXA 3U4AA 2YEZA 5IIEA 2LU3A 4S10A 4QF1B 4U1IB 5DJ6B 4EI5D 1BJ8A 4LSPL 4FQHA 4P2RE 4NDMB 5MP6H 4UZGA 2X1PA 1I1YB 2A6IA 2IPTL 5LAXB 1HHJA 4EXPX 2Y06L 1FNGB 4V2CB 1CTNA 1WBZA 3NZ8A 2NYYC 3S36H 4HIJB 4KHXL 4CNIB 4KWUA 1F6FB 5I30L 2ZNWA 3MREA 5E9DA 1DBJH 2FECI 3SQOL 3OAZK 4HIEA 4F7TA 3MV9A 4LNRB 5LQBL 2Y5TA 1I9JL 1S3KH 1JWMB 3P3YA 2FZ3B 2J5LC 3CFJA 4NQCE 3V5KB 3ULUF 5J7CC 3MRGA 4P3CH 3GRWA 4KKAD 3CX2A 4OUUB 4HIXL 5TQ0H 2V2WA 3T4AA 1U3JA 1MUJB 5D7IB 2EDYA 1HCVA 5HVWA 4L4VE 4YXKH 1N6UA 2VDQL 3BN9D 3K2UL 4NKDA 2HWZH 1HNFA 3PP4L 1IEBA 1WK0A 4J3XA 1I8LC 3UZEA 1BIIB 4XPHH 1K5NA 4X80L 3LVEA 4GAGH 4OLYH 5TE6H 3HE6B 4RFOL 4G7YH 1LK2A 3SE8L 3T0WA 2QHLA 3RUGA 2IAMD 4GG6F 4P4KC 3O3DB 5L2KE 1OD7A 4NHUA 2FJFA 5I1JH 1QLEH 2XFXA 4HUVA 3RGHA 1NANH 3BKCL 4WFHE 2AV7B 3O41A 5I74B 3BAEL 4MB5A 5FO7A 4DKDC 1DFBL 2PXYC 2WIIA 2IPTH 3TVMA 3SKNA 1CN4A 4P49A 4MMZC 5IQ7L 1H8SA 5MP6L 5TFSH 4TNVF 1NBZB 5DJ8A 5E0QA 4KQ3H 2ZOLA 1NMBH 1VADA 3MODL 1KCSL 3IDYB 5H94B 2XWJA 2APTA 1YNTA 4JZNB 5E00A 3TCXA 1RJYB 4R0LC 1IAIM 2X9WA 1UKSA 1HK6A 3HZYA 4ONHA 3VH8A 5ILTH 5DDHA 1NC2B 1RZKC 4JVUA 4UINL 2CQVA 4M6OL 4H26A 3D2UD 2RFXB 3CSGA 4JJHA 3WIHL 3WS6C 1R0AH 2HJLB 4Y1AE 2XV6B 3TVMB 3IVKA 3C6LA 3HI5H 1TQCC 1WC7A 4M7KL 4UAOB 1A6WH 1MCWM 1O7VA 2COQA 4M8QA 5LWYL 4L8SC 3LEVH 4G6JH 5DK0B 3RFZC 4YIQA 1G7JA 5L7XL 3C2AH 4X6DE 8CGTA 1SY6L 1F8TL 3MROA 2XWTB 3L3JB 5ITBL 3O81A 1OF2B 1X5JA 3OKDB 2XN9D 2H3NA 5KSAB 3X12A 5GGSA 1UWEL 1UEYA 3MJ9H 1U8NA 1LDPL 4PY8J 2PYEA 3LAFA 3IJYA 4UBDD 3EJJX 4H8WC 1ZVYA 3TYFA 3UBXB 1U8HB 3RHWF 2QADB 4LCUB 4PJCA 5JQ6H 1RFDL 1TQBC 3GMQB 1M71A 2B7DT 4PRPD 1S7QB 2HAZA 3G6AA 4FQIH 3P0VL 4XNYL 2IANB 5H94A 3T65B 4CMMA 1JYXA 1AXIB 2CD0A 2W07A 4PJEE 4GT7A 4MQTB 1YN6B 4YXHL 2XA8L 3MLVH 2JJTA 3W39B 3B6SB 1X4XA 4OFYD 1OF2A 1PAMA 3J7HA 3I02B 5DZNA 4CJ1A 2GTWA 1KOAA 5E6IA 1MHHB 4P5MB 5GZNC 1MWAH 1H5BB 1F4XL 3S88H 3FHAA 1KC5L 4IHOA 5I1IL 3P0YH 4M6AA 2XQBH 5MHSD 4XP5H 4D9RE 4TULH 1E6JH 3LMJL 4QF1A 3U2SA 4UU9A 3UAJD 4XPBL 3TFKD 4HUWA 3D25A 4J23A 4K8RL 4NBZB 4H88L 2VQ1B 5HY9B 2UYLB 4X8XA 4UOJA 4W4NA 5AWNH 1E27A 1EHLH 4DFIA 4NQCB 1EMTH 4YX2L 4Y16A 3PUCA 1A7QH 1JGLH 4K3EH 1CFSA 4CAGA 3ROLB 4UT9L 2EKSB 1CFSB 1U8MA 1ERNA 1VSCA 2JCCA 5HYJA 4U1KB 2Z91B 3UJTH 2IBZX 1KC5H 5KVFH 2G5BB 2DLTA 1FH5H 3FB7A 4PV9A 4C56A 4HZLB 3F62A 3GB7A 1T89C 3ZKMD 1MRDH 3BP5A 4FQQA 5GRYA 1RI8A 2C9AA 1NAMA 1X6LA 3GJFB 5EC2B 4G9FB 3T0AA 2YA1A 5GS2D 1FYTB 2WANA 2NY1B 3ARGC 2IG2H 4UIKL 3JTSA 1KIPB 5JOFB 3F12B 2HFEB 4YNYB 4OF6A 1ES0B 3MLRL 1C5DA 1EUTA 3LQAL 4LGSB 3WJLC 2X7LA 1YMMA 2BY3A 1KPRB 1WWAX 3WFDL 4ORGB 4OZGE 4TNWF 4FG6C 2APFA 1BD2A 4Y5YB 3WUWG 2F8OA 5J0BA 5FUCC 1J05A 4RWHA 4H1LA 4L4TE 1C12B 3FTGB 3VD5A 3VW3L 3PP3H 3OTTA 4XMKH 1UQSA 5HY9A 3LKRA 2UZIH 5T3ZL 3ARFC 3DETC 1OD9A 2EC9T 1RPQA 2FX9H 2I9LA 3U30C 3BGFB 3C8KB 1C8PA 1H15B 3CLFH 4E41B 3NGBB 3BDBA 1GAFH 5EZIL 2YHGA 3OAUH 1I7TA 1EGJL 5DMIH 5C0RL 2WMPA 4ORGA 1W8OA 5LJYH 2EYSB 4U7SA 3THMH 4MS8C 2R2CA 1ZGLM 1WT5A 1BFTA 3OJ2C 2L7JA 1QRNB 4JO1L 2NY0C 2E7MA 1JP5A 4BSJA 3L3OB 4LK4A 3UCRA 1F3JA 3BPLC 4MNQD 2PCPB 4W6XB 4PGDB 5F71A 4F2MA 1KCUL 4OGYH 2VXQH 1P1ZA 3TLRA 4NSKB 3JZ7A 1CGWA 4MX7A 4MNGE 1KBGL 1LEIA 1SVZA 4FG6D 4I0KA 2OTUA 1V3JA 4PJEA 5E8EA 1FSKB 2YD8A 4XP5L 1KJVA 1EFXB 4AY0A 5EZLA 1E28B 2QSCL 2R2HA 5EZJB 5TDPA 4X4YB 3AMKA 5EO0A 4GQ9L 2LTQB 4KHTL 1Q9OB 3AAZB 4HLZG 3RHWK 2B20A 4YHPB 3KYMB 1FFRA 5BZWB 4S2SA 5FCSH 4D0CA 1KLFA 5I0DA 4LPVA 2P8LA 4UINH 4P2QD 4QWWD 3BIKB 3C60C 4P23B 2OI9C 2ZG3A 4RA3A 4W6WB 2ZPKH 1V5JA 3O45A 4JFFA 3QH3B 3T2PA 4BJLA 2YZ8A 1M7DB 4WWKA 1DE4A 2R0WL 5MHSE 5IKCB 4OLYL 5SWZA 4LPXA 3SDDD 3KPOA 5CMAA 2P5WA 1ZA6A 2A9ML 3QA3A 4N90D 4R3SA 3TIEA 3CZFA 1IQWH 1TVHB 5DR5H 5BRZD 4PJXB 1OAYL 1MLBA 4JHWH 3ECBB 3WFZA 2EO9A 3VI4E 5DQDL 4QXTA 3TV3L 1Z9MA 5D6DC 3MRJB 1J0HA 2GSIB 4TTGA 2H6PB 3JWDL 4N0CD 4WFFD 3MLTB 1XCTA 1FG9C 4JR9H 1NLDH 2JLLA 5I1GL 3GSVB 4OGAC 5GSVB 5T1KD 1IGMH 3IDJB 3U6RB 2QR0B 4RFEA 3UO1L 2P44B 1P4IL 1A7PL 5DI8A 3UBXA 4X6FB 5GJTL 2VDPL 4HZAA 4JQXC 1K2DA 3DV6B 5D5MA 1D9KD 1QYGL 5M94B 3BH9B 4YDKL 4LDLB 2VLRB 3L5XL 1Y18B 3DUSA 4NRYA 1NAKL 1PG7X 3BZEA 1KN4H 4M7KH 5TDPB 5HI5C 2YSSA 3N0PB 4FZ8H 3IDNA 5DD1L 3VI3F 3TESA 5DJCA 4PLJC 3QUYB 3UPAA 5HGHB 5C7XL 2R1XA 5HHMD 5T3XH 2F54B 4LEXH 4P4KA 5I66B 5E6ID 3HPJB 4F58H 4YXKL 3M45A 3FONA 3HA0A 5FYKU 1HSBA 4KU1A 4HCRA 5IHUL 5F9JA 3CMGA 4X99B 4ZOAA 4JG0L 3VXMB 1IMHC 4ZODA 2F58H 3D48R 4NZUH 3RDTC 3SE4C 2GCYB 5BO1H 5F7FA 5F6HJ 4HPYH 5EBMB 3TBWA 1A9BA 4FP8L 1KJ2B 5DSCB 1RK0B 3PWLA 3P4OA 2YSSB 1I4FB 4X6BB 1X7QB 4HD9A 4O2EA 1DBBL 3QI9C 1D6VH 2PKDA 5I8EB 3Q5OA 5L0QB 4MNGA 2IH1A 1RJZA 2VMFA 4G8EA 1BJ1H 1YYLH 1U8KA 1NGWB 3QG6A 4UILL 4QXGL 5HYQB 2F5BL 3QG6B 4G5ZH 4DN3H 3EYQC 1TZGL 3BHBA 5GGUB 4K3DH 2X1XR 4JHAH 5IR1B 3DXAE 4NM4H 1DL7H 2VJXA 5IW3A 3WN5B 1BVKA 1KENL 1WAAF 4PGDA 5FOBB 4GBXA 5IP4A 4EUPA 4QHUB 1R6VA 5GSRB 4LSSH 1ZEAL 4EOWH 2JK5A 4JO4H 4PLKC 3SDCD 4EKXA 4FQLH 1N0LA 1J8KA 1VKXA 1F4HA 5DD5H 5IW6B 5IFAH 3HE7C 3JWOC 3C5JA 4Z95L 1A64A 4NO5A 5DUBB 4XB8A 4XTRC 4HKZB 4QHNA 5K59E 4ZPVB 4X6EB 3QBTB 2VRAA 3BW9A 2VR9A 4JDVB 1CXEA 3OKNB 4GLRI 1O5DT 5BS0A 3TT3H 3V79C 1IGYB 3QUML 4ESKA 2RAMA 1IGCH 4ZG1A 4FQQB 4HFUH 1Z2KA 3MR9A 1K4DA 3ABZA 1LP9A 2H32B 4YHYC 2XKSA 1BEYH 4MD4A 2VSDA 3QCTL 1IZKA 5IBTH 5CINH 4JY5L 1A7RL 1INQA 4PRDB 2ERJB 4O5LH 4M93B 4OM0L 3R1GH 1ZT1A 2Y06H 1T0NA 5FECB 1MCIA 3ARBA 4LLMA 4NC2B 2ZCLL 3AS0A 3HG1A 4A2LA 2AJSL 5CS7A 3QWOB 4Z0BL 4PRIB 5JPNA 3KHQA 2UV3A 5D1XD 4GQPH 2B1AH 4XC1L 5KAQG 3HZVB 1HINL 1CDIA 1TTUA 4R0LB 5IB1B 1IAMA 2CSPA 5EG6C 2AV7A 3O41B 3P4MA 1CLCA 4HUXB 4S1RL 3PV7A 5C9JB 2VTFA 4RMTA 2WIMA 3TBYB 1YMMD 3BOVA 1INDH 4H0HB 3D39E 5KVDL 3T3PE 1OAXL 1VGKA 4PV8B 1JN6B 3QXVA 2AJYL 4KK9C 4EN3D 5ICZA 4OZGB 5DJ0A 3BWUC 5L8KB 3TN0D 3VXPB 1DE4B 2AK1H 2O26U 1CT8A 5IKCA 4NRXA 3SCMD 3WFEH 3IXAA 5GS1A 1G84A 3O0RH 5EN2A 2CGRH 5D7SL 5HGGS 1N5AB 2OTWB 4XGZA 4NNXA 4AH2A 1PLGL 3BRFA 2A6KA 4MA7L 2XXCB 1PEZA 3F7PC 1TCMA 1ZXQA 3ZYOA 4LVEA 4X98B 4PFEA 5DD3H 4R4ND 4JFEE 3ZKQD 1H8OA 4KHTH 2VKWA 1MIMH 3VH8G 1YQVH 4RFEB 4JRYA 5HD8C 4O4YH 1H3VA 4I4WA 3WEXA 3PWUA 4NQEE 4P2OB 1YY9C 1L6XA 1DQMH 5C6TH 1E4XH 1MQKL 4Z7UA 1T83C 4L1HA 3O3EB 4DFHA 1HE7A 3KPPB 2YC1A 4G6KL 3DIFB 4B50A 1ZA6B 1EHNA 1QA9A 2R2EA 5IVXF 1BWWA 2E8YA 5HDOA 4OCNC 2C7UA 2ZJSH 3QAZC 4ZDHB 2DQJL 3W9DB 4BQCA 4MAUL 1YEEH 2HLAB 7FABL 1S78D 2IQ9L 1AGFA 1AGCA 1NCDL 1UACH 3H9SA 2GY7B 2X89A 3FONB 5E70A 1UXSB 4LLUA 5EO1A 2HT4D 4KROD 4MHHI 3FHQA 3BQUD 3TA3D 3PWNA 4MNHB 3RP1A 2NY4C 2J8UA 4WUKH 5E4EB 4S1SH 4Z7UE 4CW1A 1IRAY 4KROC 4MJID 5CUSL 4HKXB 1ZLWK 3MRPA 4XVJH 5EA0L 1SEBB 3G04A 3MXVL 5GGVL 1U0QA 3UTOA 4KJQD 1A3LH 5I15L 2XY1A 3ARRA 3P11L 4ZFZA 4IS6A 4NUJA 4ZTPH 5BVPL 5IOPA 2FR4B 2OI9B 3VWJC 1C5CL 1VCAA 3T3PF 1A7OH 2ADJB 3ARDB 5C08B 3GMPA 4YHKL 4OUUA 1XZ0A 2PTVA 2XQYK 4OCYH 1UXSA 4LLUB 5F88A 2IBBA 1RIVL 3G6JA 3MUGA 3NCCB 3S35H 4FQCL 2OL3A 3UZQA 2FIKA 1A47A 3BMWA 4O4YL 5D72H 5DJXA 3QWRD 4PJIB 3JV5A 3UP1A 4WCYH 2VXSH 1CD8A 2BMKB 1BZ7B 3TO2B 1JGDA 1IL1A 3OKKB 5CFHA 4RIRA 1NLBL 3FT3B 4I3SH 3ZHKA 2YA2A 3UTTE 4CADB 1RUAH 3SE9H 4X7SH 1CDCA 5BZDB 4GW4B 5HYIA 3MLYH 5FA4A 3FOLB 5L88L 5CHNB 1DLHB 3KJ4B 3RGVD 3KPRA 2ICEA 4ZYKA 1U8PB 3F7QA 4PP2A 2LU7A 4F37K 2YD4A 5E08L 4MLSA 3VFGL 1U2HA 2CPCA 2MOVA 3QIBB 4YDVB 3P4NA 3IDMA 4NQXA 1R5IA 3HHRB 1RFDH 2WWMD 5C2BL 3IDMB 4NQXB 4F15B 2VLKB 1QNZH 1NL0L 1JPSH 2H2SC 3KS0H 2Y07L 1UWEH 3MRBB 3GO1L 1V7NH 1KIQB 1AP2B 1IC5H 1LP9E 1CFTB 1ZWIA 5C07B 3ZE0F 3L9RA 2YUXA 5C0GB 1F8TH 2X6MA 5BS0E 3ARFB 2BVQB 4XH2A 5C0CE 3BGAA 3VXRB 1BOYA 3FN0L 4YGVB 5AZ2L 3QB7C 2XNAA 1I8KA 1LO5A 2ZCLH 1V7ML 2EDQA 3VG0L 5IGXL 3QDJB 3W0WB 1MY7A 2Z31D 2EE6A 2O61B 4D94A 4OLXH 5D1ZC 1H0DA 5EBLB 1UXWA 2VC2L 4JVWA 1BVLA 4OGXL 3V6FA 2AK4B 3FCTA 2BJMH 3UTPD 4E41A 2XG4A 2P43B 5I17A 1ZGLP 4KJPC 1P9MC 4MDIA 4RAVB 3TBTB 1CFTA 2ICWI 4PJ5E 3KLAB 4MCYA 3PGFL 4X0KA 1G7PA 2VLJD 2OM5A 3DBXB 3RZCA 1B88A 3S96B 4PJ8B 2OR7A 1H5BC 5FCUH 1JNJA 3QFJE 4B7IA 4PLKD 5D2NB 5KZCB 3MUY1 3KPQA 3U9UB 5EOCL 1AHWB 5FYJU 2GKIA 1U8NB 3SY0B 5JOPE 3EDJA 5DHVA 1B4RA 1TFHA 3CFKB 3RVTC 5DXWA 4Y4KA 3QEUA 5IF0B 4QTIH 5F7LB 1DVFB 4AM0A 3QUMB 3DROB 4WI3A 4AIXA 1OCWH 4W70A 3FO2A 1FORL 4BM7A 2ED7A 1JUFB 4IMKC 1IJ9A 2FO4A 4J6RH 1T7ZA 4Z7WF 1X44A 4HQQH 3WEXB 3WO4B 3RTQD 3DIFA 1S7XA 3V5DA 3QI9D 5CMAB 4Z7UB 1WJ3A 2NY6B 5JPNB 3QJHA 1CBVH 2V7NA 3JWDC 3DUUA 4GAGL 3KPSD 5GHWL 1CLYL 1RVFL 4C59B 4XBGA 4LCWE 2APWA 3U46B 4G6AC 4A6YB 4XVTL 1GL4B 4M6OH 1M71B 1RUKH 3VFMB 2KUTA 2EH8L 2C3HA 1DQTA 2ZKHL 1HWGB 5DC0A 2ZSVB 5ECJE 2XWJB 4OV5B 1NCBH 3SDDB 2MHAB 4OQTH 1G6RL 1ZTXL 5E6IC 1LDSA 3BEWA 1CT8B 3P11H 1ZE3C 4K7PX 5HJ3B 3H9ZA 4RBPH 3VWJD 2NY7H 4XMPL 2ZZUT 1OGAB 3C60A 2V2TA 1OTTC 1HXMA 3MXVH 5SWSA 4NRZB 5MEQA 5F9WB 3FQRA 3ZTNH 2VAAA 1L7TH 1U8JB 2AI0L 2W9DL 1I1AD 1X5FA 4YHOH 4WHDA 3ULVC 1JF6A 4XNXL 4YEEA 5KSBE 1GGBH 3BKCH 2IBZY 4JRYD 4WW2F 2PYFA 5JMOC 5DMGD 3LN5A 1BF2A 4Y2DD 5D6CA 1BOGA 5L8LB 3SDYL 5F89A 4JRWA 1IM3B 1YEHH 1YN6A 1T5WA 1F58H 2ZJSL 3RIAF 5ACZA 1DSFL 3EFDL 1UC6A 2YC1B 4TUKH 1BBJA 4ZUUA 3DO7A 2DMKA 4S0SD 3NTCL 5DD0L 1I8LA 3S37H 2C1PA 2J8UE 2PYED 3S34L 3TV3H 1A1OA 1PG7L 5C8JB 3SDXB 2YD9A 4BH7B 4MNGB 2XG5A 4OB5H 4LHUD 2KBGA 4KVCL 1CGXA 4PP2B 3B9AA 2DJ4A 5D6CB 2FCBA 3SJVA 1FNAA 3D25B 1IEAB 4HMDA 1IM3A 2VITA 4R90H 4RX4A 3C08L 2QBWA 2DQGL 2EXWD 4F57L 4GG6E 1QQDA 4WHYG 4Z9KB 1TZIB 1YEFL 1BZ7A 1ES0A 2FL5B 4JO3H 3HE6A 2W0FA 3V4PL 5JXEC 5JDSA 5CILL 2Z9TA 4NBXB 1A0QL 2V5RA 2A73A 2E6PA 3LH2L 4CMHB 2XACC 1IAKA 2ZP0T 3T3MF 1F2XK 2ICWA 4IJ3C 3U0WH 1UB5A 1BECA 2K1MA 4PJGA 2Q76B 2BDNL 2X42A 3OKLB 1GGCL 1NC2A 3Q1SL 3NBNA 2Z8WC 1KBGH 5K93A 3ZKXC 2ZUWA 4PGBB 3OZ9H 4Y5XB 5KS9A 2F19L 4BFGA 2OXGA 1HN1A 4AIZA 3CMOL 2AJZB 2IEPA 4HBCL 1URLA 4ZUVB 2NY0D 3B9KA 5CEZE 2OP4L 5I17B 3ARGA 1RZ8A 4LL9A 2VDRH 4NP4L 4ZXBA 4CDHA 3FRPG 4NQCD 2PXYA 5F1IB 4KY1L 1XCQA 5CD5D 5HGDB 2C4FU 3MA7A 5FM8A 4JDVA 3MCLH 5JW3L 1YECH 5CBEB 3C6LD 3RIFF 3V4VH 4KJYA 3QUYC 4XHJD 3DETD 3KXFD 4JN2A 5D7JC 1WSST 2CUMA 3JV4A 5LAXA 3L7EB 3O6MH 4OZHF 3WO4C 3REWB 4K94L 1ITCA 4W4OA 2VZVA 4X7DC 4K71C 2HJKA 1KYOK 3P4MB 3CCHA 5E99L 1TZIA 1LK2B 2YRZA 1T66D 3HG1E 2HG5B 3W0WE 2ZKHH 1RV6X 4AM0B 1U8QA 5DURB 2WLYA 2EH8H 4M61B 3X3FH 2OR8A 3RPKA 4E0RA 1N6QL 2F53B 3MXWH 3QI9A 2CIIB 3ES6A 3VMNA 3PJSB 5CD3A 1VGEH 4G6MH 5DJ2B 4EOWL 3DBXA 5J12B 4I3GA 4QRPB 4U1SA 1MHCA 3KYAA 2CH8A 2DN7A 3KYMA 4WFHD 2DI9A 1C12A 5J6HB 3O11B 3O3AA 5E5MA 5TQ2L 3FN9A 4BSWA 3QQ4A 4OM1H 3PQYD 2QR0A 4XC3H 4QKXB 1UCBH 4J6RL 1NFDB 1G9NH 3PWJA 4BUHA 3S8WA 2NY1D 4YUEL 1B0GA 4LLVA 3QIWB 1IKNA 4G8FA 3EYQD 1MCQA 4GRWB 3KJ6L 4U6TA 4NZJA 1ZGLB 5T3XD 1KV3A 3VXPA 4F9LC 2VL5A 5T33H 4XP1H 1DANT 4XCFH 5DRZA 2FD6H 4IIQC 2FYYB 3LKPB 4YHOL 2IMMA 1NFIA 5DTFB 1TJHL 4YHMH 5KVFL 3GMLA 5D1XB 4Q2ZA 4X7EC 4NCC1 1CQYA 4L3EE 2RB8A 4Z77A 1UM4H 1INEL 5EUOE 5E8DH 1YUHA 4OCSL 3ZYIA 2V9TA 1P7KA 4YHLH 5IW1B 3EGSA 1WITA 3B9DA 4U1LB 3RL1A 1XR9A 1T22B 3GDBA 4O51A 3BIKA 3VFOB 3TFKC 1Q9WB 5D1QC 4JG0H 4KV5E 2VYRE 4NC1E 4IOFC 5D2LA 5HHXH 4CKVX 3VXNB 2B0SH 5HGAA 3RWFA 3DYMA 2C3VB 2XTLA 3O9WD 3DV4B 5IM7A 2N7AA 2F53A 5I8OH 4WFGD 2AQ1A 2E7HA 3BX7C 4M02A 4DVRL 1OAQL 5AG8A 3LKNA 1Y6KR 5C0DB 3LOWA 5FO8B 1ADQA 1QSFA 4Y2DA 4RMVA 4PJCE 1O0VA 3HI6L 2CJUL 4I18C 3K74B 2Y72A 4PTUB 3D69B 3L5XH 3MRIA 3VG0H 4DTGH 5HSFA 3UTTD 5GSVA 2Z4QA 1R3JA 4Y4FC 4YHIA 2ORBL 3PHQA 3M17B 5C9KA 4N0YH 4JHZA 3RNQA 1MPAH 2QLVB 2B8OT 3SCMA 5EOQL 4PRNA 3GSUA 2D7PA 2R8SL 3KYKH 3MRCB 3T2QA 4L9DA 2OR9H 4PJDF 2YBRB 2P5EB 1PX4A 3EJZD 1R3LB 2A83A 3RAJL 5C09D 2FIKB 4G9FA 1JCKA 4FQXD 3KS0J 2Y5EA 5EU3B 5GS0L 2WSKA 1IQWL 1G1CA 2PTUA 5CZKA 4KGLA 4FXGB 4G8EB 3ZKXB 4M00A 3AU1B 3VWKC 5ITBH 1BBDL 4ZSOE 3O6FD 4DGYH 2R0LH 3SDDC 3MLYL 4EIZC 4UI2A 2BNQE 2EECA 4P48A 5FA4B 1UB5B 3G08B 3BYYA 2R39A 4DEPB 3EYOB 3HZMA 4K55A 2ZCHL 2FH8A 5JHLH 2NY1C 1HEZB 1OB1B 2MTPA 4QWWC 3QDMB 2IPKA 3M8OH 5IJKC 4WU5A 4WENB 2VNCA 3PDGA 4GH7B 5JR1H 1OY3B 2W65A 3MGOB 5B8CC 3M8OL 3QPXL 4LCWA 1P7QA 3ESUF 2G75A 4MYWB 1UVQA 4Y4KD 3NIDE 1NCAL 4NKIL 2OQJA 2ITDB 1J18A 1E0OB 4JY6B 1EEYB 3L3GB 3PIQA 3WIFB 1BP3B 1QBLL 1OAUL 3RWJB 1WICA 4P3DA 3ARFA 5KTEL 2DRUA 1T66C 3N06B 4MQ7B 5IT2L 1N0XH 4LGPB 5TDNA 5GRVL 4HIHA 4KI5C 4WDIB 1CFNA 2NQCA 4NJ9H 5FV1L 3DXAD 3B8YA 3QNYA 4WW2B 4W4OC 2DQEL 5EA0H 2HT2C 3RAJH 4MQXD 4HJ0C 2OL3H 3KYKL 2WP3O 3EFFA 2E3VA 2A6JB 2FD6L 3QUYD 4OF8A 4S1SL 3WIHA 4ELMF 1D5BA 3D87B 1L9NA 3C6LC 1CXLA 1MSPA 3D3VA 3ORJA 3LQZB 3QCUL 4LNRA 4B0MM 1FGNH 1MF2H 4YGAB 3KXFB 4P4RB 3IXAB 2DM2A 4LBEA 3SDXF 1E28A 1JZ4A 3NA9H 3N85L 2QQQA 3VRJB 1DQDL 3DPBA 4R4FH 3PXJA 4DWHA 2MJWA 2G9HB 1NLBH 4HLJA 4DGYL 4PJ5A 4M7ZC 2IQAB 3SE8H 1JGEA 4XPFH 3W0WD 3TCLB 3RL1B 5E1AB 3QWQB 3GM8A 4PBXA 2EDXA 1NCUA 1GPOH 3H6JA 1AD9B 1Q38A 3BXNB 4LCCA 3F7YB 1N7ML 3GBLA 2CDEA 3C5ZA 4RGMC 3NCYS 2Q8BL 2X1WL 3UTPE 1A4KB 5F9AC 4LDEB 4OD3L 3O2VL 4Y88A 4NO2B 1JF1A 2EYSA 4GS7B 2QEJA 2VUOA 2YPVL 1NGYB 4Y5XC 4GSDL 3EOBB 3HZVA 3IU3B 5FYJD 4JZJC 3VRJA 4Y16D 2FJHB 2FATH 2I24N 4Z7WB 2IH3A 4N0YL 2JB6A 5H37G 1FRGH 3FAXA 5DDHB 5BZWA 3SHSA 4N5EC 3X12B 1MAML 4XCYA 4OFKA 4WV1C 2R29L 5EC1A 3S36X 2H32A 3OGOE 5CUSH 2VQUA 2G60L 4I3RL 1J1OL 4KQ4L 1E4WH 3V6OA 3DXAB 4KY1H 4X6DB 4CW1B 3O3BA 3ARTA 3N50A 3L7FA 2ENSA 4DOHE 4QXUL 4PJEB 4UT9H 1IT9H 4D3CL 4YFLI 4FABH 1UCBL 1NH6A 1M6OB 4LQFH 4KXZI 4OM1L 3GSWA 3DI3B 3I75A 4WU7B 4JE4B 4PJ7B 3WUWA 3WIIH 4G80A 1R3HB 1WVZA 5FA3A 3V6ZB 1UA6L 3VFUA 1H8NA 1F3JB 5DVNA 1OGAA 4ZQKB 4TULL 1X5YA 1INEH 3O4LB 5I1KH 4M7LL 5TGBA 3IXTB 2IFGA 4AT6A 1FFQA 4NQTA 3PWUB 4P2OA 4Y2DC 3SGEI 1YEKL 2WP3T 4WEUD 4Q0XH 3GM0A 3ROOB 3RTQB 5IFHH 5LGJB 4NIKB 3OPZL 5J56B 3G6AB 1N26A 1FNHA 3BP7B 1I1AC 3HCVA 4Z7VA 2XTJC 5EFIB 5EDXA 3QIUD 3LN4A 1U3HB 3TT1H 1BX2A 3W9EA 2Q7NA 3HMXL 1SY6A 1I3GH 2YN5A 1OTTD 2FJHA 3WJJA 4OZIF 4XGZB 3UZVB 4O2EB 2AJXL 3RDTA 4LPUA 1MREL 1U91B 4YWGH 1YEDB 3OX8B 4NWTH 4L8CB 2OXHA 5HGBB 5H37H 3MRGB 3ZSTA 5CJ5A 2EDRA 3W82A 2EYRA 4GAYA 2O93L 2QQLH 1SM3L 4JFPB 3CUPB 4KKBC 2I60H 4S1RH 1WBYB 4M8QB 1KUMA 3H7BA 4YZFE 4FQXB 4UBDC 3RGVB 4GBXB 2E7BA 4X5XB 5E94A 5KG9B 4JCMA 1NBYB 4NN6B 1HINH 1FYTA 1CDUA 1OVZA 3N1QC 5L7XH 3H9SE 2XTJB 3LPFA 5FDWB 3MV01 5E2TH 5B22A 1NMAL 1MCDA 1LE9A 2ESVB 5JW5B 2WUCL 2HKHL 1KFAH 1G7QA 4WHTB 3E6FB 1ZK9A 2CLVB 2NXYD 4U2ZA 3X14A 5I66A 3CFBA 1NGWA 2DICA 1A14L 2OZ4A 1D5IH 1VA9A 3D1MC 3OKMA 4J1UB 3SKMB 2PYEE 5JUEL 4PJIF 4C57C 4ERSL 2B5IC 4Q0XL 3VI3E 5C8JA 1QFHA 3ZE0E 1NCCH 1NMCB 2EO1A 4P9HH 3BWAB 3QDME 3CC5A 1A1MA 1LP9B 3HAEG 4JFEA 1MNUH 5E9DB 1S7VA 2PF6A 1N3NB 2EIZB 5DO2D 5F70A 3BFOA 1INQB 4PRDA 2AJUL 1E4JA 1BHGA 5DFWH 1JK8A 2HRPL 1IGFL 2NLJB 3TWCL 3WKNA 3MREB 3VGAB 2BC4B 4JFHE 3VFWA 1SYVB 5ICZB 4Z95H 3FT4A 2Y36H 3MBED 1FBIH 1ULVA 3MPCA 4JM2B 1QZ1A 5CP3A 3U0WL 4X6DF 4KJPD 5I1AB 4KUZL 3I84A 3GJEA 4UDUB 4ZPVA 2O5ZL 3CUPA 2IQAA 5DD1H 4Q9RH 1NSNL 2P5EE 4WNQA 2G9HA 3T4YB 4NT6A 2BRQA 2PO6D 5GRJL 3QDGA 2A0LD 3IRZA 4KC3B 1X5ZA 2ED8A 1UADC 1UM5H 2RCSH 3R8QA 4HH9A 3QNZB 4IRSB 5SWQA 3MFFB 5ICXB 4DEPC 4Y19E 1HOCA 1W72H 4HAGA 5JNYB 4MA1B 3AROA 2X4TB 4MXQC 3EW3B 3LQZA 4M61A 1KJVB 5FM5O 32C2A 5I1GH 4OLZH 3MNZA 2KQNA 4OB5L 5EIVA 4KDTA 2NTSP 3CX5J 5F1NA 4G8IB 3MROB 2LQRA 3T0ED 1QFWH 3QXDB 4XXDB 1BFVL 4KDVA 5GS0C 1B2WH 1U3YA 5I1CL 3JSSA 5GS2H 2AK4A 1D5XB 3D0LB 1L0QA 1G7HA 4J3SA 5GGQH 1DN0B 4Z76A 2WWMC 5EU6B 1DBMH 3GKWH 4DKEH 3MGTA 1IM9D 1LEKB 1OQOA 3O45B 1FC2D 1G7IB 2A1WL 2F8XC 1P5UA 4F7CA 2BVQA 3NA9L 4F58L 3V0VB 2YPKB 4PRIA 5ID0B 1M6OA 1T1WB 5HPMA 4ELMB 1LD9A 35C8H 5GPRA 1WWCA 3MRMA 4PJ7A 2VABB 4XNXH 2BVEA 3DSFL 5DJCB 3MJ7A 4C4KT 3DHMA 1FVDB 3KPLB 2R56H 1OW0A 5CIPB 1FDLL 3MO1A 3T8XA 2BNRD 5HHOD 2YWYA 2BVTA 1A4JA 4MGXA 4EI5C 4XBEH 4PJHB 2HYMA 3ARVA 3QIWD 5DWUL 1KG0A 2VXQL 5DI8B 4GSDH 2CDFB 4HFWA 2YKLL 1V3LA 3QAZB 1V3MA 5ITFB 2HLFC 3HPLB 1SYSA 4Z7VB 5KN5A 2D9QB 3HMWL 3NACH 1YUHB 5J3HC 5LBSH 4L29B 3HE7A 1RUKL 3AM8A 1KCKA 3ILQD 1N7MH 1XGUB 5DGRA 4KKLC 4KJQC 2GSGB 1ZHKB 3Q0HA 5HHVL 5IMLA 5F3BB 4OZFA 1TVDA 4G9DB 1EGJH 1S7WB 2O5XL 4HAFA 4Y1AD 3H0TA 5IMOA 3DX7B 3QISA 1MH5B 3M17A 2D7QA 3CLFL 1JRHH 4TSBH 4UTAL 1OTUD 1QFUL 4X99A 3VXMA 1P6FA 2NY4D 4NFBA 3B4NA 3NFNA 3BQUC 2V17H 3LD8B 3O9WB 3QUXA 3SGDI 2R0LL 1I8MB 1FGNL 1D6EB 2YXFA 5E4EC 1FVEB 1S5HA 4IS6B 5KVGH 3BUTA 4KROB 4XCCL 3AREA 2XZQH 1D9KB 1FFNB 3EYSH 4EIGB 1B6UA 3JTTB 4LASH 5IGXH 2X41A 4UQ2A 5F7EH 1KXQE 3ZT7A 5BMFL 4X6BA 1MELA 3E1F1 2ADIA 1CIDA 3ZE2E 5C86A 4HMCA 1MEXL 3AU1A 1I7ZB 5F6HI 2BNUB 1TDQA 5ANME 5A1AA 4Z7OE 1RMFH 5D5ME 1JHTB 3ULVL 2ICCA 5EOQH 2ADFL 5E1HB 3WNNA 4YHZL 3V8OA 1JHLH 5DWUH 3U9PL 1SVCP 4K3JH 4LLAA 4YK4C 4LCCC 2DL2A 1A3LL 5I15H 1PDKA 5GRUL 5CCKL 3EJYD 1A9BB 2P5EA 5K9QI 1GC1C 3IFNL 1CIUA 1P4LA 3TVMD 4EBQL 3ZTJG 2DLFH 4YFDB 2NW3B 1P7HL 3AUVA 4IEFB 4C4KO 3SPVA 1CXKA 1CFVH 3FMGH 4KKNA 2CKBA 3CXHJ 4JDZB 3N1FC 2CO6B 1NDGA 1CYGA 5SWZE 4UQ3A 4RGNC 2ZOKA 2AEIT 3EYOA 5C0CD 1JRHL 4UTAH 1S5IL 1WZ1H 3NH7H 1FCCA 2VLKA 3VXRE 3EYVB 2A9NH 4PJ9A 4G43B 4H25B 1MJ7H 2B4CL 2GAZB 3L3KA 5DJDB 2F8VA 2I9TA 3QDMA 4ZS7L 4JRXD 2LU4A 2XZCH 5GJSH 3KYNA 5GGQL 2F54D 2NY5H 5M7QA 5FO9A 1V7NL 2KPNA 1GGTA 2R1WA 1T7XA 5D1XC 2K7PA 1GIGH 1EZVX 1J88A 3TH2T 3FOLA 2ESVA 3MFFA 2GFBB 5E2UL 3PJSA 1R5VB 1F4WH 2Z8SA 5HDLA 1CXFA 1DBAH 1CGSL 2Z8RA 4ZO6A 2XOTA 2H26B 4FFWC 4HV8A 1KPRA 1JHKL 1G7LA 1TNNA 4GMTL 4QRRD 4JM2A 3MFGB 5GISL 3MRFB 4X6CB 3HC0A 5CZXD 4YUEH 4PGJA 1LILA 3OQ3B 2ZUXA 1HKLL 4U3HA 4HXBH 3JVGC 2FEEI 5GISH 3L3OA 4X4XA 2IAMA 4M7ZB 5FOBA 3D9AL 1HHHB 4M48L 3RNKB 3RVVD 3L1OH 4F9LA 2VR5A 4OIAA 4ZD3H 2VXSL 3ZDXF 3DSFH 3RPIB 3CFCL 1ADQH 3OF6A 4K07A 5FYKE 5J4MA 2E8ZA 1NMCC 3OGCA 5I1DB 3QHFH 3BGMB 4KUZH 4KK6D 4MMXC 2CKNA 3PQYE 2HTKD 1U8KB 5D7IE 1FP5A 1J1PL 5DEGB 1CK0H 3O11A 3O3AB 3GUTB 3ZE1E 1RJYA 3DTXA 3GIVA 5DRNB 2CXGA 4DKEL 4H88H 2AXFA 5FHAL 1E4KC 3RVWD 5CZVH 1R3KB 4QLRA 1CVRA 4IDJH 1IBGL 5CIPA 3T8XB 1BAFH 4UUJB 4JFOA 3FCTB 2OTUB 4E0RB 1ETZB 2E7LC 4XPTL 4C54A 4PRHA 4LPCA 1WUNT 1TZHB 2UWEF 3LKOA 4OD2A 4OT1H 4QOKB 4XH2B 5F7MC 3O9WA 5CWSB 3PHSA 5KS9F 3QH3A 1BD2E 4OFDA 4LCYB 3EZJB 1S9YB 2DTSA 3KPMB 3QUXC 5FUCE 2QSTA 4TTDC 4E9LA 4WGWB 2LABA 4D0CB 3MNVA 3NCFB 3LRGA 1HILA 3QUYA 3A6OA 4JFFD 4WEBH 3MC0A 4ZDHA 2BY2A 3QDHA 3LS5L 1NFDA 4K7PH 1BLNB 1GGIL 1KLGA 5F96H 5MEOA 4XNYH 2WBJD 2YZ1A 3L5WB 1EBPA 3RDTD 1HWHB 4HCRL 3FFDB 1IKFL 4FA8A 2UWEB 4P46C 5IJKA 4L8BA 4YK4B 1GGUA 1P53A 1OAXH 2NX5D 5C6TL 3MV8D 5BV7C 4PJCB 3TGXA 1TJGH 2G2RB 5BMFH 3CD4A 1VACA 4Y2DB 4XP6H 1JWSA 4L3EB 3QFJB 5IESH 4RIRB 5AD0A 3B5HA 1EIBA 4XVSH 5BVJB 2BHZA 3KG5A 4BH8B 4M1DL 5F21B 4NNXB 4AH2B 3H42H 4LCWD 2AS5M 3V6ZA 5I8KL 3VFUB 5LWYH 4E41D 5FYLH 1HNGA 3TPKA 5KAQF 1IE5A 3DROA 2IFFH 2M26A 5A3ID 3S37X 1ETZA 6CGTA 1AJ7H 1IKNC 3QO1B 2IPKB 4OIBA 5CINL 4KMQA 1WFTA 5CWSA 3SBWC 2LFGA 3FT2B 4Y4HA 1JNHB 3ARQA 4AEHH 2V2TB 4M4PA 3GMRA 1MHEA 1WAAE 3HNVH 4QHUA 3HE7B 4H1LG 5ESAA 1U8MB 2JCCB 1IFHL 1RZ8B 5JW4N 1LO0L 1FZOB 4X4ME 4NFCA 4YBHA 2YKLH 3UC0H 1CR9H 3OKYA 5DVOA 4I9WE 1DLHA 3LDBB 4GG6A 4UB0H 2C5DC 5H35A 3CVHH 3VE0A 1QPPA 1U58A 1IT9L 2EEAA 4D3CH 5DD5L 4PP1C 4QY8A 5T3XL 3AS2A 3QNXA 3C60D 1J9CT 4HIHB 4QXUH 4DZBB 1R3LA 4N0FA 5EU5B 2W9EL 3WCYA 4TVPD 1DZBA 1PKQB 4LSSL 3SQBA 5KS9B 3ULUD 4E5XB 3C8HA 1FLRL 1A0QH 2BSSA 4U6YA 4I3RH 2W9DH 5AG9A 4RZCA 4RBPK 3X14B 1MAMH 4MDJB 4I5BA 1HQ4B 4HFUL 5SV3A 3TA3B 3P9MB 3SDAA 1B4JL 1JPFA 1VKXB 3VCLA 1JZ2A 4F37F 5DMYA 1WT5C 3KDMA 2XFXB 1TCRA 4PJBA 3I85A 2F54E 2