1K85A

Solution structure of the fibronectin type iii domain from bacillus circulans wl-12 chitinase a1.
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
88
structure length
88
Chain Sequence
b'HMAPTAPTNLASTAQTTSSITLSWTASTDNVGVTGYDVYNGTALATTVTGTTATISGLAADTSYTFTVKAKDAAGNVSAASNAVSVKT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHITINASE A1
publication title Solution Structure of the Fibronectin Type III Domain from Bacillus circulans WL-12 Chitinase A1
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Hydrolase
total genus 7
structure length 88
sequence length 88
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1k85A00
3NABH 3C5ZB 3O4LE 1P53A 5C0BD 4HDIB 2GSIB 5CCKL 1W0YT 1F6AA 1VGEL 1FBIL 1UXSB 3PP4L 2BCKB 3QEQE 3W5MA 4M5ZL 3EJZD 4LHJB 1ZLSL 2P46B 4HWBA 1AP2A 4EUPB 1EAPA 1LP9A 3D0LA 1G9ML 5EBLA 2ATPA 2CRYA 1NC4B 1Y18A 3JWNC 3NIDF 4JRXD 3HE6A 1YEIL 4P5KB 3GMMB 1T1YB 4PJ9C 5D5MA 2FEEL 3MA7B 1XIWA 3QA3B 4H1LB 3FN0H 1G7IA 1WWBX 2XG5A 2BNRA 2DLFH 3LKPA 3IKCB 3DETC 1VGKA 4HIJB 5D4QA 3REVB 4U0RB 3TZVB 3L7FB 1N64H 3RIAK 2BVUA 3AVEA 3WDIA 4LIQL 1I9EA 1UWGH 1YEKH 1HKLL 5T1DL 3BZDA 4NP4H 5CZXC 1KLGA 4OQTA 2HN7B 5ELIA 3QHFL 5IHZB 2BOCA 1I85C 3FFCA 2B1AL 5DD6A 1YNTA 5K9KA 3UEZA 3F7VA 5HHNB 2H45A 3GHEL 3ILPA 3HNSL 3JBG7 4NRYB 4OD2A 4UB0H 5EOQH 1WT5A 3GSQB 4LQ1A 1CQKA 2YRPA 4P4RB 2DM4A 4KUCF 5C0GB 4EQ3A 1MJUH 1R3KA 5DEFA 4QLRA 4RMTA 2J12B 4KQ4L 1R3HA 3IRPX 1PYWB 1ZGLM 4P23A 3U4EB 4MCYB 3IF1A 3PDGA 3M8OL 2X2YA 3MUZ1 5L8JB 2DQUL 1DE4A 1DQLH 1VFAB 2APBA 1MY5A 2VSCA 5C2BL 4X6CE 3ZHLA 1V7MH 1FGNL 3QBTB 1XF1A 3F58H 5E6ZA 3ZKSD 3PABB 1UM4L 3ABZA 2AK4B 4TSCL 3NZHH 4W68A 1ZA3A 1TPXB 1UJ3B 4ZXBA 3EAKA 2NXYD 1QRNB 5ICZB 1WBYB 3SDXA 4GXUM 5FKPA 1D6VH 3I3BA 5DFWH 2VNCA 4JANA 4JG1L 3NCJL 3TJHD 5IW1B 1ZHBA 4PB9L 5D6DC 4QHUB 1DLHA 1UENA 3WKNA 1X5XA 3F6IA 2EZ0C 5D2NA 1V3LA 3QQ4B 5HDBF 3WJJA 2GITA 1YN7A 4PBWD 1J12A 5C9JA 3W0WE 3ZKMD 5GGQH 5HVWA 5HXMA 1HH6A 2NXZB 2X05A 3FB5B 3BI9X 3AY4A 1RJLB 1DZBA 3X3FH 1FRGL 3GSXA 5C2UB 5SWSD 2IFGA 4F9LA 1JGEA 4KKBD 2ZCKH 1A3LH 2QSCL 1BOYA 3GIZL 1AD0A 2R1WB 5DMYA 5GJTL 4GRLD 1RIHL 4M43H 5JW3L 4X0KA 3AS2A 2XFXA 4KTDH 1L9NA 1MRDH 1R3JB 2PCPA 3PQYD 4P2RB 1P5UA 3MCKB 1HHGB 1R5WB 4PGCA 4PP2B 3L3JB 1AFVL 3ZT7A 2YMXH 4NM4L 4F7TB 1C8PA 4UTBL 3FMGH 4UUJB 2H2SC 2UYLB 3V4UH 1BZQK 5C71A 3UTSA 3SO3B 1CS6A 5DEZA 4ZD3L 4H25A 1Z2KA 5MEOB 1NDMA 1UACL 2Y07H 4YEEA 3ORJA 5EZIL 4G8IA 3CDYA 2F53A 4UBDD 3UTQB 1N7ML 3T0EE 3KPPB 4NN7B 2APXA 3C08H 1IAMA 3O81A 1E6OH 4PJIB 2A6JB 1EHNA 1DQTA 3ZYOA 5T5FH 3O4OB 1S7TB 1M6OB 3LEVL 1VKXB 3PWVB 5CSGA 4QT5B 5D96B 1CDUA 2A1WL 3HZYA 4LHQB 3L3IB 4ZFGH 2J8UF 3DXAB 3KPRB 1BM3H 3I3EA 4QRPD 4Y4KC 3NA4A 1EZVX 1QTYT 4LGSB 4EI5A 4R96A 1JWSA 4KI5D 3V4PL 3ULUE 5MHSD 4MQXD 2B2XL 4BFIA 4E41D 1I4FB 3QIBC 1KB5H 2VLRA 4PG9B 4WFEE 3R1GH 5L6YL 3GK8L 2FIRT 1NCDH 3CFDA 3VI4E 4KKLD 4LFHG 5E0QA 3CSYA 3D25A 1CLOL 4CL7A 5ITFA 3O4LB 1OT1A 3BSZH 4V2BA 3ZDZE 2XICA 4K3EH 2VZ3A 4Y4FA 1QSED 3QEQB 4WENB 5LBSH 2ZP0T 1A0QH 2DQFB 1IEBB 4MCZB 2I27N 4Q6IA 4QYOA 2VZSA 2Q76A 3OV6A 2WLYA 5T3ZE 1B9ZA 1GOGA 3WEXB 1X9QA 4Z7NE 2E7BA 3KS0J 1IGML 4WEBH 4X9IA 3VXNA 3BO8B 4NQDE 2Q8BL 1U95B 3FQUA 2ZUXA 5HVFB 4FTVD 3IDJA 3RU8H 2JJUA 4DN3L 1YMHA 3IRZA 2KBGA 4P5TA 1NMAH 4MSWA 1J5OH 2O61B 4O2FB 1YNKH 1L0XA 1U8PB 3C6SB 4GRMA 5IROC 4J3UA 1YQVH 4MD5B 1B6DA 3T2PA 6FABH 4ELME 4JHAL 2AJZB 1PSKL 1I9IH 3FB8A 3VXUA 5B39A 3QH3A 1H0DA 3O3EA 2VUOA 5IQ7L 2NLJB 2A38A 1BPVA 3NPSC 5I1GL 1T21B 1IKNA 4Z95L 2IG2H 1EGJA 4JKWA 2XRAH 3AB0B 5KVGH 4I8DA 1QQDA 4AM0B 4UOJA 4OUOA 1INQB 2LU3A 1YEEL 4XNYH 5IJVB 3MNWA 4HUWB 4Q9RL 4QKXB 1DLFL 5KN5A 3ULUH 1D5ZB 4UU9B 1Y6MR 4LU5H 4RX4D 5FKAA 1HZHH 1N8ZA 4M7ZC 3MYJB 4ODWB 4LVHB 4U0QB 5DJ8B 3ARVA 3OGCA 1JF5A 1S7WA 3VDBA 1FVEA 1HEZA 4NO3B 3HS0B 4UT9L 4X6CB 3U1SL 5GSVB 1RJCA 1OD7A 4M9PA 5ILTH 3RA7L 1MOEA 4WIQA 4EVNB 3H7LA 2ARJA 3VXOB 5IQ9A 2VZVA 5T3ZH 3N85L 1J0IA 3K46A 4M6NH 1OAZL 2VDPL 1II4E 3T4AA 2ZKHH 5DHVH 5FYJL 3P4MA 3SGDI 1DVFD 3BZEA 1YECH 3JTSA 4N0YH 1BVKA 4YHNB 3W0WB 1I7TA 5EBMA 2COQA 5GZNC 2JE8A 2XYCA 4XCEB 4JO2L 4AG4L 1S9XA 5F7EH 5E08L 1E4XI 2QADC 4DVRL 4M61B 1B88A 3NABL 3MA9H 4NOBA 4O5LH 1I8MA 4PJCE 2ED7A 5ESAB 5IJKC 1I8KA 1O0VA 5F1SA 2BFVH 3TBVB 2EO9A 2ILLA 3UDWA 2P44B 1X5GA 2F5BH 1A4JA 3MV9E 4NQSB 4RFOH 4AH2B 4ODSL 5F72S 3RGVB 2X9XA 4E9LA 1BQHB 1BOGA 1XF2B 2VQTA 2JJWA 3B8YA 1KCSH 1CGXA 3ARTA 4ORGA 3KXFD 4YDLC 1WZKA 3CVIL 2HFFB 5EZJA 4QNPE 4P0DA 5CEZE 5IUSA 4UT6H 2FLRT 4Y88A 3ZE1E 3FN0L 2R9HC 1FJ1B 3EW3B 4LLVA 1U58A 2DLFL 2I5YH 2CK2A 4JFQB 3EYFB 3QUKA 2IPTL 3VGHA 1OTTC 1FZKB 1N64L 4I0PB 3TO4A 4HCRH 4KROC 3FONB 1IZKA 3UX9B 1UWGL 1GXEA 3REWB 4RNRA 4F2MA 1YEKL 4NP4L 4X4XA 1OGTA 1WBZA 1MJJB 4NFDA 4XPAH 1CD8A 3T0EB 3PGFH 1EFXB 4UB0L 4PGBA 1WIPA 5EOQL 4GOSA 4QHKI 1ZT4B 3Q2CA 4RMQA 1A6WH 4L4JA 1MJUL 1F3RB 2WUBH 4NBXB 2Y06H 4UTAH 3BIKB 3LMJH 3BKYL 1DQMH 4ESKA 2NTFA 4F7EB 4NC0B 2VXQH 4XXDA 3TN0D 1E28B 1LE9B 4MAYA 3OAZH 2OMBA 4UILH 2A83A 1T03H 4FFWD 4WHYG 4MJ6A 3VXMA 3QUZA 3T0VA 1FFNB 4GS7B 5FO7A 2OMNA 5I8OH 2JJSA 5C07D 3FO0H 3BW9A 5HI5C 4IDJH 4G6KH 4JFEA 3MGTA 4WWKC 3KPNA 2VITB 3THMH 4J4PD 5GRZA 2XOTA 1CXIA 4P3WA 4UAOC 1KACB 5LGHL 5EIIA 1D6VL 3FRPA 4P57A 4LLWB 1A1MA 2PO6B 2VJXA 2IANA 5HGBB 1Y6NR 4NQDB 4HUMB 1ZGLA 3B9AA 5JW5B 5CSBA 3GSOA 4DOHE 1OVZA 2OTWA 3ARDA 2IQ9H 3V0AC 4DCQB 5GGQL 3VWKA 1A7RH 3MRLA 4M6OH 4NQXA 3X3FL 1RK1A 5EH1A 3KLHD 5I1HH 3V7AG 1SJHA 3L3KA 4PY8J 2ZCKL 1A3LL 1JYXA 5ICXB 2Z4QB 5IW3A 1QFUH 1S7RB 4ELMB 3VFUB 2XQYK 3KWWA 4D8PA 3OPZH 1MRDL 1F3JA 1Q9LA 1T7ZA 4LCYA 4X7FC 1F45A 2EXWC 3TVMC 2IPKB 3DO7A 2PYED 4F7PB 3FMGL 3RWIB 5DMKB 2DJUA 1NCBH 1X5JA 1QSVA 4L29A 4EEEA 1YN6B 2VLLB 3V4UL 1QFWH 1F3DJ 4OZHE 5FOJA 5IKCB 2L7UA 2EH8H 2Y07L 1CLZL 1GZQB 1RIVH 3QDMD 1G9EA 1IQWH 5DFVD 3R8BB 4JLRA 2QEJA 4NKDB 4AEEA 1I3RB 4EIZC 2EDKA 1J05A 1OPGH 5DK2A 3C08L 4L8DA 1E6OL 5E6IB 2B0SH 5FCSH 2ID5A 3RTQA 2IBZX 5T5FL 4QY8B 1DQDH 4GBXD 3VD4A 1LO5A 1UADC 4HUKB 5D6CA 4QWWD 1OSZB 2YN5A 3H7BA 4ZFGL 4OTXH 4HKXB 1ZKAA 1BLNA 1BM3L 1F4HA 3CFKB 2C3WA 4I77H 3C8HA 3DOSA 3GKZA 2QR0A 4GUPB 3Q5TA 2C1PA 4GAYB 3KPSA 4Z7VF 1LNUA 4FMFA 1RULH 4GW1A 5JORA 2JCCA 1A64A 1KB5L 3R1GL 5J0BA 3JXAA 4WU7B 1NCDL 4P46C 3HMXA 3SDDB 3ULSA 3AAZA 3VRJA 1DBKH 5BOPA 3O3AA 4PJCB 3BSZL 4R4BA 4K3EL 1MCHA 1LEGB 3WFCH 4YWGH 2H3NA 3QUMA 5LBSL 4Y2DD 3MV9B 4S0SD 1A0QL 3EFFA 1S3KL 4Z8FH 2UZXB 4PRDA 4PRPE 3BPOC 4OLEA 4Z76B 4U1HA 4NDMB 3EUUA 1XCTB 5IB1B 5DDHB 4GAJH 4YHYB 1MUJB 1YPZE 4U6XA 4Y5VA 1I1AD 3DUSB 5SX4I 4YGAB 2WWMC 3RVUC 1MRCH 2WBJD 2D7QA 2J6EA 3RU8L 1MHHA 1VADB 3CFBB 1NMAL 4R4ND 1PGRB 4KJQD 3ARBB 1YNKL 5EORH 3GMPB 1NC2A 1MVUB 2FO1A 4O2EA 4LCCB 1YQVL 5DQJA 4X98A 5D7JC 4ZFOL 3A6OA 2YEZB 3PHQA 3GSNB 5D1QD 5D93B 2HMIC 4LCWD 5HGDB 4XC3H 1AO7D 1QP1A 3P40A 3SE3C 4ZS6C 5EC2B 2W07A 1J0JA 5D72H 1A9EB 4ZUVB 2IG2L 1N5AB 2K3TA 2XRAL 5KVGL 1Z3GL 3V0VB 4CVXB 2GTWB 3LEXB 1XF3A 1LHZA 1N6QH 4XNYL 1LO0H 3M45A 3WNLA 4XP9H 2CRZA 3QIUC 4LLDB 3RDTD 3VGEA 2X9YA 4N0CD 1N6VA 4I2XA 4WJ5B 2CIKB 4LU5L 5TE4H 2B5IB 3QUYD 1MLCA 4LVNC 1HZHL 1CFNB 4PR5A 3SGEI 1K3ZA 1CR9H 3BKCH 1K8DB 4WV1C 5B39G 3DROB 3QFJD 1U8IB 1CFQA 4RGNE 4R7NA 3WS3A 1RD6A 4GW5A 4H20H 3TV3H 1D9KA 1VHPA 3IAGC 1K9TA 5ILTL 3CVHA 2Q7YB 4K55A 2Z8WC 1G6RB 3BZFB 4KK8C 4Q9CA 5HI3C 5T3ZL 2W0FA 2C7UB 4M6NL 4PJ7F 4G9FA 5F9WB 4YAQA 5SWZA 3ARQA 4MDJB 4D9QE 4TTGA 2Y7QB 3DETD 4PGDB 1KLFA 2XKSA 5E2JA 2HJLB 2WBWB 3KPLB 4KI5F 1YECL 4JM2B 5L7XH 1WCBA 4N0YL 1G7LA 4DOHB 3OKMB 3ZDXF 4CVZB 1H15B 3F7QA 5CZXD 5FHBH 4LMQE 5F7EL 5BRZA 4LRNH 4RGMC 4XZUB 4CW1A 5FYJD 4HAFA 3MA9L 5DJCB 4O5LL 3RY4A 3LKNA 3VGBA 3VXSA 3O45B 3SQBA 5AZ2H 5HYFA 5I2IA 2BFVL 4WHTB 5EC1B 4DUXA 2F5BL 5IB3B 2Y5TA 4WFFE 3B5HA 3RY6C 5KSBA 5IF0B 1TVDA 1KCSL 3MLSH 5J89A 3GM8A 1UB6B 4WVRA 3FT3B 1WAAF 3MRGA 3TNMB 3GSRA 1KJMB 2N4IA 4XH2B 3ZE2E 3ULVF 4QHLB 4UMGA 5FGBA 5DA4A 3CFCH 4EI6B 2GK0B 1EVTC 3FOMA 5KVMC 4A6YH 2IADB 2SEBB 3ZE0F 3QG7H 1FN4A 1QVOB 3MV7D 2CGRH 4HCRL 4M3JA 5J57B 1U8JA 5FUCC 3PHSA 4OZHB 4GRWE 2VE6A 5JHDD 5A2IH 3LCYA 2J8UA 1MCOH 2Z8VC 3P2TA 4M93B 4C56A 5D7LE 1XF4B 3MV8E 4V2CB 4XPAL 1LVEA 3ROOB 2GQHA 3B9KC 1VACA 2CR3A 3PGFL 4YPGB 5T3XH 3MFGB 4ODXB 4E5XA 1ORQB 1A6WL 2WUBL 2VH5H 3VXTB 5AG9A 2Y06L 4UTAL 2A6KB 5BZDB 4NCDA 3LMJL 3IDYC 1DQML 3NGBC 1FYTE 5D7IE 4N1HB 1T0MB 2EZ0D 4F7MA 4PLJC 4BELD 4CKVX 1NCTA 2VXQL 3N06B 5CAYB 4F37K 4UILL 4FXLA 1T03L 4PTTA 1KPUB 2HJKA 4OAWA 4BZ2L 1S5IH 4ZO7A 3GMNB 1S8DB 1PZ5A 1ZVYA 4OGYH 3TA3C 5L2KA 1I9JH 5I8OL 3H42H 1MJ8H 1LEKA 32C2B 4IDJL 5J56B 4KRPC 4G6KL 1NGZA 4R8WL 3ZDYF 2IMMA 3CFEB 4FQJL 3THML 4OQ1A 5HGHB 1TFHA 3BYTA 4DTGL 4P4KB 5I6XB 5IEKB 1CIDA 2A6IA 1YYLL 1LP9E 5CJXC 3BPCA 1CGYA 3ARRA 1PQZA 4B50A 4PRPB 4HXBL 2AXJA 1K2DA 1P4BH 1ZHNA 3PWNA 1YPZB 3LSOA 5D5ME 1CGUA 4U1GB 1KT2A 1S7XA 2H2SD 3E6FA 4ODVH 1B90A 1AC0A 4UV7L 3ZHDA 5DD0H 4LDOB 1MELA 4TNWF 1A7RL 3PWJB 4M6OL 2ATKA 3QI9C 1MY7A 1UQSA 3MLVH 3O3UN 4GRWH 1FIEA 1EBPA 3EJJX 4TSAH 1WWCA 1PX3A 3OHXA 2BX5A 1OWWA 5I1HL 2Y23A 3WNPA 1J1PH 1ERNA 3HRPA 5I1DA 4MD0B 2I9TB 5T1KA 4LGRB 3GJFA 4Z0BH 4NQED 1D7FA 2KDGA 1QFUL 2DYPD 2VLJA 3FTGA 4N90D 3FRPG 3MRPB 2F54E 4FA8A 3BGFC 1Z9OA 4FABH 4LNRA 5B4MC 3FQWA 1N59B 3OPZL 1UM6H 2Z91A 3FN3A 3EHBD 1YY8B 5IMLB 1M1SA 3HUJE 2VLME 5AUMA 3UCRA 2ADFH 1MCDA 5IFHH 3QO0B 1NCBL 1I8LC 2NY7H 3QIBD 1YC8A 1QFWL 2BVQB 4IMKA 5DJXB 4CU6A 5K59F 2W38A 3RWJA 3V5KB 4S1SL 1IQWL 1CGTA 3OB0K 5AAMA 5K9QI 3UJJL 3ALPA 3IVKA 4RGNB 1C08B 3GMLA 1X4XA 3DWTA 4YO0B 3DVNA 1C5DA 4OUUA 3PXJA 3GSWB 3O6FA 2B0SL 5MERA 1JJUA 2EDJA 4M5YH 2FBJH 2BJMH 2ORBH 3G5XA 2EEBA 1DQDL 2PETA 2ZG3A 2DKMA 5KBNC 3SDXE 3DRTA 4OTXL 3DTXB 3QJFB 1NFKA 1WC7A 2WBKA 1MHCB 2NY1B 1AD9A 5TQ0H 5D2NE 5F7FA 4HX1B 3TIDB 4JFOB 4Q0XH 4XXCC 1UZ6E 3VWJB 2ZUTA 1MF2H 1EUTA 3MFFA 1OHQA 3FQRB 1XR8A 1HNFA 1RULL 1XGUA 1SMAA 3PE9A 1NCCH 1RHHB 2D9CA 2YPLD 3O9WC 3SCMB 5DEGA 3EJYC 1DBKL 4YBHA 1A22B 1YA5A 2FDBP 4WUUA 4AEIL 4JREB 3WS6A 3Q5OA 4YWGL 4AIXA 2F19H 1IEAA 2VQUA 4MWFA 4Z8FL 4WI4A 3WLBA 4U1KA 2C3XA 4WFHD 3IFNH 4IRZH 3CZJA 5B8CC 1K4DA 3D85D 4K3DH 4JZJB 1JPFA 4LF3B 5TF1L 1IC7H 1CQYA 1P7QA 35C8H 3MV11 1JZ7A 1MRCL 2P8LA 4L9LB 1TCRA 2H32B 4JN1H 1VFMA 1W0VA 3TIEA 5DWUL 5CJBA 5IB2B 2K1MA 5EORL 5KSVA 4GRWB 2IC2A 1XGQA 4HH9B 1NCUA 2FBOJ 2QSQA 3CPLA 1WTLA 3BJLA 3G6AB 2NY0B 2PXYC 3BQUA 1IGYB 3HC0B 5D7LB 3MV8B 3KG5A 1I8IB 4OKVA 4XC3L 3FQTA 1WSST 5DC9B 3T2OA 3T4YB 4NHUB 5E8NA 3O3DA 4PPTA 5D72L 3EOBB 4F9PA 4KKAC 5KZCD 2H2PC 4HMCA 4NWUH 4Y16C 4MA7H 1FYTB 5D7IB 3DMMA 4XBEH 1JIBA 1LO0L 2QQQA 5GZND 5IMKB 3GI8H 3WUWA 4BH7B 1DQJB 2QADD 5TE4L 2VLRE 4IRSD 1CR9L 3BKCL 5HHPB 4WI9A 2BHUA 4NO2A 2C3GA 2AABH 4H20L 4DVBA 5D1XC 5E4EC 1Z9MA 3K2MC 4OZFA 5DUBA 4O58H 3W5NA 2L7JA 3MV01 1ZE3C 3NFSH 2APVA 1AP2B 1EAPB 1LP9B 3D0LB 3LQAH 4MAUH 5EBLB 5FYLH 4WWID 3FB7B 1HHJA 3RNKA 5C0BA 2ZJSH 1CE1L 1NGPH 3H6JA 4LSTL 4TYUA 3C87A 5D5MB 5IW6B 1UA6H 4LCIH 2F8VA 1INEH 4WW2F 3IU3A 4KROD 1G7IB 5L7XL 1A6TA 4CNIA 3FZUC 3LKPB 4H88H 5IVNA 3PV7A 3KPQA 1TIUA 3QG6A 4JRXA 3DX9A 5FHBL 4PIRF 2BVOB 4HBQA 2GJ6D 4L1DA 1X4ZA 3G6DH 2YR3A 1KLGB 5AZ2L 4NQCD 3DUUA 2BOCB 1OGAE 1D5XB 4TNVF 1YNTB 4F7CA 5E4IA 3TT1H 3WSQL 2MCG1 2F54B 4OD2B 43C9A 3IXAA 5CIPH 1BQLH 2AJSH 1U6AL 4XP1H 3MLSL 4I9WD 2FL5A 1R3KB 4U1IA 4MQ7A 4RSVA 3MJ6A 5IB5A 2ICEA 1R3HB 3HUJB 2VYRE 1CD9B 2WM0A 3WNKA 3ARUA 3HPJA 3CFCL 1I7RB 4PD4J 2WP3T 4WI5A 2JKXA 3D6GA 4KUZH 3TNNA 4A6YL 5AG8A 3F12A 4U3CA 3QG7L 4GKZA 3MRHA 3C60C 4G7YH 4KRNA 2CGRL 3GM0A 5DHYA 3LQAC 4QRUA 5E9DD 3BFOA 1CXHA 5HI5D 1MCOL 4FZ8H 4HFWB 4PJBE 3KNBB 3FT4B 4WWKD 1TXKA 2EE9A 2X4OA 4EKXA 4TOYH 1A9BA 4Z7VA 3CZFA 5T3XL 3LS5L 4WCYL 3PF2A 2MQ3A 2V7NA 1ZA3B 4F80A 2Q6WA 4ZXBB 1FL5A 2P24A 3O11A 1U8LA 4IS6A 4R0LA 5BW7A 2FRGP 4IRJC 3SDXB 3TH2T 1T83C 2X89A 1NDGB 4NKOB 3HE7A 2FZ3B 4CADA 1HOCB 5ALBH 1QR1B 4OI7A 1JL8A 3W9EB 3BP4B 3DVIA 5D2NB 1FORH 5C09D 2GITB 1YN7B 4I4WB 5C9JB 1S5IL 1HH6B 3AM8C 2PTTB 2CLRB 5JOPD 3FHAA 3ZTJG 1I9JL 3H42L 1MJ8L 3JSSA 3GSXB 2BSSA 5EN2B 3HG1E 3SPVA 1JHTA 1KF9B 3TBYA 4PLKC 4J2XA 1DUZA 1QSFA 3MLZL 2FJFA 3V7MA 1AD0B 2X1WL 4Z7WE 3BDYH 1YJDH 2MFNA 3O2DH 4X0KB 3RAJH 2JLLA 2EXWD 1U3ZA 4MA1B 4JJHA 4JM4H 2QJDA 1U8NA 5SWSA 1L0YA 1XF5A 2P5WD 1PG7H 1F5WA 4ODVL 4GRLA 5IK3B 5GS0H 4QXUH 1U0QA 2DQHH 4FP8H 5AYUH 5HDLA 4S1DC 2FB4L 1HXYA 2YZ8A 3MBED 3MLVL 1IFHH 3DNKA 4H25B 3KJ4B 1S9WA 4NOFA 1ADQL 4Z0BL 3RHWF 4MXVE 4CBPA 4XNQA 4FABL 4ZPVB 4DW2H 2IGFH 4DJMA 2AJYH 1Y0LA 5EUOF 4LHUA 1MJ7H 3I75A 2Q87A 1XCQB 3BXNA 1U8OA 3WBDA 1WJ3A 3PWPE 4UNUA 2VERN 3QSKB 4S0TD 5CEXB 2ADFL 4PV8A 3QXUA 1QEWA 1WEJH 2ADJB 3Q1SH 3V4VH 3P9WB 3RVXC 1QBLH 5IFHL 4OGXL 2NY7L 4X5XA 3N9GH 1F02I 2V6HA 4R96B 1CDHA 1JWSB 4P46D 1YJDC 1AXTH 1M4KA 4GQ9H 5DURD 2NX5D 5B3JE 4PJ7A 5J1AA 2VLRB 1ZT1A 3TO2B 2FECL 4R90L 1CZ8H 3CFDB 3VGAC 1GVIA 3ECBA 4O4YH 1Q9OB 1AQKH 1I1FA 3D25B 1F2QA 1ZVHA 3SEPA 1PZUB 4M5YL 2ORBL 2BJML 2FBJL 4JHZA 5JW4N 1FL3A 1JGUH 5CZVH 3L1OH 1MCKA 4QYOB 4PRNB 1C12A 3I2CH 2FATH 3RVUD 2WWMD 1CDGA 2AK1H 2IANE 3DPBA 3G04B 3BH9A 3P4OA 2IMNA 3W82A 3IDJB 3QDAA 1J1OL 2WNGA 2VDMH 5GS1C 4QHNA 1YMHB 4P5TB 3C5JB 1NCCL 1JYNA 4MSWB 4JKKA 5D7JD 4PJ5E 1WAAA 2ESVD 4X6DF 1WQVT 1KPRA 2HMID 5I1IH 3LIZH 4RAVB 3W39B 3UTZB 2YPVH 3OAUH 1JUFB 4ZNCD 1BF2A 2EEAA 5IG7B 3EBAA 1OGAB 4ZS6D 2F19L 1U9KA 4FNLH 4KDVA 4FQQA 3BIBX 3EZJB 5B39B 3VH8B 1PD6A 1SYVA 3IFNL 2P47B 3QH3B 2YD4A 1UWXH 4IRZL 2IAMA 3ARGB 1C16A 3P4NB 2EC9T 4ZDHA 3NCFB 2R8SH 2B20A 2FX9H 2OTUA 1IC7L 3L3DA 2YD8A 1WFNA 4V1DE 3S5LA 3QIUD 1QQDB 1A1NA 1ZA6A 3NFPA 4JN1L 1TZHA 3MNWB 4YIQB 3M17A 1BX2B 3KYMB 5C08E 3K2UL 5KN5B 3DYPA 4X83A 1FNGA 3Q6GH 1W0WA 2FEEI 2WUCH 1S7UB 4IMLA 4ZYKA 4PJBB 3RI5F 2KUTA 1S7WB 1HEZB 1KEGH 2HA1A 4KK8D 3WO4C 2EECA 1PDKA 4ZOCA 3RGVC 3SDAB 1IGTB 5HI3D 4JJ5A 3CDFA 3FOLA 4E42B 3PP3H 4PJGA 1MLBB 4HIEA 5EO9A 4NZTH 1RUMH 3BZ4A 4AL8L 4HUXA 4XBEL 4POYA 2Y5EA 3O8XA 4CVWA 5F3BA 1FYHB 5CWSB 3KPSE 1IM9A 3GI8L 3JTSB 1ZVSA 1BVKB 1GPOH 5BXFA 3ARPA 3NIDE 4HJ0C 2X4PA 4U1SA 1I7TB 5EBMB 5CILH 4IIQA 5DT1H 2R1XA 2A9NH 5K9QG 2AABL 2NW3A 2K9UA 1I8MB 2EDWA 1OTSC 3HG1B 5E2UH 3I85A 2R0LH 4MQTB 4O58L 3GO1H 1M71B 1JFQH 3IJHA 1A4JB 2P8MA 5L0QC 3C09C 5F88A 1GC1H 2JTDA 3QIWB 4BSWB 4Z7WB 1IMHC 1BOGB 4P2OB 3LQAL 4MAUL 3RWFA 3RVTC 2XTJB 5FYLL 1CI5A 1WWAX 4APQB 5CGMA 2ZJSL 3WUWG 1NGPL 5EZJB 1XZ0A 1G84A 1UA6L 2BVPA 3ARFC 1INEL 1G7PB 4LCIL 5I9QB 4M7JH 4N5UA 15C8H 1MFBH 1QA9B 4JGMA 1T4KA 5E8DH 2VLKA 5GRVL 4H88L 3KXFA 1KENH 3QUKB 1FSKC 2I07A 3SDCA 4OZFG 2FJHB 4XMKH 5JXAL 4RNRB 4F2MB 3B9KD 3G6DL 4X4XB 4OFYA 3KDMA 4NO0D 3EGSB 5DZOA 2YA1A 1OGTB 4LSRH 1MWAH 5DQDH 3FAWA 2AV7A 4QOKA 3V8CA 2QHRL 3B5GA 2CK0H 4YHZH 3TT1L 1NCNA 2VB5A 3U30C 4OCMC 1BQLL 2AJSL 2HRPH 4XP1L 1PG7X 3UXFA 3UPAA 2X9WA 1CFSA 4M4RA 3WN5A 3RKPA 4JZOB 4PLJD 1NUNB 3WDHA 4KKCC 2ZCLH 3UYOD 3PWPB 1AGBB 2NTFB 2QV2A 4KUZL 2NW2A 4DEPB 2IH1A 4XXDB 5M94B 1CXEA 2BNQD 4G7YL 5E7FA 1J0ZA 3AUVA 1GYAA 3TA3D 1C5BH 3K7UA 3QDGA 4Y19E 1AGEA 5HYJD 1L6XA 4PGZA 4XCFH 3X17A 4FZ8L 4KRPD 4MJ6B 4S10A 3I6GB 3QUZB 3UBXI 1ZGLP 1JPTH 5T1LD 3MNVB 4TOYL 2OZ4A 4YXLH 3MROA 3FO9A 4BQCA 2XA3A 2H6PB 5ISZE 3KPNB 5A2LH 3M1BA 2BXZA 3H3BC 4LEXH 5JA8B 1OM3H 5F9AC 3P4LA 4HV8B 4LKXB 5EIIB 4OZIF 3U7AA 4X7EC 1CIUA 2CRIA 2X1XR 4J4PA 1A1MB 5ALBL 2IANB 1IGJA 5EU5A 1FORL 4FXGA 2A74A 3ARDB 4C83A 3RZWA 3T0WA 4JFYA 1SEQH 1WF5A 2NNAB 3VXQB 1U8MB 3MRLB 3UTTD 4ZUTB 4ZPTB 4NQXB 4PJ5B 3SE8H 1RK1B 2P49B 3MRIA 5A16A 3VXSE 2W92A 4YBQC 4X6EA 3ULUF 1SJHB 1OAUH 2WIMA 2VIRA 5EU4A 4KV5F 2EDFA 2AVGA 2EH7H 4G8GD 3KWWB 2VDKH 2V5SA 3BDYL 1YJDL 4J3OC 5ESQB 3RAJL 4D8PB 5L2JA 5EBWA 1DN0A 2KPNA 3NACL 1QBAA 3IJSA 4LCYB 1Q9LB 1AGCA 1QKZH 1PKOA 1ZHLA 4OCWH 3OF6D 4HK0B 1OB1A 4V1DB 5E8OA 3DO7B 5GS0L 4QXUL 2DQHL 1MFCH 1SBBA 4Z7NF 4FP8L 1DUYA 5AYUL 4L29B 4G80A 4JVWA 1IFHL 5C08B 2MQ0A 5EU6D 3OR6A 4ODBD 4C56E 2P5ED 2YC1B 5HPOA 3TPKA 4LSUH 5C0NC 3W11C 4YK4C 4URTB 3KYAA 4YHIB 2J8OA 1J05B 1ZTXL 1GOHA 3TM6A 3MUGB 5KW9H 1P7KB 3RTQB 1MCFA 2AJYL 3RZCA 3KLAA 2CUHA 1LO5B 1MJ7L 4YR6A 3UBXA 4JFDD 5I0ZA 3W81A 3Q5YA 1B3JA 4R97B 4LDEB 4OD1H 1KUMA 1F4AA 5IMOA 3FQNA 5JDSA 3Q1SL 3V4VL 1KNOA 1QBLL 5GHWH 3D39A 4B5EA 4UDTA 1LO4L 1T20A 2LTQC 3N9GL 2V2WB 1Q9WA 3G08A 2C1PB 3KPSB 3O9WD 3T0BA 1AXTL 2DLEA 2GKIA 4GQ9L 4GW1B 4P5MB 5AYQA 3S3SA 5JORB 3VXRE 1CBVH 1KXQE 2D7MA 1J8KA 5L2KE 5MI0B 5KVDH 4O4YL 2OP4H 1F6FB 1AQKL 4WDIB 4WW2A 1WGOA 1AXSB 5I8CA 4LHUG 3VRJB 1OAKH 2EDQA 4R4BB 4RCAA 1B0GA 2Z31C 4GG8A 5CZVL 2F15A 3L1OL 5F7WC 2BVTA 1CFVL 1P4LB 4ZFZB 4JN2B 3EFFB 1KXTB 2E8ZA 4U1HB 3I2CL 4X8XA 2FATL 4LAQH 1FL6B 5EOCJ 1A4KA 2AK1L 4DKEL 4HWEH 4Y5VB 4PRHD 5AAWA 1MAJA 3C5ZA 1FLRH 5KSAC 1NBVH 1CXLA 2DBJA 4HDIA 1QPPA 1I1RA 2VDML 1MHHB 1UXSA 5E1AB 2BCKA 4YPJA 2CIIA 1NGQH 4ONOA 1HQRA 2PXYD 1TVBB 5T33H 4O2EB 4XNMB 3LIZL 2WBJA 5I1IL 2NY4B 1FO0H 3V8OA 5DQJB 3BPLC 2YPVL 3OAUL 4YXHH 3PHQB 2VLJE 4FNLL 1NC4D 5IFJA 1RZKH 1H8NA 1Z5LA 2PTUA 4H1LA 5J11C 4PJCF 3V6ZB 4KKAD 4RMRA 5I71B 1LK2A 5SV3A 3B2VH 4HIJA 1IZJA 3REVA 2H2PD 3TZVA 1F2XK 1NEUA 2V5YA 3ZT6A 2R8SL 1I1CA 2FX9L 1ZT7A 3WFBH 2WINA 4D2NA 4KJYA 5HVHB 5F71A 4ZOBA 1XF3B 2HN7A 3GGWB 1NBQA 3BE1H 2DQDH 3AREC 4Y4HB 1D6EB 2CUIA 4M1GL 4LPXA 1WVZA 5EO1B 3ZE1F 2BK8A 3DIFB 3K80A 3Q6GL 1XAUA 5HHNA 4ODTL 4BYHA 4NRYA 2WUCL 2YS4A 4N1EA 1EIBA 3GSQA 4Y19B 5CZKA 4JRWA 4RAHA 4P4RA 5D1XD 5C0GA 3VDCA 4PJ8C 4R7NB 2RCSH 1KEGL 1F6LL 4X9GA 3NIGF 1KTRL 4WO4B 2OI9B 5ISZB 3QEUB 3U4EA 3SGJC 3CVHB 2EDXA 4MCYA 3S5LG 3T04D 1JNLH 3SJVE 2VDRL 3QWRD 2W0FB 1AIFA 4NZTL 3WV0A 3QEGH 2O5ZH 5BS0D 4IOIB 3FZUD 1NMBH 1RZKC 3OKEA 4NGHH 1PVHA 1AI1H 2BY2A 1WCBB 1NLBH 1G7LB 1GPOL 4PJ9A 1J7VR 1FQ9C 1BFTA 5CILL 2O93L 5E8PB 5DT1L 4J3SA 2A9NL 2CDEB 4WEMB 3VXSB 5CKGA 4WUUE 5ICZA 1WBYA 5I2IB 3LD8B 2R0LL 3GO1L 1QRND 5FO8A 4XP5H 4EXKA 4KTEH 4QHUA 1I85A 5FF6A 3QQ4A 5HHMD 4TVPE 5MP6H 4K7PH 3FB5A 4KVCH 1HHHA 3MLRL 1RJLA 4M7JL 4J3VA 4WW1A 15C8L 1MFBL 1IJ9A 4ENEC 5TFSL 5FYLD 1T89C 5EUOA 1KENL 4HT1H 2UUDH 4GQPH 1YDPB 4XMKL 2B4CC 2VE6B 3T2NH 5FM8A 5J6GB 1FFPA 5DQ9B 4C56B 4LSRL 1MWAL 5DQDL 4K3JH 2JIXD 1R3JA 4P2RA 3MCKA 1R5WA 5JHDA 2WWKT 1ZANH 2CQVA 4E5XB 2HRPL 1UG9A 2J7LA 1SY6H 2NY6B 4UUJA 3ZO0A 4L8CB 5GGTH 2UYLA 3VDAA 4FZEH 2I24N 2ZCLL 5D1ZC 5MEOA 3SDYH 3T0AA 3AS3A 4F7MB 2ZUQB 2DMBA 2WIIA 3UTQA 2PKDA 3KPPA 4GMTH 5DJ6B 5D6DA 3QXTA 4PJIA 1FNHA 2A6JA 1NUFA 4PV9A 5DLMH 1BBJB 4XCFL 3VXRB 1V3KA 3KYNA 1CDCA 1JPTL 4PLKD 4ODHH 5L2KB 1VKXA 1LEKB 3PWVA 4YXLL 1NGZB 3KPRA 2VXVH 4MNQE 4LEXL 3WIHH 1OM3L 3MRQB 4CDGC 3RQ3A 2A6IB 2PW2B 3BP7B 3VFSB 1PQZB 5C0BE 1RK0A 4RIRA 3QJHB 3P0YH 1T80A 5ID0B 1I4FA 2PYFA 3LVEA 4PG9A 1ZHNB 3PWNB 3WFEL 3LSOB 3DGGB 4S1DD 3E6FB 1I3VA 3WJLC 3O4LA 4QRQB 4JRXE 1SEQL 1FG9C 5DJDB 3QEQA 2ATKB 3SE8L 2DQFA 5E94A 3OHXB 4AY0A 2D0GA 2ED8A 4NKIH 1A6AB 4HHAB 1OAUL 4NZUL 4L3AA 5I75C 3S9DB 2VLJB 3HI1B 1AHWC 3VU2A 2EH7L 3OSKA 2C4FU 4JHWH 1U95A 1PJ9A 4LNRB 3WIFB 2B39A 1QFWM 3EYQD 3VFPB 2ZNXA 3RVXD 5I1EH 3DHJA 3U6RB 3QUXB 2O61A 4LSQH 4O2FA 5FA4B 1U8PA 4XPFL 2OL3B 3D9AH 2X40A 4F58H 1MFCL 4MD5A 3QNYB 3FAXA 2AJZA 3C6LB 4Y4KA 3LN4A 4H0HB 3RWJB 1E27B 4JDVB 1UKQA 2R2BA 5L9DH 2NLJA 4LSUL 4Y1AA 1J8HD 4EN3A 4KK6C 3HN3A 4ZAKB 4Z7VE 5KW9L 3VCLA 3O6FB 2XQYG 5MERB 4L3EA 1H3VA 1INQA 1J0YA 1UH3A 5DVKA 1FAKT 2ENSA 4HUWA 2Q3ZA 2HFTA 1MCCA 1SYSB 1B2WH 2X4QA 4OD1L 1KIQB 4PJDF 3SJVB 1BGXH 3U0WH 1D5ZA 3DRTB 4OCYH 1K3IA 4UU9A 1K6QH 2EEDA 5DYOA 1WC7B 1FLTX 1IAIH 4U6YB 5GHWL 4R9HA 2EYTB 2O5YL 1AD9B 3PIQB 3HS0A 3T09A 5JQHC 4R7DA 4HWBH 4H5SB 5F1NB 5GSVA 2HP4A 4J7RA 4FRWA 4DAGH 1D5IH 2W60A 1CBVL 4X4YB 2YD9A 3I02B 4EVNA 1A6UH 2I25N 2OP4L 3PV6A 5DEGB 2RR3A 4EDWH 5IOPA 4GKSB 4WFGE 1OAKL 4KGJA 3UBXG 4WUUB 3A6BL 5H94B 3DV6B 2CMRH 4KY1L 5IT2H 4DGVL 5C92A 3GI9H 3LPWA 5M7QA 1IEAB 4MWFB 3HNVH 3WLBB 4U1KB 3QPXH 2AV1B 1EZVY 2ADIB 2FR4B 2OLDA 5SWSE 4N0FA 4YHNA 3W0WA 4LRIC 3OKLA 4PD4K 1S9VB 4OQTH 4ZNEA 4I18C 1KB5A 1PY4A 2OBGA 1T5WB 4M61A 5F96H 1FLRL 4ETQA 5ETUB 1NBVL 3HAEH 4WHYH 4GH7B 1HINH 1OLZA 1W0VB 3TIEB 4BQBA 2I26N 4XNXH 5HHOA 1NGQL 2OXGA 4NQSA 4P9HH 4XNUL 3HC3H 1BQHA 5T33L 1XGQB 2HYMA 1FO0L 3EJZC 3RGVD 1VFOA 4YXHL 5SX5H 2CKBL 1RZKL 4OKVB 3FQTB 4K7PX 2VRAA 5A2FA 5F7KC 3B2VL 5C0CD 1UCBH 4JFQA 1QLEH 3O3DB 3HE6C 4I0PA 1S5HB 1K8IB 3WFBL 3FONA 3S36H 3GUTA 3ILQC 5F9OH 3F62A 1XIWC 1ZAGA 4XC1H 1IGFH 3BX7C 2W59A 3DMMB 4L8SB 5D71L 1UM5H 3BE1L 1VEOA 3UROR 4ZFOA 2DQDL 1MJJA 3GMOA 1ZLUH 4HJ0D 3U4BH 2VC2H 4NC1C 1C7SA 4G6FB 4LOUC 3T0EA 3WUWB 3ZE2F 3VFOA 4OZIA 4QRPE 4H1LG 1OTSD 1EFXD 3H3PH 2UZYB 4CJ1A 1T04A 4NO2B 4K7FB 2WAHA 4KI5E 1KJ2B 4GRWF 5MHSE 1P1ZA 4E41E 1VPOH 3ZDXE 4JPKL 4OZFB 5DUBB 3B2UD 3RVTD 2OSLB 4BK4A 5DVMA 5DJZA 5IJKA 2YD3A 4XHQA 4MNQB 1E28A 4P9HC 3MREB 4QRTB 3TEUA 1M7DA 4Q97A 2C9AA 2B4CL 3RNKB 3ARFD 5C0BB 5C6WH 25C8H 1T2JA 2E8YA 2VDNL 4GXVH 4UDUA 3QEGL 2O5ZL 4P23C 2OR7A 2XNAB 1NMBL 3P77A 1FFNA 3IU3B 4NGHL 1AI1L 1ACZA 1BD2D 1A6TB 4CNIB 5TJWK 5BCAA 2XWJB 4JRYD 3KPQB 4JRXB 1CYGA 3DX9B 2VSDA 3H9SD 3RWCB 3X13B 4B0MM 1AE6L 1T6VN 2OTPA 4JAMB 2FX7L 4G7VH 5IHUL 4NYLB 1IBGH 3ARXA 4FTVE 2HT3C 1XH3B 4YBLB 3DUUB 3VFNB 4U6HA 2ITCB 2VQ1B 3S37H 1MFEH 4KTEL 4PB0H 4X9FA 2GJ6A 4BH8B 5JW5A 2PO6D 4AZ8A 4KKCD 3MOBH 4OM0H 4JG0H 3QO1B 4NQCA 4MJID 5MP6L 4K7PL 2YKLH 1MCLA 4U1IB 4KVCL 4MQ7B 1Q8MA 3QEHB 2GIYA 5I8KH 1BJMA 3MXWL 3PGCB 4X7SL 2J3SA 7FABL 4DN4L 3F12B 1R3LB 1IVLA 4HT1L 5DXWA 4GKZB 5ICXA 2Z4QA 5F6IB 1IQDB 3MRHB 2G5BA 2OCFD 5EBGA 3AY4C 5DHYB 3VFUA 4ELMA 3ARZA 4QRUB 2C3HA 5BO1L 3PHOA 3T2NL 5HTSA 4KKBC 2DTMH 2OK0H 1HSBB 1SMOA 4F9LC 1GGTA 1T66C 4K3JL 3LN5B 1W8NA 3IFPA 5MEND 2E9JA 4Z7VB 3CZFB 1ZSDA 3LKQB 1ZANL 3NAAH 3KHOA 2IPKA 5E9DA 3ZL4H 4F7PA 4OZ4B 3RWIA 2V7NB 3EFDL 4JPWH 2R69H 4NNPH 4WWKA 5GGTL 4FZEL 2EDOA 4PJAF 4IS6B 4JQIH 3V6OE 3VRIB 1CTNA 4HCRA 1T7VA 3MSPA 3ZDYE 5JLZA 3SDYL 2DQIH 4CADB 1FPTL 4NKDA 1NAML 3I6LD 5CUSH 1I3RA 5JUEH 3D5OF 4GMTL 2NXYB 3HUJF 2YA2A 4J1UA 1F97A 5DLML 2R0ZH 4YBQD 1TETH 2CLVA 3EYSH 4QF1A 3SKMA 2FNBA 1T1ZB 4OIIL 3D3VA 1ED3A 3T2QA 5JPMA 1QFWI 1OSZA 4GMSH 4MNHA 1P84J 2FGWH 3N1FC 3O6MH 3TBYB 3OKYA 4JPVH 4PUBH 3MXVH 3CFKA 4LPCA 3WIHL 1SBSL 4GUPA 4UI2A 5F1OB 4Z6AT 3BPNB 4GAYA 2X4UB 3LZFH 5SWSB 1U8NB 1J86A 2VN7A 4WU7A 4JFFD 4P48A 4P3CL 3F5WB 4MQXC 1MFAH 4EI5C 2H8PA 1UCTA 2IALB 3SDDA 3U83A 4BA8A 2VLKE 4GRLB 4M1CC 2F58H 4PJCA 5GGUA 4CVUA 3KXFE 4Y8DC 5GGSA 5EFIA 2CKNA 3TVMA 3QP3A 5HJ3B 3MV9A 1EO7A 3DGCR 5C0ND 4M7LL 3W11D 1RUPH 4NKIL 1KV3A 4Z76A 2ADGA 1XCTA 5IB1A 4LLAA 5DDHA 2DQTH 1MUJA 3S8WA 3VD3A 1ONQA 2LQRA 4Y4FC 3PXHA 4XCYA 1KFAL 1XGRA 2VL4A 3DUSA 4JHWL 4Q6IC 1BQUA 5K59E 1G9NH 3PWUA 1Y0LB 1X5LA 5CEZD 2ZPKH 1VADA 3I75B 3CFBA 5F7DA 3L3HA 5I1EL 3ARBA 4XNZB 4LSQL 5I0DA 4LIQE 1MVUA 1TZIA 3D9AL 3QNZB 1UH4A 1QEWB 4F58L 4HIIB 5M95B 2YEZA 3GJEA 1QOKA 4X5XB 5A2JH 3MJ8B 3F65A 4ZS7L 1OP5H 4NCC2 4HLZH 5J1AB 2YD7A 3ZSTA 4QRPB 2CDFA 3RWGB 5L9DL 1T1WB 4JFZH 3ECBB 4HJJH 3U79A 1A9EA 1RZJH 2Z31D 4ZUVA 1N5AA 3V0VA 4CVXA 4NNYB 4IBLT 5CEYA 2GTWA 3LEXA 4E41B 3K74B 5JIKA 1V5JA 3MODL 3P0VL 5C07E 1E0OB 3CU1A 2R0KH 1DANU 1B2WL 1IKNC 2E7LC 1BGXL 1M7IA 4OCYL 4YJZL 5IESH 1CFNA 3OKDA 1IAIL 5F1KC 5KSAD 4RWYL 3CFJA 3DROA 2ZG1A 3UZEA 4MXQC 4HK3J 3JUYA 4HWBL 5CCKH 3NN8A 2N7BA 2FO4B 1FBIH 4QHNB 1TTUA 1D5IL 4MZ3A 4BSVB 4N9GB 4M5ZH 3BZFA 1G6RA 1A6UL 2IBZY 1ZLSH 1G9MH 4JO4H 1BWMA 1VESA 2C7UA 4FTVB 1TVHB 3CSGA 4MDJA 4HKBA 5IT2L 4CGTA 4MA3B 5I8EA 3GI9L 1I1YB 2Y7QA 2ESVA 4FQQB 2HJLA 3HNVL 3QT2A 5FDWA 3E2HC 3KYOA 1SYVB 1RAMA 4CVZA 1H15A 3ESUF 1HYRC 2IAMB 1GIGH 1S78C 4NQVA 1C16B 4Q2ZA 4DKAA 1REIA 4OQTL 3SE3A 4JM2D 4OLZH 3LEYH 4M03A 3OXSB 4F8TA 4XZUA 3ARED 5F96L 4KMQA 3LS4H 1A1NB 3NFPB 3O45A 2CPCA 1MIEH 5I1KH 4XWOD 2EDTA 5EC1A 4XNXL 4WHDA 5E8EB 4P9HL 1HQ4B 4PJ8D 1IM3B 1W0WB 3S37X 5IF0A 1ZLWH 4JZNA 3UDWC 3C2SA 4HSQA 3TNMA 3WCYA 4POZC 1KJMA 3FJTA 4KQ4H 4XH2A 1CL7I 4FQIH 4QHLA 1WZMA 3R06B 3QDME 2XTJC 4JJ5B 1UCBL 1QLEL 1QVOA 3S36L 2ZUWA 5F9OL 4XC1L 1IGFL 1EEQA 12E8L 2W65B 3LQZA 1UM5L 1BQHG 43CAB 3WE6A 3O8XB 2YK1L 1XF4A 3U4BL 5F3BB 2HTLC 3TO4C 1FGNH 2ERJC 2CXKA 2ZNWA 5BXFB 5BV7B 1NKRA 4NSKA 3DYOA 5LJYH 1BFSA 3QWQB 4ODXA 3U46B 5K9OB 2FWOA 4R2GC 2D31B 3H3PL 2R1XB 3VXTA 4C4KT 4X5LA 2C1OB 1DVFB 2H41A 3STZB 2A6KA 5BZDA 1VPOL 1KN2H 1T0MA 2EICA 4XVTH 2IWGA 3NCJH 4PJBF 1IGCH 2P8MB 3L5XL 5INDA 5CSZA 3QRFM 3UJIH 3IDGA 3ZT5A 5FIEA 1KPUA 3VI3F 5KAQG 4GXVL 3GMNA 3JV4B 4ENED 1PG7W 1S8DA 1XZ0B 4DEPC 1A3RH 3DX7B 1FRGH 4MAYC 32C2A 3JV6B 5LXGH 5HDOA 2AJUH 1KCVH 1T4KB 4HWZB 2VLKB 1NJ9A 3CFEA 3KXFB 5HGHA 1M7XA 4MJ2A 2I07B 3SDCB 5IEKA 2X41A 4OLYH 3MRFB 3QCUH 4G7VL 3NMEA 3QAZC 5DMJB 1KCKA 3R0NA 5GJTH 1IBGL 5JW3H 3EKCA 3QB7C 4PRPA 4HEME 4P4KD 2R2HA 1B6UA 2ZOLB 4GAGL 3S37L 4D3CH 1YPZA 3AS1A 4PB0L 1AFVH 3TT3H 4GLRH 1CTOA 3IGAA 4OM0L 4JG0L 4NO0A 2QQKH 2XWTB 4NRXB 3BUTA 3LDBB 2YKLL 1CFSB 3WN5B 3GJFK 4Z7WF 4ZD3H 5GGSY 5I8KL 2HTKC 4LARH 3BD3A 3UZVB 2NW2B 2I9TA 3JV5A 4FN0A 3VWKC 1BJ1J 1N7MH 4BK5A 3MRPA 3T1FB 1A6ZB 4PJDA 3EO1A 2DTML 2OK0L 1JHKH 1F42A 2VKWA 4Q9QL 2BNQA 1J0HA 1DEDA 3TN0B 4I0CC 4XT1C 4LFHD 4O9HH 2WQRA 3MJ7B 1JYWA 3FO9B 3TA3A 2A2QT 3ARYA 1HHIA 1NEZB 3QFJE 4P9MH 4JPWL 2R69L 4NNPL 4OFKA 4A6YA 1AR1D 1J11A 2BVQA 5C07B 3K4AA 5DJXA 4HLJA 4DQOL 1JK8A 4K71B 3Q0HA 4P99A 2DQIL 2CLZA 2J88H 5L6YH 2Q1EA 4U31A 1IGJB 1BZ7A 4LSDA 5ACZB 1DBJH 4UIKL 5EU5B 5JUEL 4ONHA 1C08A 1G7JA 4FXGB 3HZVB 4ZUWA 3DI2B 4YO0A 3UYRL 4JQVA 4C83B 3GSWA 2ZSWB 2R0ZL 1OF2A 1E4KC 1TETL 2APTA 3EYSL 5A1AA 4NJAH 3SQOH 4OF5A 1HCFX 2X44D 3MRIB 2W9EH 3QI9A 3DTXA 3QJFA 4GBXC 4O2CB 3V9FA 1A2YB 2OX5A 3O6ML 4JPVL 2VIRB 3MXVL 1A7BA 1OP3K 1MHCA 2GTZA 4JCMA 5DVLA 3FFDA 2FECI 5FYJE 4LPUA 3ME0A 4HX1A 4KC3B 4JFOA 3TIDA 3VWJA 5DK0B 3VG0H 3LZFL 3FQRA 3ZLQC 4DN3H 3IJSB 1S9KC 2DOCA 1LD9A 1RHHA 3AMLA 1RJZA 3SCMA 1OB1B 5E8OB 5J1SC 2F58L 5EUOE 1DUYB 3GMQA 4I3RH 3F8UB 4G80B 1U93A 5CMAB 5MI0C 1I8LA 2Y36L 3NIFF 4KK6D 3ZKNC 1RUPL 1UXWA 3V95A 2UWEF 3QDJD 2NZIA 5BQ7A 4NO5B 2DQTL 1M05B 4JZJA 3MV7E 3BP5B 3DUHA 4BM7A 3NBNA 5JHDE 1DEEA 1G9NL 1H9VA 3NCMA 3QDMB 1YEEH 2E9BA 1GSMA 5IVZB 3RZCB 2P5EA 3UBXB 4OD3H 1VDGA 5JTWA 3C9NB 4KMTH 4KXZH 3KR3H 4ODUA 4WI3A 4DGYH 1OW0C 1RZFH 1KNOB 2AEQH 2EXYD 3G6AA 5D7LA 3MV8A 3G08B 1I8IA 1N2RB 1W72H 3M07A 5C0AD 4MLIA 4XXCA 2KZWA 3C5SB 4JY6B 4HJJL 1KIUA 1RZJL 2VDLH 4WW2B 4DKFH 4TTDC 3N85H 5I8CB 3O9WA 1ETZB 1B0GB 1FYTA 4XCCH 1WICA 3O0RL 5F7YC 4X6DE 4EIGB 2YUXA 1K5NA 4BH7A 1DQJA 4J6RH 1E4WL 4ZTPL 4QRRD 2D9QB 2AXFB 1A4KB 5IESL 4N0CC 4Y2DB 5B8CA 1IGIL 2UZIH 3NPZB 5C0DA 3G9AB 4Z0XA 3MMEB 4F57L 5D7KD 2D3VA 4X7TA 2NY3C 2CIIB 2XV6B 1EHLL 1HQRB 4ODSH 1I1AB 3P30H 3QQ3B 4ONGH 4PRHA 4JO4L 1G1CA 2WBJB 4XVUC 1CG9B 3FB7A 4HUVB 1D9KC 3CVIH 4Z5RB 3HZKA 1MCPL 2XZCH 5IFJB 1Z5LB 2VKXA 5IW6A 3LV3A 2HFEA 2PXYA 3HE6D 4KVNH 1LK2B 1JRHH 3ILQD 1XIWD 3P3YA 1GIGL 2OQJB 4NQEE 5IV2B 2IPTH 1GGBL 1AY1H 5D1QB 1ZLVH 3O2WH 4OLZL 1V7NH 1ZT7B 2WINB 1X44A 3LEYL 2BNRD 4YHOL 2BVOA 4KJYB 2XG4A 2ICES 3LS4L 5KSUB 3GKWH 4XI5C 4LOUD 2AKRA 4Y0GA 3MRNA 1MIEL 5I1KL 2BERA 1PY9A 4Y16A 1D5XA 4U6VH 4PJAA 2F54A 3BVNA 1JWUB 3FFCD 2ZWLT 4G8FB 1P5VA 4Y1AE 5F1IB 3MGAA 1RZIB 4HF5H 3G6JF 1X6NA 3RDTB 4Q9BA 1T0PB 4FQIL 3HUJA 4L3EE 3BKYH 3QUYB 1ZEAH 1I7RA 3ZYJA 1Q94A 3QFJB 1KSRA 4Z77A 1SJVA 4P23D 3GDBA 1TITA 4XRCB 1QUNA 3AROA 1AIFB 1PAMA 4ZG1A 4HFWA 2HJFB 3KNBA 4OSUL 3FT4A 3OKEB 4WI6A 4D9LH 5T1MA 3ELAT 5JOEA 1IAOB 1BIIB 3CCHA 4PJ9B 4N8PA 1Q9KB 2HT3D 1CFTB 3U0TB 2J4WL 5A40E 5LGHH 5E2TH 1NDGA 1KN2L 4LP4A 2GFBB 4NKOA 4ZXBD 2E7CA 4XVTL 2FZ3A 5FO8B 1HOCA 1IGCL 5BMFH 2YPLE 1QR1A 2NQCA 3W9EA 3BP4A 3UJIL 5FF6B 1N0LA 4I4WA 4RA0C 2A77L 2HVKB 3VFGH 1JGVH 4ZNEE 2PTTA 5F8QC 2CLRA 1HHHB 1A3RL 3GZKA 4WW1B 4UQ2A 4LSVH 3OX8B 5LXGL 4WFHE 2AJUL 1KCVL 2AJXH 5EN2A 1A21A 1CDYA 3E3QC 4XB7A 5EUOB 5HHOE 3MOQA 3WNNA 4OLYL 2P1YA 3QCUL 1T66D 3C60A 2VABB 2XY1A 3RL1B 1FFPB 5KG9A 3BUYA 4JO3H 4XPBL 1HILB 1VFUA 5DA0B 4D3CL 5LCVH 1ZXQA 3MV7B 1SEBB 5JHDB 3TT3L 2XZQH 5IK3A 1FGVH 3RWDA 2QQKL 2AERT 1VSCA 4NT6A 1WK0A 1WIUA 1X5ZA 3D2UD 1B4RA 3UTSD 4LARL 1CLZH 3T77B 2EIEA 3H8NA 2BSTB 3LY6A 3CK0L 4W81A 1MCRA 2VDOH 1WITA 4IRJA 1T83A 1U3HC 4DUVA 4U1LA 2WIIB 2IJ0C 2I9LA 1CVRA 4PGEA 4GSDH 4OZIE 4PV9B 4ZPVA 1ND0A 1JHKL 2F53D 4X4ME 1J88A 1JI1A 1BVZA 3OJDB 2YXFA 3KYNB 4PFEA 4X4ZA 1XCQA 2QQNL 3WHE0 3AM8A 3N1QC 4O9HL 3W2DH 3P11H 5CEXA 1R5VA 1YEFH 2OR8A 2ADJA 3EHBC 1LEIB 4P9ML 3VMPA 4JQXC 3I50L 4HS6A 4X6DB 4DFIA 5JW4M 2GUOA 1RK0B 4RIRB 3HMXL 4EI5D 2KH2B 2PYFB 2NMSA 4M1CD 2J88L 3TO2A 4NJ9H 4KV5E 4H8WH 1X5HA 3QUML 1DBJL 1Q9OA 1YQ2A 4U2ZA 3CMOL 3JVGA 5L88H 2VO5A 1OLLA 3K8MA 4NJAL 3SQOL 4NNXA 5CHNA 1FG2B 1S3KH 5E94B 5IMMB 4Y4FD 3PL6C 2W9EL 4PRNA 5J12C 3VG9C 3VD9A 2R4RH 4MZ2A 1KIPB 4Y5YC 3NCEB 5LGJA 4RBPH 3W9DA 3G04A 4KAQL 5DZNA 3WDJA 3V52H 3DECA 3L5WB 2GJ6E 1CN4A 4NQCE 4M3KB 3VG0L 2ICWJ 1PFCA 4NQEB 3C5JA 2DYPB 5J3HC 2G9HA 1BWWA 3HRZB 4RAVA 3W39A 3UTZA 1JUFA 1UVQB 1CICC 4I3RL 1MRFH 4JKMA 5IG7A 3EYVB 4AENB 5JQ6H 1OGAA 4Y4KB 5DS8A 5FYJU 3WFHA 3LN4B 4W4OA 3K3QA 3SE9H 1S7VB 3VH8A 1JTTA 2R2BB 2VAJA 3PDDA 3O2DA 3WS6C 1DCLA 3VXUD 5GS2H 4H8WC 3ARGA 4Y1AB 1D5BB 3P4NA 3QIBB 4EN3B 4HH8A 3NFNA 4Y7MA 4S1QH 1Z3GH 2ITDB 5E9DE 3VCLB 4HPOL 4GKNB 4L3EB 4P2CG 5FYKH 2YUVA 4M6ML 4YIQA 3WFZA 4DFHA 1BX2A 4OD3L 3KYMA 1NFIB 2X4QB 1T2QH 2NY2C 3OQ3B 3IU4L 3OKNB 4KMTL 3KR3L 4MXQD 5DYOB 4DGYL 1RZFL 1S7UA 2AEQL 4PJEF 4KJWC 1EHXA 4PJBA 5AEAA 2EDRA 4N5EC 4D0DA 4R7DB 1NH6A 3SDAA 5IM7A 1IGTA 1W72L 2R29H 4O00A 3ARSA 1EHAA 3BJ91 2IQAA 2W60B 4KMLB 4CRPA 3BQUC 5GS1A 3PV6B 4MX7A 3D3VE 2VDLL 4E42A 4DKFL 3U2SA 2ZUYA 5DJAB 5IOPB 2D4FA 3KHQA 1MLBA 2J5LC 2AS5M 2B7DT 1AKJA 3TBTA 1N4XH 4DK3A 4XCCL 5JOPE 3G5ZA 4D0CA 2YPLB 5JXEA 1S78D 5CWSA 4Y5XC 4RFEA 1EFQA 4F9PC 4J6RL 1CGVA 4N0FB 2VN4A 3OKLB 4QRSA 5I1JH 1KB5B 5GGVH 1KEMH 1MH5B 4TNWK 2UZIL 3NPSB 3QCTL 1BREA 4ETQB 4IRSC 2Q7NA 3AGVA 4PBXA 5FK9B 2RBLA 3HG1A 5ANME 4QTIH 4YE4H 5EA0H 5HHOB 1M71A 3D85B 3U9PH 1DBMH 2RB8A 1CFBA 2CD0A 3P30L 4ONGL 3QIWA 4BSWA 4Z7WA 4XMLL 4P2OA 3ET9F 4POZD 4APQA 2XTJD 1EUUA 1WZLA 3H2WA 2BP3A 4MJ5A 2XZCL 4M7ZB 1G7PA 3FCTB 4KVNL 5E00A 5I66B 2J2ZA 1QA9A 1JRHL 4XPHL 5CP3H 5GSRA 3CSPA 1RVFH 2OR9H 4U1MA 4O51A 4X6BB 4M4PA 1AY1L 3O2WL 2EDLA 1V7NL 3DJ9A 3S6CA 4U49A 3GUTB 4LSSH 3NIGE 3NCYP 2FJHA 1FVDA 1AXIB 3GB7B 2HTLD 3GKWL 3TO4D 1NGWA 3EGSA 1YMMA 4ZFOB 3GMOB 1I3UA 2DAVA 1RFDH 4U6VL 4R2GD 4J23A 4LKCA 5KZCB 3VFOB 4OZIB 4OI8A 3HPLA 4J3TA 1P84K 2BSRB 4HF5L 1T04B 4AK1A 5HHQA 4JZOA 4K23H 4LDLB 3PWPA 4WNQB 1AGBA 1P1ZB 2QADB 1QBBA 1ZEAL 5F21B 1T22B 5DJZB 1TJIL 5HYSA 1M7DB 4OIAA 1Q1JH 4MAYD 4UDUB 2Q86B 4BZ2H 2GT9A 4NQTA 4PJHE 3I6GA 3P77B 4YDLB 3SGKA 4D9LL 1KCRL 2RIKA 3MNVA 4OGAD 1EDQA 4PRBB 1H3GA 3VXMD 5ESVA 4R8WH 2H6PA 4FQJH 1MAKA 4JPIB 4JGUA 4RMVA 4FQHB 3UPRA 3HI6H 4JFED 4DTGH 3L7EA 1YYLH 3CLEH 4HV8A 4LKXA 1NMCC 4KROB 4NN6C 4HXBH 5E2TL 1O7SA 4U6HB 4OI9A 4D94A 2FX8H 3TGXA 2HVJB 2ESVE 4FS0A 3RKDC 5BMFL 3CLFH 3NZ8A 1FE8H 3QPQC 2GJ6B 4LVOC 5DHVB 4OF7A 5CKAA 2PR4L 4R0LC 4UV7H 2IAND 2VAAB 4HD9A 2HKFH 4NQCB 4NFCA 2HTKD 1VCAA 2EDEA 2NNAA 1JGVL 3HE7C 1ES0B 5LAXA 3VFGL 3VXQA 1U8MA 1I7UB 2GYSA 2JB6A 4ZUTA 3ARDD 4ZPTA 5F7UA 4PJ5A 4U7SA 3VWKD 1GGCL 2UVFA 1ZHKA 5DJ0A 4YHKH 4LSVL 2XWBB 2DJSA 3MC0A 2AJXL 1CXKA 1HIMH 1QR4A 2G5BB 2R23A 1EX0A 1TZGH 3PHOB 4CMMB 1PBYA 5ESQA 3EDFA 4JO3L 4NBZB 5J13C 2R2CA 3B9EA 4OFVA 3O3BA 4LCUB 3GIVA 1R24A 5LCVL 3IFPB 1ZSDB 4HK0A 1R0AL 5E9DB 2XZQL 4V1DA 4GAFB 1FGVL 1ZS8B 3EOTH 1AJ7H 1W8OA 2E3VA 4FG6C 4WWKB 3QXAB 5JMRA 4K8RH 5C08A 1BF8A 5MENA 5C8JA 2HLAA 4S1SH 5JLZB 4UAOB 3MBEC 3OJVC 2VDOL 5HBBA 2YC1A 3ZKXC 3UJJH 1KG0B 3CDGA 3B83A 5JO5A 1XGPA 2DJ4A 3CUPB 4YHIA 4JY4A 3MUGA 4GSDL 4J1UB 3JV0A 1F8TH 1P7KA 1WFOA 1FCCA 3MJ9A 3WXWH 2ICWB 2CLVB 3DRQB 4QF1B 3SKMB 4XBPB 3HZMB 1P2CB 5KTEL 4ELKA 3D3VB 3W2DL 1ED3B 5JPMB 4MNHB 5HYQB 3P11L 1ZV5A 1YEFL 4NCC1 4LLQA 4TPRH 2HG5B 5F7MC 3ROLA 2V2WA 1N6UA 1KN4L 3OMZA 2AQ3A 2KQNA 1XT5A 3T8XB 1BFOA 4P5MA 4Z7UE 3KPSD 4NJ9L 4H8WL 2EC8A 4OJFL 4BFEA 1BVLA 2H8PB 4WDIA 5FDYA 1AXSA 2Z92A 5CBEA 1HE7A 5GGUB 4AEIH 5GGSB 5EFIB 3ZKND 5L88L 2LU4A 5F9JA 5ANMB 3TVMB 3B9VA 3GEWB 2R2EB 5I73C 1U8KA 5GRJL 1OY3B 4K8RC 1P4LA 4ZFZA 4JN2A 5DVOA 4ZUSB 3SOBH 4TNVK 1HH9B 5FUCE 1GJIA 2R4RL 2ADGB 5JW4Q 1FL6A 3K0WA 4DZBB 5JZ7C 4ZO8A 1ONQB 3H9ZA 4U7KA 5ACLA 5TF1H 4XCYB 1LO3L 1XGRB 3V52L 3VFMA 4KGLA 1JPST 4TUKH 4ZSOA 4KHTH 5DRZA 2DD8H 3PWUB 5ENWB 4Z7OE 5DMGC 2DWEA 2ZG2A 5E1AA 1KGCD 1CGSL 5F7DB 5DWUH 3L3HB 5GJSH 3QNXA 3G6JA 1QG3A 3RWEB 1TVBA 2M2DA 1TZIB 4XNMA 2LV4A 1TJGH 1RHFA 1NC2D 5CINH 1MRFL 3GJEB 3AU1A 5JQ6L 1DDHB 1EBAA 3UTPD 2ZUVA 1JWMB 4FQ1L 3RBGA 4PJDE 2ZOKA 3SE9L 4TTDD 3V6ZA 3ULVC 3IDMB 3KPTA 4TVSa 4WEUD 2CDFB 5LGKA 2F8OA 2BNQE 1QHPA 1FH5H 2HLFC 5DRXB 2V17L 3O2VL 3EOAB 4S1QL 4P46B 5JNYA 2H26A 3BEVA 1IAIM 2WV3A 5CEYB 5HYJE 1MPAH 5DURB 5FYKL 3GGWA 1JPSH 2AXGA 1A5FL 4OLWH 4Y4HA 1D6EA 3IS1X 2Z31A 4TUOA 1T2QL 5EO1A 1M7IB 3DIFA 4Y19A 3OKDB 3BPOB 2MHAB 5CP7B 3LRGA 4JB9H 5TE6H 2X70B 3CFJB 4PJHB 3VH8G 1T3FB 2NY3D 3VFVA 1TDQA 2DQGL 5FM5M 4S2SA 3NN8B 2R29L 4PREB 4WO4A 3MQIA 5T3XE 5ISZA 3QEUA 4XVUD 1D9KD 5I30L 4M02A 2JJVA 1MI5A 3S4SA 1U3YA 1N4XL 4OCRH 4HKBB 1F90H 2YN3A 4FQXC 3T65A 3UTTE 1CE1H 1T7WA 5I8EB 4LSTH 4IOIA 4MYWB 5D7JB 2ESVB 4G9FD 4QEGA 5SWZD 4FFYH 4G43A 5FDWB 3KYOB 1GAFL 2P8PA 4WGWB 2DB8A 5ADPH 3O41A 5EB9A 5F97E 4NN5C 1JZ8A 4OFIA 3D0VA 4NQVB 4Q2ZB 4XI5D 5I1JL 5GGVL 5E8PA 1KEML 3O8XC 4G8GE 4IJ3C 3TF7C 5BJTB 4OCXH 2CDEA 2JJTA 4MMXC 3V5HB 1EMTL 1N0XH 5BRZD 2EYSB 4IDLA 4QTIL 4P3DB 4HKZA 4YE4L 5EA0L 3U9PL 1RV6X 1KJ3H 3V6BR 1DBML 1JF1A 1RI8A 3TBWB 4IIQC 4LK4A 3RHWK 3WSQH 1OAYH 1BEYL 1MEXH 3QIUB 3BRGC 1BMGA 4JZNB 1U6AH 3ALWA 5IWLA 5EU7C 2ZSVA 4LVNB 5DD3H 2HT2C 4WV1B 5FECA 1FFRA 2JELH 2CRMA 4E0RB 5J4MA 2P5EE 2VISA 5LKNA 1RVFL 2OR9L 4RAUB 3IDXH 4KK5C 5F8RC 3TH3T 4TN9A 3SGJA 2GW5A 1YDPA 4LSSL 1FNEA 3QCVH 1OQOA 3D1MC 4HKJB 5KOMC 5J6GA 4TULH 3LQZB 5DQ9A 5IVXF 4OT1L 5D8JH 3WE6B 3X12B 4PGJA 1RFDL 4JFDE 5DTFA 3CD4A 5DC0A 4WHCA 2E6QA 2FIKA 3LS5H 4NSKB 2BSED 2QSVA 4WCYH 2FWOB 2KKQA 1OSPL 4Z78A 4L8CA 1P9MC 3A0OA 1MSPA 3BISA 4K23L 1KIRB 4RGMB 1C7TA 4L4VA 2ZUSA 1RU9H 1FAIL 2YSSB 4FHBD 5INDB 5CSZB 2FCBA 1MCJA 3IFOA 3FB6A 4XGZB 4KH2A 5DJ6A 3IDGB 3OG4B 4RFNC 1T1XA 1Q1JL 2AJ3A 1BBJA 1IAKA 1PKQE 1YEDA 3EO0A 3VXRA 4Z7UB 4YH6A 4XCNA 1Z0MA 1SQ2N 1TQBC 3ZHKA 1P6AB 1JZ3A 1NJ9B 2AQ1A 5L2KD 5I15H 3HR6A 3HI6L 1JHLH 4IM8A 4PRHE 3MRQA 3MLZH 4JDZB 1T89A 2PW2A 2XA8H 3S98A 3CLEL 1S9YB 3BP7A 3VFSA 1MHEB 3QJHA 5HYSG 2R2HB 5ID0A 2V9RA 2FX8L 3DGGA 2K7PA 5FUZL 3CLFL 1FE8L 4LP5A 5DMIL 3IGAB 1VFBA 3B9KB 3SO5A 2D2OA 2HKFL 4NO0B 4QRQA 4YDIH 5DJDA 2FB4H 2X4TB 1JV5B 5I74C 5T5NF 1U3HD 1G7MB 1URLA 5GZOC 3N0PB 4YHKL 3PGDA 4L4TA 5F89B 5CBAA 5ICYB 1A6AA 2DICA 4HHAA 5D1ZA 1HIML 3H9HB 3IDYB 3NGBB 1ADQH 1HSAA 1QACA 1HXMB 5TGBA 3HI1A 4PJAE 1OOAA 3PDOA 5T1KD 2PTVA 3BT2H 4PJDB 1TZGL 3RI5K 4TSBH 3EO1B 3WIFA 2DRUA 1A47A 2MOVA 3H9YA 1AR2A 1YYMH 5E95B 9CGTA 4OM1L 5FM4A 1I9RH 4PRAA 2BNQB 2WLZA 1IARB 3VFPA 5I1AB 3U6RA 3QUXA 4XAWH 5FA4A 3TA3B 2X1OA 3S3PA 2OL3A 2Y72A 1ITBB 1HHIB 5HYJB 5E7BA 3EOTL 1AJ7L 2EYRB 4YC2C 4OGXH 4EOWH 4GG6E 3QNYA 4A6YB 4K8RL 2VR5A 4LLUB 3C6LA 1HHKA 5D2LF 3UO1L 1JK8B 1E27A 4JDVA 4X7CC 2CLZB 4R90H 1BZ7B 1GZPA 5EIQA 4ONHB 4ZAKA 1G7JB 4ZUWB 4EQ2A 1YZZA 2R0WH 4MS8C 3ZTNH 1CD1A 1F8TL 1TQCC 3PL6D 2AGJH 3WXWL 3QRGH 1OF2B 5BS0E 3WJLA 1RSFA 1TNMA 4M62L 5F93C 4G42A 6CGTA 1SY6A 4O02L 1SYSA 3SJVA 1KIQA 3QI9B 1SVZA 2XPGA 4X6FB 2GHWB 2YD1A 4U6YA 3UTTB 2GTZB 4TPRL 5J9PB 2EYTA 4F15C 2W9LA 3FFDB 3PIQA 1YEJL 3UP1A 2W9DL 5J3HD 1AHWA 4H5SA 5F1NA 3VJ6A 3BGFB 4EUPH 1J1OH 3ULVL 4X4YA 3Q48A 3I02A 1LD9B 1CICD 1RJZB 4G8GB 4L1HA 1JTPA 3BH8A 1MVFA 4GKSA 1NBZB 5HHME 3HNTH 1GH7A 5H94A 3DV6A 3GMQB 1U93B 5F70A 5HSFA 3KPOB 1IAII 5ID1B 3SOBL 3DYMA 1UXWB 2AV1A 2ADIA 3T08A 5FYLE 5BQ7B 2FR4A 1T5XB 3C8DA 2VZUA 3IB4A 1F00I 4RQQB 4CMHC 1S9VA 2CO6B 5BVJA 1DR9A 1J0KA 1S7SB 3LHPH 1T5WA 1FZOB 1DEEB 4TUKL 4KHTL 2DD8L 1CE6B 5ETUA 2N56A 2NY2D 1P7QD 2P5EB 3T1WA 4JKPL 4NIKB 1U8QA 5GJSL 4KJWD 3K2UH 3PWLB 5IB4A 4AT6B 4N5ED 1TCMA 4ODUB 4X8JA 1JN6B 3SKJL 1TJGL 3C5ZC 2G60L 2Z93B 2IPUG 4W70A 4Z9KB 5CINL 4OZGF 1UJTA 4G6AD 3MJGX 4JFDB 2Y4SA 3BQUD 3OG6B 4HZAA 2QQLH 5HHVH 2HWZH 1S5HA 1K8IA 1FH5L 1NUGA 3ALXA 5C0EA 2JK5A 4U2YA 3O9WB 5ABDE 1I7ZA 2V9TA 1MPAL 4AL8H 4L8SA 4Y89A 1JPSL 4WY7L 5EO0B 5LG1A 4OLWL 4U0RC 3TZVC 3BP6B 5GS2D 1OARL 2YOCA 4NKMB 1K5NB 1KJVA 2D4DA 5JHLL 1T0NA 3T3PF 5SWQB 1PKQB 2XI9A 4JB9L 5FYKD 5TE6L 5B8CB 4MQSB 3G5VB 3MNZB 4K7FA 4LRIA 5C86A 4I18A 5C0DB 1KJ2A 4Z0XB 4WI2A 4QRRA 4GW4A 2OSLA 4X7TB 3RIFF 3WIIH 2XXCB 4MNQA 4P2QA 4PRHB 3MREA 5FA3B 4QRTA 5DD5L 2RQ8A 3OXRB 3IXTB 3MRCA 2CSPA 1F4WH 4OCRL 1F90L 2QSTA 2F5AL 2DDQH 3HZKB 3JTTB 2XNAA 3LV3B 2HFEB 2PXYB 5DRWB 1FNFA 4FFYL 5IHLB 4KI1A 2E5EA 5ADPL 3BMVA 1F58H 2XWJA 2GAZA 1XGYH 1HYSC 3K1DA 3RWCA 4XVJL 3X13A 1G7QA 2JCCF 5AWNH 2Y6SC 4OCXL 4JAMA 2N7AA 5JXAH 4NYLA 5H2BB 5TDOA 1N0XL 2AKRB 1XH3A 5EZLA 3MRNB 4LL9A 3VFNA 1B0WA 2ITCA 1KJ3L 2VQ1A 3GBLA 2BY0A 4Y16B 3S4SG 1V3MA 2QHRH 1TPXC 1IC5L 4PJAB 1UJ3C 3SY0A 4NRZB 5E5MB 1U2HA 1FNAA 1OAYL 3BVNB 1MEXL 2EO1A 4BH8A 1JBJA 5KOVC 4ACPA 4KZEH 3QO1A 4XBGA 3Q3GB 5DD3L 5FO9A 3QEHA 2DQEL 4OLVH 2JELL 2VWEC 2BHZA 3PGCA 4KKNA 1Q94B 4JE4B 3KVQA 4KDTA 4WI7A 3U9UA 4F33B 5ITBH 3HAEA 2MCPL 1R3LA 1J8HE 5D1XB 5E4EB 5IBTH 3IDXL 4Z77B 1IQDA 4GG6B 2NXZC 3GRWH 2Q8AH 2F8XC 3QCVL 5AZEL 2OZ4L 4TULL 4ZTOH 2DKSA 4HPYH 1VENA 1HSBA 1JF6A 1E6JH 5D8JL 2RHEA 3CXHJ 3QWOB 3DV4B 3LN5A 5DRNA 5T1MB 1R5IB 1EV2E 3CCHB 2IBBA 3VI3E 3LKQA 2E6JA 4U4BA 2FGZA 4K7PY 4OZ4A 4PRID 1IC1A 1A8JH 5CJQH 5BS0B 3L5HA 3RKDD 3MGOA 3VRIA 3FKUS 3X11B 3QPQD 4JKLA 2LAGB 3V5DB 3BEWA 5TDPB 1RU9L 3SKNB 2YPKA 3EYUH 2X89D 3HE7D 4P59H 3SO3C 5FB8B 4A2MA 2EDNA 1K4CA 2AEIT 3SBWA 1WTGT 1T1ZA 3MO1B 4UQ2B 3LKSB 3RUGE 4NN7C 5KS9F 3MRBB 5HHMB 3OAZK 4KJPC 1CT8A 3BRDA 5I15L 1U42A 1JHLL 4WFGD 3O4OC 2XA8L 3QFDA 3C60B 2X4UA 1QSFD 3OL2A 5D96C 3BUYB 5KG9B 5DVNA 3NACH 3VGDA 5IP4A 2E27L 3F5WA 4FG6D 2L0DA 2IALA 1LE5A 1H3UA 1BQSA 3RWDB 5I76B 1J1XH 4YDIL 2W0PA 4NT6B 4ONFH 3OWEA 4IOFC 5H8DA 2JIXB 1ACYH 5HJ3A 3PQYA 4HUUA 3QHTC 3MUHL 4HGWB 5C0CE 1A7NH 4OCSH 1RZ8A 1YMME 1NAKH 3OB0H 4IRJB 1UC6A 2NPLX 5E03A 3A6CH 4U1LB 3WKMH 4JVUA 2I9LB 2NZ9C 3F7YA 1ZTXH 4PGEB 3BT2L 4RGOH 4TSBL 3D2UA 3K4DA 2GY5A 1ND0B 3MTRA 3L3GB 4PY7A 1YYML 3I3DA 5CIPB 1IC4L 5KSBF 1ITCA 1I9RL 1OTUD 4X80H 4QCIA 2P7TB 4XAWL 2A0LC 1GCFA 4LHUD 3FQXB 1R5VB 3I6KB 3QNZA 3EYQC 4HIIA 3PG2A 4ISVB 4EOWL 2MSPA 1LO4H 5GRXG 5J6HB 4HS6B 4QXTA 4OF0A 3MJ8A 2GUOB 3U36B 4QRPA 3RWGA 1XR9B 4MB5A 1T1WA 5EPMB 3MUY1 4K8RD 2R0WL 4NNYA 3ZTNL 4E41A 2AGJL 3HTLX 3QRGL 4M48H 5TF0A 1MQKL 1QFPA 1CFVH 4NNXB 5CHNB 1JPGA 5JZ7D 4EN3C 3WHE1 2H9GA 1BD2E 3BKMH 3OAYH 4JRYE 2JB5L 3AB0C 2GK2A 5LGJB 5DUML 5I1LB 4GJTB 3QXDB 3H9SE 4DKEH 4IOSD 3W9DB 1QSEA 1F4YL 4I5BB 5DMGD 1NANH 2X1PA 3NIFE 2UWEE 1JNHA 2FO4A 2BRQA 5ADOH 4Z7QF 4BSVA 4N9GA 3UPCA 2G9HB 3BHBA 4LVHC 4U1JB 3HNTL 4FTVA 1TVHA 4MJIE 3RPIA 3MRDB 5F7HA 3FO1A 3ULVD 4W6WB 4MA3A 1I1YA 1IT9H 1INDH 1KCLA 5DS8B 5HVGB 1OAXL 5IVOA 3WFHB 4LGPB 1YC7A 2HLFD 2XN9D 5BVPH 3S35H 3UAJD 5IVXA 2DS4A 3QXWA 2G2RA 1UB5A 3LHPL 3NFNB 1XGTB 3OXSA 4Z18A 2IAMD 3VGAB 1BHGA 1FDLH 1MHPL 4PLNC 5ACMA 3WMSA 1J8HB 1NPUA 5F6HI 5E8EA 5MENE 4M1GH 4RMWA 1HQ4A 3TYGH 1IM3A 4ODTH 3HFMH 5GGRA 2E7LA 5DUPH 2YZ1A 4D0DB 2MMXA 4OV6F 4DWHA 5IM7B 2KL6A 3R06A 4RX4A 2QQLL 2IQAB 4OF8A 4ETYA 5HHVL 2BHYA 3I6LE 3G5YA 2HWZL 5H37H 5GS1B 4MX7B 4FQXD 2VDRH 3U2SB 5TPWH 3KJ6L 2ARJQ 3V6OA 3AMKA 1AKJB 3TBTB 1P4IH 2FHBA 2W65A 3VRLF 43CAA 3G5ZB 4D0CB 1QD0A 4I0PC 4RFEB 3RL2B 1NKOA 2K7QA 3HMWL 4I0KA 1CD0A 3O8XD 4EXPX 1ZWIA 4ZFFB 4QRSB 1IM9D 2DMCA 3U46A 2FH6A 5K9OA 2V2TB 3MRMB 2D31A 4PJFE 2P4AB 4PLOB 4BSJA 2C1OA 1DVFA 4JFHD 3STZA 3T0EC 2OJEB 3RUGB 1YUHB 1V05A 4J3XA 4X99B 4MNGE 3WIIL 5A2KH 4JFFE 4NZJA 3VFRB 2AI0L 2FSEA 1A14L 3B2UC 2HT2D 4BJLA 1NGYA 3DX6A 4D9RD 4CDHA 1F4WL 4MDIB 3VD7A 2DDQL 3JV4A 4CN1A 4MJ5B 5IBUG 1FZMB 3MLRH 4ZSOE 3DX7A 4UNVA 4KK5D 2X4SA 5E00B 1FZJA 3JV6A 4RISH 4HWZA 5TFSH 1F58L 5GSRB 3WO4B 1XGYL 4U1MB 4O51B 3ULUC 2GCYA 1FVCB 3G6JE 2VLKD 1R3IH 5AWNL 3ESVF 1UYWH 2QLVB 3MRFA 1FVDB 1RIUH 3DBXB 4GS7C 3RBSA 1NGWB 4R3SA 5E1HB 3SDCD 5C0JB 5AD0A 5C0CB 4OF3A 1YMMB 3CFIC 1TLKA 1BFVH 2ZOLA 2E7HA 4OFYD 1H8SA 1HI6B 4QOKD 3SKUD 4LKCB 4YDKH 1BAFH 5EUKA 1G1YA 5D2LA 3U7WH 4KZEL 3HPLB 2WANA 3VA2C 2XWTA 3BIAX 4NRXA 3VFTA 2EDHA 2PNDA 1MCEA 5HHQB 2PO6C 3KS0H 4OLVL 2VZ1A 4NM8H 5EIVA 5FAAA 5C3LD 1WIOA 5ITBL 2D7PA 5IIEA 1DBBH 2G5RA 2HFGH 5IBTL 3V6FB 3GRWL 2Q8AL 5HYSB 4AYFA 2RAMA 3T1FA 5L0QB 1A6ZA 2EKSB 3C09B 1TJHH 4PG2A 3MLWH 3RJQB 2DM7A 4ZTOL 4HPYL 2GT9B 5EU3B 2DM2A 1QYGH 1E6JL 4GLRI 2QKIA 4KHXH 3QDGD 4WUKH 3TN0A 2A73B 1E4JA 4HG4J 1GHFH 1ZMYA 3TCLB 3MJ7A 2G75A 3ARFB 5ESVB 1Q72H 3MRJA 1NEZA 5CJQL 3UPRB 4LPYA 1H3PH 3L7EB 1JYVA 2M26A 1MQ8A 2LAAA 3MRKA 5CD3B 4AJ0A 5C07A 1DQLL 1FSKB 1MI5E 3HAEG 4OFPA 1BD2B 4U1NA 4JRYB 5ECJE 1BBDH 1JNNH 1V7ML 3H9SB 3WFEH 5HY9A 3EYUL 3F58L 3NZ8B 4HIXH 3EYOA 5ACZA 4P59L 5E6YA 2IBGA 3HZVA 3NZHL 4KRMB 5DI8B 2ZSWA 2UWEB 5GZOD 3U30B 2EE6A 5LAXB 2JB6B 1CDIA 1JVKA 1U8HB 4YLQT 5FCUH 1KB9J 1ZHKB 5DJ0B 3K4ZA 3QULB 5CEZH 1QHOA 4DKDC 1KTKE 4O2CA 5E6IC 1A2YA 5GS3A 4XAKD 4MJIB 4OBSA 4NZUH 4C59B 3K1KC 3ZSSA 1MCSA 1L7IH 2R23B 3