1K85A

Solution structure of the fibronectin type iii domain from bacillus circulans wl-12 chitinase a1.
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
88
structure length
88
Chain Sequence
HMAPTAPTNLASTAQTTSSITLSWTASTDNVGVTGYDVYNGTALATTVTGTTATISGLAADTSYTFTVKAKDAAGNVSAASNAVSVKT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CHITINASE A1
publication title Solution Structure of the Fibronectin Type III Domain from Bacillus circulans WL-12 Chitinase A1
pubmed doi rcsb
source organism Bacillus circulans
molecule tags Hydrolase
total genus 7
structure length 88
sequence length 88
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1k85A00
4PJ7E 3MCKB 2B5IC 1RVFH 2PNDA 3WFBH 1UG9A 3MRBA 5EU5A 1URLA 4ALAL 1I7UB 4Y4KC 4JREC 2MQCA 3O6KH 4PRDA 2DYPD 5EBLA 2FJFA 4M03A 1N6QH 4ZXBB 4IHOB 4WY7H 4ZS6D 4E0RA 5D2LA 3T0WA 4YBQD 3O0RL 1F4WL 4APQA 4KUZL 1PLGH 3FRUB 3S3SA 5JIHA 4QXGL 3RY4A 4M7KH 1FN4A 3C5JA 2ZUQB 2EZ0C 3S96A 3RUGE 2XQBL 5IB1A 4P3WA 4ONHB 3QUKB 4KK8D 3FQXA 3UJIL 3BGMA 3MRQB 4F2MB 3F5WB 3TBSB 2UYLA 4I4WB 2Q6WA 2Q76B 4DZ8A 1ZA3A 4XVSH 1CGSL 5C1MB 1H15B 3TVMA 1JWSA 2FEEI 5IW3A 3HE7C 5DS8A 1HOCA 2BVOB 1L9NA 5A3IC 4P5TD 3VFTA 5D5ME 3QNXA 2IG2H 1KCKA 4I2XE 2IPUK 4PRBA 5ISZA 1ZHLB 1OARH 1XCTB 5E5MA 4PRIA 2V5TA 2WM0A 4YFDB 3ARBA 4YHIB 4PLOB 3H3KA 4Z95H 4WTZA 5DD3L 3ULUF 1Z9OA 3WUWG 1NCAL 3V6ZB 5I1EL 4ZUVA 3FHAA 3TO2A 4P4KA 4YWGL 2JJTA 4YBQC 4I3RL 3M1BB 2BERA 2GK2A 1R3HA 1UXSB 3UTOA 5JOFA 1HNGA 3OAUH 5IEKA 3V52H 3ARDC 3SE9L 1CICB 4BKLA 4OGXH 1QLRA 4HWEH 5ADPH 2ESVB 1X5IA 2MCPL 5IOPA 5T3XH 1T5XA 1BD2E 1RIHH 3FMGL 2LVCA 3OX8A 3E8UL 1ZLUK 4GAGL 4PRAB 5DJDA 1IGML 4I0CC 1E4KC 4XXDB 2EDDA 4HIJB 2X1QA 1QRKA 3MLSH 3MGAA 1NKRA 1F3DH 4LSVH 1CXIA 4WV1C 2BNRD 1JRHL 4JDVA 4XPGL 2BRQA 1TZHA 1P1ZB 3G5XB 3HZYB 4M6NL 3BN3B 3THMH 1UJ3A 3LV3A 3HR6A 5E5UB 3WE6A 1S9XA 4YHZH 4R7NB 5CBAB 1D9KC 1HHJA 3NABH 5MP6H 3EO1B 3EW3B 1MVFA 4DTGH 4UINH 3H8NA 5HYIA 3K8MA 5CWSB 2W9DH 3VGAC 2EDKA 3QAZC 3Q48A 3HN3A 1NDGB 4WUUA 5CZXD 1UWEL 5C8JA 4XB8A 4GRLC 4LAQL 3ALPA 1MUJB 4PJXF 1BBDH 3BPNC 3HNVL 3NIDE 5C0RL 5I9QB 3KPPB 1H5BB 1AGDA 5E2WL 2NY2D 3UTSB 1SEQH 2AEPH 4U1GC 5T5NG 4N0RA 2VZTA 1JPGA 3LIZH 2FX7L 2JK5A 5FYLD 5ALCH 3M45A 4I0PB 4NFBA 1N59A 1MCLA 4U6HB 3QWRD 5F89A 3WJJA 5GGVL 5L0QC 1K5NA 3C08H 3A6CL 1T04A 3VCLB 1RK1A 2FECL 5E2JA 4XCCH 1OCWL 4WI7A 2JB6A 5FM4A 5F1SA 1DL7L 4XVUC 5E03A 1JIBA 3MRRA 3VG9C 1OTUC 3HE6D 1TQBC 3S5LG 4IRSB 4J1UA 2Q3ZA 1S9KC 1RULL 4KRMB 2XACC 1A6TB 1J7VR 2EEDA 3BE1L 4HBQA 3FB7A 1BBJB 1RD6A 5IB4B 4Y2DC 4S1QH 1RZJL 4OSUH 5D2LF 4Z7QE 3TPUA 1T4KA 4JRXA 2ICES 1HXYB 4FTVA 4B50A 3L5IA 4U6XA 3IS1X 3MZTA 4M02A 2X4RA 4EN3B 1OW0C 5F3HB 3W11D 5FM8A 4B0MM 4YDKL 4L8DA 3Q1SL 4P59L 4ELME 1MRCL 4M8QA 3WDIA 2FEDD 2YBRA 3HNTL 4QT5B 5AWNH 2NY2C 3UXFA 1AHWC 2Q7YA 1TJGH 5GSRA 3G04B 2YRZA 3ZYIA 5F1OB 1FBIL 4R90H 4HQQH 4JQXA 1R3JA 1WFNA 1CLZH 4OI9A 1MREH 1I7TA 3GSNB 4KAQH 2DQEL 2P5WA 4P5MB 5BOPA 2Z8SA 4JFYA 2ZUYA 2HN7A 2IH3B 4XPFL 3TCLB 4CVXB 2F54A 5ANMA 4DOHB 4PP2B 1PY4A 4V1DD 4HKJB 2YPVH 3OR7A 3PGDA 3NCFB 3OJMB 3OAYH 3O8XB 2AQ3A 5TDNA 3FFDA 4RGMB 3IDGB 3KYKH 3P0GB 3HC3H 4FP8L 4LSQH 3N1MC 3VJ6B 1FVCB 1YN6A 1I9IL 3QO0B 3REWB 2AI0L 2RIKA 4G9FD 1TTUA 3BDYL 3VWKA 3CVIL 1LD9A 2VKWA 5C6TH 4X9GA 4FQCH 4HLZH 5FYLH 3DXAB 3UJJH 5JXAL 2HFFA 3GRWL 4QO1A 1WJ3A 3D6GA 4BSVB 3TN0D 2CLZA 1ES0B 3A67H 1CFQB 1N3NB 5IK3A 4DZBA 2J88H 2C1OB 2ICWJ 2CH8A 2FEDC 3WJLC 3JV4A 3GI9L 3ZKXC 3TV3L 4OLXH 2X6MA 3DI3B 3VFOB 4ZFGH 4J2XA 1ZS8B 2Z8RA 3UP1A 1FC2D 5DJYA 3CXHK 5JA9A 4QRTB 3WNOA 2CUMA 4XC3L 4HCRH 1HCFX 1JVKA 2VLJB 3O41A 4WHDA 4OTXL 3QUMA 1W72A 2XWBB 1GOFA 1XGTA 4U4BA 2X4QB 2FNBA 3FOMA 1S9WA 2VDNH 3PWJA 1EXUA 5ERWB 4ZQKA 5HHXH 1N0XH 2WBKA 1JHLL 2Y5EA 3QUZD 2EKJA 4J7RA 3VXSD 4LLMA 4NZUH 3V9FA 3MCKA 3AMKA 1KBGL 4LVHB 3LS4H 1I7UA 1J0IA 4PJ9B 4GAYB 5LQBH 1T03H 4X99B 1NLBL 3TN0C 4IHOA 3NZ8B 1BX2B 1MAML 1NFKA 4R4FH 4U0QB 1AE6L 3SDXE 2VXUL 3R8BB 4KK9C 3FRUA 5IV2B 4U0RC 3ARVA 3M8OL 3Q6GL 2RCSH 4K3HA 2BOCA 1OGAA 2DJ4A 3BMWA 1KCSL 1RZKL 2R15A 1UFUA 4ONHA 4LKXA 5EUOB 2DKUA 1BIHA 4H1LG 3MRQA 4F2MA 5JA8B 3F5WA 4A6YL 3TBSA 3D85D 2YD8A 4I4WA 3V7MA 1UH2A 1GGTA 3FOLB 4J3SA 4RISH 4NC1E 4S10A 3ZTNH 3U4AA 3ZSTA 4TUKH 1RFDL 2F5AH 5EU3B 3D69B 4PBVC 4Q74A 2YN5A 3KPSB 1H15A 5L2JB 5J9PB 3LSOB 4XWOC 1C16B 3QUZC 2BVOA 3K46A 3JWDL 1DUYB 1ZANH 1KPVA 2AXHA 3SGEH 1P4IH 2F74B 1DJSA 3VD9A 2Q87A 3GI8H 1ACZA 4UTBL 1ZHLA 1XCTA 4JDZA 4MA8H 5J6HB 4JQVC 3QDJB 1CLCA 1JTOA 1ZVYA 4GFTB 1L0XA 1QHPA 2NNAA 1A5FL 1Q0XL 3UTPD 2FEEL 2XN9E 3DNKA 3PIQB 4Z18A 3T3MF 5CKAA 5KVGL 1AI1L 5IMKA 4WI9A 1QSFB 4JG1H 1CFSB 4CRPA 3V6OA 4WWID 3CU7A 3V6ZA 4O5LH 1ZLSH 1U8KB 4HIEB 3UJTH 5GS0D 2OR8A 3ZHDA 3M1BA 1LDPL 1U2CA 1UXSA 2GJ6E 1JK8B 2VDML 1CICA 4MJ2A 2X9XA 4QYOB 2ITCB 4KMTH 4EEEA 5CP3H 3FFCE 2ESVA 1RUMH 2DLFH 4JZOB 1KJ3L 5SWZD 2Z31B 4PRAA 1QQDB 1NGXB 1EUTA 4LSSH 5GS1B 5HVFB 5H37G 3PP4H 4AZ8A 4LCYB 1B4JL 4HWBL 4HIJA 4QHKJ 4C57C 4HH9B 1XZ0A 4MXQC 4RMRA 1PQZB 1OD9A 2X4TB 4JANB 3VH8B 4DOHE 3QCVL 4UOW0 2Z4QB 3QDAA 5CEZL 3HZYA 1P1ZA 3G5XA 3O4OB 25C8H 4UT7L 5L8LB 4NPYB 3DROB 4R7NA 4KXZI 5E8EA 4M5ZL 1BEYL 4N68A 5CBAA 3EO1A 5C9KA 4QHUB 4KTDL 3DX9B 4TYUA 3RL2B 5CWSA 2QHRH 2WV3A 1NDGA 2DM2A 4K23L 5BW7A 1CDGA 4KPHL 1T0NB 1MUJA 2IAMA 5LGJB 3S8WA 1WUNT 4HPYH 4U1NB 4L8CB 3KPPA 3HNSL 5E7FA 1H5BA 3MBEB 2W65B 1FPTL 5GS0C 1ZVSB 3UTSA 2APWA 2ZNXA 2XV6B 5LG1A 4KRNA 3TA3D 1JGEB 4XC1L 1AR2A 2IANB 5IF0B 4U6HA 3QDGD 2E5EA 1MFDL 4FZEH 3WO4C 3LCYA 3UYRH 1AQKL 2A9ML 3VCLA 3OQ3B 1QACA 1I9JL 2D7TH 3LQZB 3QIWD 2KBGA 2QQNL 3L3GB 2VLME 4LEOB 2ADFL 2PTTA 1CFVL 4IRSA 4EIZC 4I3GA 4Q9RH 1Q38A 4OM0H 2E7LC 2XZCH 5HHPB 3VXRD 3GBNL 1A6TA 3JSSA 4YIQB 5EU7E 4FS0A 1BBJA 5INDB 3BT2H 1YJDC 4OQTA 1NFIB 5IB4A 2I27N 4W81A 4JN1L 4TVPL 1QBMH 5GS0H 4U3XA 1HXYA 4NKMB 4F58L 2PUQT 3QRGL 4EN3A 5F3HA 2W59A 2EIDA 5FYJE 4JKKA 4WFED 1JGVL 3LKOB 1A9BA 3CCHB 2VDOH 1I8KB 2HT4D 3MNWB 4JO4L 4QT5A 3S36L 1OGTB 2H32H 3ZL4H 4M7LL 3KXFE 3TA3C 3G04A 2VN7A 3F58L 3SKOA 3KLAB 5E6IB 5DLML 4LVOC 5BRZD 3NTCL 3RX8A 3AGVA 3BD5A 3GSNA 1AC6A 1LDSA 4P5MA 3QIWC 2Q20A 4MXVF 3TCLA 5CD5D 4CVXA 1YJDH 3RIFK 1ORSB 4PP2A 4BK4A 1A6ZA 1TZGH 4PJEE 3PWUB 4HKJA 3GBML 2YD5A 2QQLL 4DGIL 1FH5H 3DO7B 3O8XA 1D5XB 4HMDA 5HDOA 3IDGA 2YK1L 3VJ6A 1FVCA 3QO0A 5MEOB 3REWA 3LN5B 2AEQH 2XTJB 2VQ1B 5L6YH 4GUPB 1Q1JH 5D93C 5D7LD 4ZS7L 5FUOH 3N9GL 3B9EA 4ZNCD 1CD9B 4NUGH 3DXAA 4OGAD 4LRIC 4BSVA 1ES0A 4PRPD 1WITA 1N3NA 3LMJH 3LHPL 2HT4C 2MFNA 2A9NL 2C1OA 5E08L 4MHHG 1JPTH 3QIUD 4FZ8H 2XT1B 1WZKA 3NCCB 4XP9L 3SPVB 3VFOA 4NFDA 1ZS8A 2YA2A 4P0DA 1UCBH 3JV5A 4PJHB 4YK4C 4FQ2L 4QRTA 2P8LB 2BXZA 4F57H 4UIKL 4J3WA 1YEKH 5DURD 2FO1A 2VLJA 4C56E 1NLDL 4X6DE 4D9QD 3RNQB 2XWBA 2NXZD 3HG1D 5JW4N 2X4QA 5E6ZA 2XPGB 5C07B 1PKQB 4KROD 3S37H 1J0KA 1I75A 5ERWA 3D3VE 2EC8A 3VXPB 1T89A 3ECBB 4K3GA 1NC4D 3ME0A 1CIDA 4JFDB 2YUXA 3G6AB 4R9HA 1JNNL 3PWPB 4XCFH 4WI3A 4HF5L 5C86A 2Z9TA 1S3KL 3KS0J 1NEZG 1A14H 1A6PA 1YNKH 4PJ9A 4GAYA 3D2UD 1NANH 1VFMA 4OGAC 1UACL 5J3HC 3W2DL 3GKZA 5EWIH 4X99A 4BA8A 4XP1L 1X5GA 1MCIA 4ONFL 3NZ8A 1BX2A 4DGVH 1TJIH 2VQUA 1OAXL 3DSFL 5J13C 3MXWH 4CDHA 4HFUL 1N7ML 2YRPA 4H88L 5F6IB 3RWGB 4WI2A 5IV2A 2E27H 3D9AL 4Y88A 3PP3K 3MA9H 4M48H 3MC0A 4XBEH 5MI0B 4PRHB 1RUPL 4YHYC 5EB9A 1AO7E 3QEQE 4QF1B 5F9AC 1PX4A 4M7ZB 2NXZC 4HT1L 5TF1H 4L4TB 1KENH 4Z7UE 3QI9B 4KROC 3EJYD 1H8OA 4LIQH 2R8SH 5EU3A 2QSQA 3D69A 3KPSA 5L2JA 5J9PA 3AC0A 3LSOA 4MA1B 1C16A 3KLSA 4PB9L 4OLYH 1DUYA 3ESVF 4A6YB 4Z78B 4PB0H 5FAAA 5GS2H 3N1PC 1P84K 1LK3L 2YMXL 3PDGA 4YHLH 4LKCB 2FD6L 4JFFD 5I6XB 4S1SH 2APTA 1L0YA 4NWUL 4DEPC 5J6HA 3QDJA 4HS6B 5DMIH 2AKRA 4RQQB 2OTPA 3L7FB 3IU4L 2IWGA 3PIQA 1IT9H 3TP4A 1QSFA 3LH2H 1CFSA 2IH1B 1LNUB 4LHUD 3CH8A 4MNGE 1U8KA 2DF3A 3EOTL 4HIEA 4Q6IB 3MLPA 1QR1A 5CP7B 3O9WB 1B90A 4D0DB 4X7EC 4P48A 2X40A 1YQVL 2VLKD 2M8XA 1OLLA 1CXFA 3DVIA 1JK8A 4XWGL 3BWUC 4QYOA 2ITCA 4TRPH 2O5ZL 3RDTD 2B1HL 3OXSB 3PGFL 4ZYKA 2YXFA 4JZOA 2Q8AH 2Z31A 1QQDA 1NGXA 5GS1A 1NGYB 1D5IH 1EEQA 2CGRL 3QHZL 4LCYA 3QQNA 3DTXB 4KVNL 3I3EA 1BJ1J 4HH9A 5DJ2B 3H9ZA 4G8GE 4N0UB 1PQZA 2X4TA 4JANA 5EC2B 3UTQB 3VH8A 2Z92B 2Z4QA 2VDKH 3O4LB 4ODTL 1INDH 2R4RL 3B9KD 2BNUB 2ZUUA 4NPYA 2NY4B 5A2IH 3WXWL 4QHUA 4YJZL 1A1NB 2IADB 4UOJA 3RL2A 3DX9A 5H94B 1YYLH 5KANI 1IJ9A 3VXNB 5E99H 5JIKA 1SM3H 1K6QL 3C6LA 1ZT4B 1T0NA 2R0ZL 4KQ4H 1IGCH 4YBHA 1A2YB 5LGJA 4L8CA 4LDLB 3S4SG 2QTEA 5DRXB 1ZVSA 3U9PH 4AIZB 1NCDH 3L3KB 1JGEA 4C4KT 4M1GL 2IANA 5IF0A 1FL5B 3RDTC 3N1QC 5F9WC 3LQZA 3ZZ1A 1C1EH 1X5ZA 3LKNB 3QXUA 4UAOB 2DLTA 3MRCB 1S5HB 3L3GA 2W0KA 3MV7E 4LEOA 4NOFA 3RGVB 5CAYB 4EUPH 1MHHB 2XZAH 3OB0H 5EZIH 1LEIB 2QADB 3EO9L 5DUBB 5HHPA 4D3CH 3MRJB 4K94C 5KW9L 4N0CD 4YIQA 2A0LD 1X5KA 5INDA 3B9KC 2XZZA 4I8DA 4K3JH 2MSPA 2A1WH 5E24E 2EDNA 1ZT1B 4NKMA 5I1CH 4FQLL 4R3SB 4YQXH 4YPGA 2HVKB 1WBZB 2WLZA 1UQSB 2EICA 3TH2T 1ZLWH 3SGEI 1NMBL 3LKOA 2QR0B 4X6EB 3CCHA 3IXAB 1I8KA 2X44D 5J12B 3MNWA 5EUOF 1OGTA 2A74B 3PABB 4FQ1H 4ERSH 2OSLB 4KVCH 1NGQH 2MQ3A 3KLAA 5E6IA 3LPGA 3ULVE 2FB4H 43CAB 4OZGE 4C4KO 2J3SA 4OCSL 4KI5D 4X7SH 2BVQB 4YBLC 1ORSA 1KLUB 1PBYA 3DV4B 3BO8B 3PWUA 4P2RD 3MLZH 2NXYB 5I1KH 1BP3B 1RPQA 5CZVL 3DO7A 1D5XA 1B88A 5DJZA 3S37X 4JGJA 2A0LC 4M93B 1OAQH 3WIIL 3I2CL 5EBMB 1QFOA 4RX4A 3LN5A 1WF5A 2BFVH 5TJWK 2VQ1A 2EIEA 4MYWB 4D9LL 1E4WH 3MJ7B 1MY5A 2CKBH 5GGRY 4AEHL 4Y19B 4YC2C 2FZ3B 2WW8A 4PY7B 3DARA 4M4PA 5LWYH 3SPVA 1CR9H 1U3HB 3CLFL 3KDMB 5JW4R 3UPRB 5IFAL 3GRWA 5EU6E 4PJHA 1UWGL 2P8LA 5K9JL 1J8HB 4XGZB 3TCXA 1VFAB 4KI5C 4JFEA 1BQHG 3V95A 3QPXL 4QRPE 5HDQH 1F11B 1IC4L 2QHLA 3P4NB 2XPGA 5C07A 4PJ8D 1PKQA 4BZ2H 4OKDA 1RJZB 3FN9A 1U9KA 2FCBA 3MV9D 3ARSA 8CGTA 2UWEE 3VXPA 3ECBA 4P2OC 2AABH 2X70B 1OB1B 3QQ3B 5F96L 3BH9B 2RAMA 4JFDA 3G6AA 3PWPA 3FN0H 1N64L 2EECA 4O51B 3BAEH 2PYED 3J7HA 4IIQC 1LMKA 3HRPA 1KV3A 5F97E 3AY4C 4JZJC 2VTFA 1HIML 4XMPH 4ZNEA 1J0HA 2F53B 2EH8H 1E4JA 3HLAB 1CE6A 4ODWB 1GGCL 6CGTA 5FECA 3MA7B 1KTKE 2DQGH 1A3RL 2H2PC 4XI5C 5DVNA 4J8RB 1SMAA 4PG2C 4U6VH 4HXAH 4LGSB 3QFJD 4GW1B 1I8LC 3RWGA 4JCMA 5DZOA 5GRVK 1CD1B 3MYZA 3V4PH 2F8OA 4PRHA 4POZC 3VE0B 5KSUB 4QF1A 3ZDZE 4L4TA 2APVA 4I9WE 4Y5XC 4PJ8C 3QI9A 5JZ7D 2NR6C 4OJFH 1IBGL 2YS4A 2NW3B 2EE2A 1YMMD 5TE6H 3HFML 4CBPA 4FA8A 4PY8I 2BNQE 4A6YA 4Z78A 5FHBL 4IDJL 2W9EH 1JGLL 4LKCA 2ZKHL 1JWMB 4NP4H 3X11B 5EOCL 1JYVA 1MCKA 4HS6A 2P47B 2GIYA 2VERN 4RQQA 3L7FA 4JCLA 5HTSA 3UX9B 4PUBL 1WTGT 5DUMH 2IH1A 4F15C 1LNUA 1Q0YH 4NM4H 3HAEH 5HHOB 1UJTA 3EDEA 4Q6IA 2C7UB 5CP7A 3O9WA 4D0DA 4LCUB 2VKXA 1MCFA 1CLOL 3MRFB 3DMMB 3BOVA 4HEPG 1ORQA 3OXSA 2ID5A 2XKNA 3RPIB 5MHSD 1V3KA 5F7FA 1K8IB 3JXAA 4Y4HC 2WZPD 1NGYA 1MVUB 5IB2B 2E6JA 2E8YA 3AFLA 4X80H 5GHWH 4WIQA 3PL6B 5DJ2A 2EDQA 3SN6N 3VFRB 4N0UA 2ZCLL 5HI3D 5EC2A 3UTQA 4XPHH 1NEUA 3C5ZB 1BECA 3O4LA 4Y1AE 3U0WL 1QSEB 4FRWA 3EDKA 5F9OH 2VDPL 1MLBB 5FGBA 1UM6H 1WV7T 2F58L 4HWBA 1FRGH 2BNUA 4NQCB 5LCVH 2UVEA 5HJ3B 3A0OA 3JWOC 1A1NA 3KHOA 2IADA 3OWEA 5AG9A 4H0IA 2OZ4H 5M94B 1UA6L 1I9RL 5HGAB 2BSTB 2ARJQ 3VFPB 3QDMA 2IALB 4PJHF 3VXNA 5DWUL 4JDTL 5AZEH 2JIXB 4L8BA 1A2YA 2ARWA 1WFOA 1GHFH 3V2AR 5DRXA 4R0LB 1DBML 1G7JB 1NCCH 3BXNB 4I3SL 4OCMC 4Q2ZB 4HUMB 4F8QA 2E3VA 1QRNE 3ZKND 4AIZA 1YC8A 3L3KA 4MJ6A 4JO1H 4ZUUB 1ADQL 1FL5A 5I8KH 5T3ZD 1FLRL 4IMKA 2LU4A 3FAWA 3ZYZA 2WBJC 3LKNA 2AJSH 3MRCA 3KPRE 1S5HA 5DJ6B 2E7CA 3RGVA 3JWOH 3T4YB 4D9RD 1MHHA 1FIEA 3QXWA 3BHBB 4UV7H 5F1NB 1LEIA 3BSZL 2H6PB 1Z6JT 5DUBA 2ZCKL 3MRJA 1N6UA 5FGRA 4JRYE 3RTQB 1H3VA 1IQWL 1NJ9B 4KJWD 4BH8B 2HTKD 3OR6B 4NN5B 1FSKB 3VFGL 3JVGA 1HHIB 4KV5E 3W9DB 3BVNB 4GBXB 1VGEL 2PXYD 1AIFB 1OF2B 2CJUL 4NQDD 3ARTA 4R3SA 5F7WC 5C7XL 1J0YA 3PQYB 3KJ6H 5EIVA 2HVKA 1QLEH 1CGUA 1UQSA 3Q2CA 4OCNC 3RY6A 4ESKA 2XXCB 1W8OA 4IRJC 3WN5A 4X6EA 1MRDH 1A22B 4P23B 3IXAA 2HFGH 1IM9B 1A6AB 4R4BB 2A74A 3PABA 2OSLA 1CDYA 5KS9B 1CZ8H 3UZEA 3MGTB 43CAA 1UWXK 4LSTL 2J8UE 3T09A 2B5IB 3HI6H 4J6RL 1HZHL 5IQ7H 2V2WB 4NCC1 4PG9B 3B9DA 4M61B 4Y4KB 1NH6A 4JREB 4HJ0D 2BVQA 5HDBE 1KLUA 3DV4A 3BO8A 4XAWH 1G6RH 5EIQA 1A7RH 2CXGA 3D39E 3E3QC 4OM1L 4JY5H 1AY1H 4ORZC 2NX5B 1D6EB 2HTKC 5EBMA 1T83C 4JM2C 4KZDH 3ZE1E 2DM4A 4X0KB 5GPRA 3JWNC 1FDLH 5BVPH 4OZFH 3VG0L 1N4XH 2PXYC 1X5JA 2DQJL 4RIRA 4YUEH 4P2QD 3MRMB 3MJ7A 5JUEH 3SDDD 3GKWL 2Z8VC 5IEHB 1UC6A 3OKKB 2VDRL 4Y19A 3TZVD 3ILQD 1F4HA 5SWSE 2R2EB 5I18H 2FZ3A 4PY7A 2NY6D 3I50H 5JPMB 1Y18B 4WO4D 4NZJA 4MJIB 1U3HA 1OM3L 3KDMA 3UPRA 4OI8A 2DQHL 3IDMB 4NKQB 4EBQH 1R3IL 4FQIL 1OSZB 1Z3GL 1J8HA 4YX2L 4OIIH 1XCQB 3MRLB 3MUGB 1XGQB 2WSKA 1VFAA 3GJFK 1G6VK 3LEYL 2DYPB 1F11A 4OD1H 2RFXB 3KGRA 3MJGX 1RJZA 1RURH 5LBSL 3ARGD 5E9DE 4MNHB 4JEGB 1CK0L 1UVQB 2X70A 1OB1A 3QQ3A 3BH9A 4QOKB 2YEZB 2AGJH 5CGTA 4HZAA 1M05B 2A6KB 1GC1C 3ARDB 1BD2D 3RX5A 4AM0B 4O51A 1L4IA 4OB5L 1F58H 4V2CB 2YD4A 4OGYL 4KZEL 3SDDC 4GMSH 3IDYC 4JM4L 4DKEH 1KELH 3TJEL 2F53A 4H25B 3ILQC 4PJBE 5JR1L 1WAAA 3HLAA 2Y36L 2OJZL 3VD4A 4ODWA 2ZG1A 1U8HB 3MA7A 3TFKD 4AT6B 5TE7L 1UGNA 2QSCL 2W0PA 3CAFA 4WV1B 1ZLVH 1KF9B 4J8RA 1GRWA 4GW1A 3CSGA 3G9AB 1FFRA 3D87B 3T8XB 5IT2H 3LS5L 4YFLI 4Y16D 3QEHB 1CD1A 3IDXH 5J7CC 1D9KB 3BT2L 3LQAH 1IEAB 5E8DL 3BZEB 2HH0L 5KSUA 3VE0A 3MMEB 2WQRA 1YEDB 1F4XL 3VGAB 1ZLUH 3QAZB 1WCBB 1F90H 2DN7A 3H3BC 3DOSA 2MWCA 4P3CL 1O7SA 4GRLB 5HDLA 2GY7B 3ARGC 3BPNB 2AQ1A 2NW3A 2BY2A 3VXQB 1T1XB 5DC0A 4N8PA 4WUKL 1U8PB 12E8H 5FO9B 3FQWB 1TJHH 4TOYH 2DTML 4U1GB 5IJKC 5ACZA 1FNEA 1ZXQA 3ETBF 1JJUA 1ITBB 1JWMA 1H3TA 3X11A 1NUGA 1MIMH 1DSFH 1GIGL 2AJXH 5L0QB 1CLYL 1RU9H 3IAQA 1B3JA 3S9DB 3D48R 1U3ZA 1N8ZA 1KN4H 3TFKC 3VG9B 3NFPB 2BK8A 1VB9A 5HHOA 1TQBB 4XAKE 1JGUH 2C7UA 1A7QH 3GZKA 4JY4B 4E41D 2FDBP 3KYMB 4LCUA 1U8NB 5IHUL 4MDJB 3MRFA 3DMMA 4NJ9H 5L2KD 3V8OA 1DQJA 2YSSB 3MO1B 4P49A 2PTUA 3STBA 1CBVH 2I60L 3U7YL 3RPIA 4Y2DB 3GMRB 1MFAH 1T0MB 1K8IA 1SYSB 1JZ8A 1MVUA 4OF0A 5IB2A 3HS0B 2A77L 1EUUA 1YECH 1IC1A 3VFRA 3FTGB 5JW4Q 1VFUA 3VXUD 3IJYB 1UZ8B 4B41A 3NH7L 3C5ZA 1QSEA 3V4VH 2NY2B 3I3BA 1MLBA 1ZE3C 1AHWB 1FAKT 3PV6B 4H20L 4FFWC 3T77B 2ORBH 5HJ3A 2OR9H 3DYPA 3SCMD 3MODH 5HGAA 1IKFH 2BSTA 3UDWA 5JXEA 1ZGLP 2WWMC 3VFPA 1ZA6A 2IALA 5GJSL 1T80A 1PW3A 3VFUB 2HRPH 5EOQH 5I15H 4N8VA 2JIXA 1H3PH 4PJAE 3INUL 1YEGH 1J1PH 4N5UA 5FYJU 4R0LA 1DUZB 1G7JA 5IBUG 3BXNA 4Q2ZA 4JHWH 4EZMA 4YHNB 2OK0H 1MI5A 4O9HL 4OCYH 3BKYL 3KVQA 4NZDA 3BYYA 5ICZA 3VW3H 1MFBL 1MWAL 2EO1A 3AAZB 5FGCE 1ZK9A 5FK9B 3V0WL 5LXGL 3BD3A 1M6OA 5T3XE 4ZUUA 2A83B 1C5BH 1UM4L 1OAUL 5GISH 2KKQA 4NDMB 5B8CC 3NA9H 4WU5B 5DJ6A 4QY8B 3FQRB 1YNKL 5D6DA 3T4YA 5J1SC 4WEBL 1U8LB 3VFSB 1NCUA 5EWIL 4ZUSB 3BHBA 3N85H 5F1NA 3RVWD 1P5UA 2KH2B 4U6TA 3EUUA 1NBZB 3NCBB 3RTQA 3TIDB 1EMTL 4R8WH 1WAAF 3ZKXB 2R0LL 1NJ9A 4K7PH 4BH8A 3IFNH 3OR6A 3V5DB 1R5VA 1HHIA 3W9DA 4HSQA 3BVNA 4GBXA 4LPXA 2VLRB 1AIFA 1OF2A 1FFPB 4LOUC 2G9HB 3PQYA 3WLWD 2JELL 1FE8L 3AS3A 2AJVL 2DDQH 4JFHD 4RAUB 4WENB 4DAGL 2J5LC 4P23A 5FF6B 4V1DB 4GAJH 1IM9A 5GRXG 4K2UL 1A6AA 4EOWH 4R4BA 3H42H 3SDAD 1RSFA 4UDTB 1Q9KB 2PW1B 4OBRA 3VGHA 5KS9A 3T3PF 1IQDB 4YDLC 4KK6C 5TFSL 4OZIE 3WHE0 3MGTA 4G9FB 2O5XL 5CSBA 3GHBL 2P44B 3T0BA 1MQKH 4NQED 5DHVB 2B1AH 2V2WA 3MFGB 1IC5L 4PG9A 4QCIB 4URTB 4Y4KA 2AJYH 5JTWA 5ACMA 4GXUM 4L29B 4GKNB 1WGOA 4M9PA 5DMIL 3TN0B 1SY6L 3RVWC 5FA3A 2D0GA 2R2BB 2HFTA 3HMWL 3CMOL 2MQ0A 4NKIH 5KJRH 2NX5A 1D6EA 4U49A 3RNKB 4U0RB 3FO9B 4X0KA 2KPNA 2IFGA 1U41A 4G3YL 4DK3A 2HVJB 4LP5A 3WEXA 5IEHA 3OKKA 3U30C 4XVTH 4GJTB 5MEND 1KCUH 2VXQL 2J12B 4M43H 5T33L 1INEL 2R2EA 3AREA 3G6DH 1F3DJ 1YY9D 5JPMA 5GRUH 1Y18A 3SDAC 4AIXA 1MJJB 3WBDA 1MCDA 5D7JC 3T1WA 4MJIA 4MB3A 4C55A 2BNRE 3QUZB 4UV4H 35C8L 3IDMA 3VXSB 2R9HD 3GK8H 2UUDK 3FQTB 4GT7A 1OSZA 4LLWB 3T0VA 4BFBD 2UZIH 3DETC 1XCQA 1Y0LB 4OI7A 4U7SA 3MRLA 3MUGA 3MRDB 2YD6A 1HSAB 2DYPA 3W39B 3BW9B 3L1OH 4HKBB 1J87A 1CXHA 5B21A 5GZOC 2RFXA 2NTFB 1EO8L 4WRLA 3U7AA 1VPOL 2VLLB 5JMRA 1PSKL 1KPUB 1I1RA 4MNHA 1UVQA 5GQBA 1JNHB 5D8JL 3FFCD 3UC0L 1MCOL 1OY3B 4QOKA 2YEZA 3WFDH 1M05A 2A6KA 1A6WH 3G6JE 5ABDE 3ARDA 4AM0A 2ADGB 2V17L 2EDWA 1P4BL 4I77H 4N8CH 5FYLE 5CD3B 3QCTL 5IVXE 3BZDA 4O4YL 4JHAL 4NC1C 4P9HH 4H25A 2OP4H 5IVZB 1E4KA 4XPTH 2VYRE 1U8HA 3VRLE 4AT6A 3IS0X 1YNLH 1CD8A 4HK3N 4WV1A 2WANA 4WI8A 3FB8B 1TETL 3VMOA 2AK4B 4NM8L 4WJ5B 1QYGH 4MAYD 2GI7A 5CINH 3B4NA 4GAFB 4UT6L 4R26L 3T8XA 1KIRB 4PR5B 4FG6D 1GH7A 2R9HC 3QEHA 5EU4B 5HPOA 4KQ3H 4G9DA 1D9KA 3BKCH 3IF1B 2F19L 1LVEA 1IEAA 2A1WL 3K4AA 5DT1L 5BZDB 3BZEA 2X4PB 2XKUA 3CC5B 1YEDA 4RZCB 2AV7B 3TWCH 3ORJA 4DKFH 1WCBA 4AJ0A 5I19H 3IRZA 1WFUA 2V5YA 4GRLA 4DN3L 3HZMB 1QKZL 3VXQA 1KC5H 1T1XA 2ERJC 5I1DB 2IQ9H 5FO9A 4MCYB 3STZB 3FQWA 3A6BL 1NAML 2R56L 3ABZA 5EA0H 4WW2C 4IRZL 5CJBA 4ZTOH 5IWLA 1S7XB 4XP5L 4BM7A 1CN4A 1DBJH 3WO4B 2UZXB 2MMXA 4PD4J 3PUCA 4G8EB 1EERB 4FQXD 1A0QL 3GMNB 4HUKB 3O3DB 4K94L 5INCB 3VWJD 5KS9F 1P7QD 4JQIL 4P3DB 1YC7A 4K55A 1BGXH 2ATPB 1J1OH 2ZOKB 3NFPA 3QEGL 4JFZL 3QR2A 5A2FA 2V5RA 4H0HB 4JY4A 4MAYC 3KYMA 4V1DE 1KCRH 1S7UB 5DVKA 1U8NA 3LZFL 4JO2L 4MDJA 1NMAH 1EEUA 4FG6C 1U8IB 4K9EH 4QHNB 4TSBH 3MO1A 2YSSA 3CFEB 1OAQL 3JV6B 5DEZA 2ZUXA 5FYKE 3HC0B 4DJMA 6FABL 4FQHB 4Y2DA 1F42A 3GMRA 4X7TB 3BDXA 2E9BA 5CHNA 1T0MA 1SYSA 3L3HB 4G6MH 1OW0A 3BRFA 1T2QH 3FTGA 3B6SB 3G5ZA 3GEWB 3IJYA 1UZ8A 3BZFB 3KXFD 1KOAA 1ZTXH 4H26B 3KJ4C 3CFDB 2CUIA 1AHWA 5B3NA 1IC7H 15C8L 1FV1B 2N7BA 3PV6A 3TA3B 1UB5B 4XNZC 3W0WA 3T77A 1CR9L 3MRNB 4JO3L 4LVOB 5J1TC 3QDGB 1G9MC 3QWRA 5IUSA 3SKUD 4K7PX 5C3TA 1T66D 4YZFE 1A4KB 1K4DB 4FQXC 5L7XL 1GZQB 3VWJC 4NIKB 4PJIA 1MEXL 3VFUA 2DRUA 5KN5B 1E4XI 1IGTB 4OT1H 3CJJA 3L5HA 5EU7C 1OSPH 4HIHA 2EXYD 2VL5B 1VEPA 4YHNA 2AEWA 1BFVH 1EEZB 3AAZA 4H8WH 3VI4E 3WXVL 5FK9A 2Q8BL 3RHWF 2HRLA 4WFHE 4X4ZA 4X8JB 5E5RB 5L9DH 2A83A 2FX8L 1YPZE 3VFVB 3T08A 3NN8B 1V7MH 3KPOB 3VXSE 3TBWB 1QLFB 3EAKA 2QSTA 4MZ3A 5D93B 1GPOH 4WU5A 3SJVD 4G7VL 4QY8A 3FQRA 1MWAB 1JHKL 1CDJA 3EOBB 5DD5L 1U8LA 4I5BB 1G9MH 3ZDYF 2EH8L 4ZUSA 1ADQA 4HPOH 1OPGL 3RAJL 1CGTA 5CEXB 1NBZA 3WJLA 1X5YA 3CUPB 3TIDA 1S7VB 2ITDB 2VC2H 3V5DA 1FGNH 1UZ6E 4OCRL 1DQQB 4UTAL 1AGCB 3V6FB 5BRZB 3D1MC 4TNWK 2L0DA 3NFNB 4LCCC 2VLRA 5I66B 4LVEA 1FFPA 1XIWC 1T66C 1U58B 3LEVL 5E2UH 3GB7B 1NCWL 3QG6A 4XP6L 3WNNA 2I9LB 3U4EA 3MJ6A 1DQLL 1YEEL 4PFEA 4RAUA 3D3VD 3IAPA 5FF6A 3RU8L 5KVEH 2KQNA 1IILE 1UEYA 4WDIB 1S7SB 2GW5A 2EXYC 3GM8A 4MNQE 1T7YA 3WD5L 4UDTA 1Q9KA 2PW1A 1R5WB 2W92A 5B3JF 2B0SL 1XGRB 3MUJA 5FUZL 4KY1H 5A2JH 3FO0L 3LPWA 4G9FA 4FFVD 3MLUH 5HVHC 1TENA 4OZHE 4Z77B 5DUPH 4OCWH 5DHVA 4O2FB 5F1IB 4QCIA 3DJ9A 1F45A 4P2YA 1LQSR 1S7TB 1DQML 3MJ8B 4GKNA 5GGQL 3DX8B 4KKBD 5GGSY 5TE4L 5IESH 5ENWB 4N5EC 4MA7L 3TN0A 3VGFA 4PRPB 1TCMA 3PGCB 5C0CB 1FNGB 4POYA 2R2BA 5J13B 1YMHB 4J3TA 4RMTA 2F9BT 5TPWH 1EBPA 1MCSA 1LO4H 3RNKA 2BJMH 3GIVB 1AO7D 3JTSA 3QEQD 1X5FA 3G9VA 4W4OA 3CXDH 1QNZL 5DC4B 2ZNWA 5GGTL 1DANT 5DURB 4YHYB 3F7VB 4L9LC 5EZOH 4DW2L 2NXZB 5SWZE 2GTZB 4X80L 4KROB 4Q0XH 5KVFH 2C4XA 4XP4H 1MJJA 1VGKB 4ZNEE 5K59F 5C09B 1ITCA 3D5OF 3T2QA 3ROOB 3AM8C 4Q97A 3FQTA 1QFWH 4LLWA 1ZAGA 4FFVC 2J1KA 1IL1B 2DQCH 1Y0LA 2CKNA 5TDPB 1YEHH 3MRDA 1TFHA 5I73C 4DEPB 4JQVA 4L9DA 1AJ7H 1QBLL 3W39A 3BW9A 2H3NB 4HKBA 2FJHB 1KEGH 5JPNB 4JFOB 2IGFL 5HGHB 1LO0L 1GGIH 2NTFA 2K7QA 2CO6B 1DEEB 4NQVB 5C0AA 1IGFL 1KPUA 5CGYD 3TF7C 2WAHA 2X05A 1Y6MR 4HBCL 3NPZB 1JNHA 1GHFL 4BUGA 2J4WL 4EQ3A 4Z8FL 4HUNB 4MHHI 4UT9H 4AG4H 3S34L 2ADGA 2FX9L 4QHMA 2Z35B 5CJQH 1QFUL 3SKJH 2EEAA 2ICWI 3R4DA 5CD3A 2DLGA 3O2WH 4GXUN 5F70A 4G8GD 4X5XB 5IVZA 1X6LA 5AAMA 3VXTB 1BJ1H 2RHEA 3JUZA 1NC2D 3FB8A 4XMLH 4ODBD 2AK4A 4WJ5A 4UV7L 3HKFA 2CK0H 4ZSOE 4ZTPL 2VDLH 5DD1H 4QRUB 1TQCC 1KIRA 4O58H 2X5PA 4PR5A 4QXTB 3C2SA 5ILTL 3SO3C 3VXRE 4CW1B 2YWYA 3IF1A 2D9CA 1RUKH 5DEGB 5BZDA 4JFFB 4HXBH 5HHNA 4GRWH 2X4PA 1YEIL 3CC5A 5E95B 3LD8C 3K8KA 4RZCA 2AV7A 4FFZL 1RJCA 3HZMA 1BHGA 4NHCL 3MLXH 4LHUB 5CGYC 5I1DA 3NCYS 5MERB 4NSKB 4MCYA 5H2BB 3STZA 3WFCL 3QO1B 4LQFH 5GRVL 4HEME 3OGCB 1S7XA 3KAAA 3RKPA 1OAYH 1WISA 3RDTB 4JPWL 5BRZE 3MV7D 4G8EA 5F9WB 1A6UL 3GMNA 1NSNH 5INCA 2OYPA 5J0BA 1NAMB 5I8OL 2V9RA 3V4UH 4P3DA 1N5YL 4OD3L 1OQXA 3RVUD 1UB6B 3ULUD 2ZOKA 2J8OA 3O2VL 43C9B 3QQ4B 2JKXA 4ETYA 4CU8A 4BYHA 2E7LA 5FV1L 4UNVA 1MSPA 1S7UA 4YO0B 4K3DL 5BCAA 1FORH 3QDME 4AH2B 1U8IA 4QHNA 4FABL 3B9KB 3CFEA 3JV6A 1J1XL 1V5JA 3HC0A 4OLUH 3MOAH 4KU1A 4X7TA 2MPAL 4NOBA 3O6LH 3SQOL 2AK1H 3L3HA 5F93C 4YZFF 2F8XC 4M6OL 5E8OB 2AAVA 1DLFL 5D7LE 4LIQE 3O2DL 5FM5O 1F6AB 3B6SA 3MV11 3LQMA 4WFFD 4HLZG 4OFKA 5T3ZL 4YE4L 2VXSL 4H26A 3PWNB 5I17B 2X7LB 4ONGH 3CNKA 3CFDA 1LP9E 4AQ1B 3ZE2F 1FV1A 1BREA 1UB5A 1BF8A 3Q0HA 3MRNA 1A6VH 2MHAA 3QDGA 3C6SB 3VXOB 5C0JB 1UYWL 2EIBA 1A4KA 1K4DA 2CIIB 4KKLC 1GZQA 2EYRB 3FZUD 1Q94B 1IMHC 2EE3A 4YBLB 3RVUC 5KN5A 1IGTA 3ULUC 5E2TL 3P4MB 4D9QE 3TT1H 5BV7C 3HG1E 4JPIB 2R1WB 2VL5A 1FNLA 1LO2H 2HTLD 1MPAH 2Y07H 4DFIA 4OD2B 1EEZA 2VAJA 2VL4A 3T2PA 1F13A 4QHKI 5BO1H 5D7KE 4X8JA 3MJ9L 3KYAA 3VFVA 1E4XL 2BX5A 3NN8A 3KPOA 1H9VA 4I48B 3TBWA 1QLFA 4GKOA 2GEEA 1VFOA 5AYUH 3H9SE 1OTSD 4WW1A 2X4OA 2LVEA 1MWAA 1RIVL 4YC2B 1CF8H 3EOBA 3B3IA 4I5BA 1E6OL 5DSCB 2M26A 4MCZB 4LDEB 1VKXB 4LHJB 1CGVA 5E6YA 1UH3A 2JCCE 1CDUA 4ZUWB 5CEXA 4JHBA 3MREA 1MJUH 2GUOB 3CUPA 2GCYB 5D71H 1S7VA 2AJUL 2FGWL 2ITDA 4PTUB 3ULVC 3ULUH 4P4RB 1DQQA 3M17B 1AGCA 3V6FA 1AFVL 3NFNA 3GJEB 5I66A 3RVXD 4APQD 1KTRL 2W0LA 4NKOB 4DGYL 4FXGB 2D03L 5ICXB 1U58A 4QRPD 1UM5L 3GB7A 4RMWA 2I9LA 2FRGP 3FZUC 5FV2A 4OLWL 5CILL 3TJHC 3QIBC 1GC1L 3DRTB 2QQQA 5ADOL 4FNLH 1K8DB 2IBZY 2K7PA 4D2NA 3NCJH 4WDIA 1S7SA 3KHQA 4RFEB 5FHAH 4BZ1H 2HTLC 1RZ8B 4GLRH 5DFTA 4P2OB 3CDGB 1R5WA 3IDIB 3L5XL 5I30L 1XGRA 1M7DB 2WUBL 4JR9H 4GSDH 5IR1B 5FCUL 3CIQA 2CMRL 5D1QA 4Z77A 5E2VL 4IIQB 4O2FA 4JB9H 5CIPH 2HLFD 5F1IA 3FCTB 1P7HL 4XCNB 1OTSC 4JZJB 5T1KB 1S7TA 3K2UH 1A7OL 3RJQB 3MJ8A 3DX8A 4YDIH 3QWOB 1J88A 5ENWA 4KRLB 2JB5L 4PRPA 3QSKB 1KJ2H 1OVZA 2E6PA 3GSVB 3PGCA 5C0CA 2C3VA 2YA1A 3ARBD 3BKMH 1IM3B 1FNGA 4MQTB 3T2NL 3ZTJH 4LRNL 1YMHA 7FABH 3NAAL 4X9FA 4HX1B 1HHHB 2VXVH 4G7YL 1QFWM 3SDYH 5IFHL 3GIVA 2FIRT 2VOTA 4XNYH 2VNCA 5KOMC 3V5HB 4APQC 3BKJL 5ALBL 2VLKE 3WIHH 2VH5L 3F7VA 4G6KH 4JG0L 1WEJL 4RBPH 3NFSH 1O7VA 2GTZA 3D25B 4Y5XB 2P7TB 4PJ8B 3I75B 4Y4FC 4RFOL 1I3GH 3U2SB 3CSPA 1T21B 3GIZL 1VGKA 2EDEA 4LASL 1DVFD 5C09A 3V4VL 3ROOA 3PXHA 3WS3A 4ZAKD 1KSRA 5DR5L 4M1DL 1IL1A 1DBKH 2NQCA 5TDPA 4LCIH 2HLFC 4MMXC 2B4CH 2H1PH 2H3NA 3P11L 2FJHA 4IS6A 5DMGD 4QXUH 4JFOA 5JPNA 1PG7H 1MJ8L 4HDIB 2I5YL 3HMXL 4HAGA 1DEEA 4HC1L 4KHXH 1GXEA 4F15B 5B38G 1B0WA 1MHCB 3ARBC 5JW3L 4MDIB 4DCQB 1DN2A 1OWWA 5E0QA 5L8KB 4HLJA 4WUUD 1NAKL 2D4DA 5JIIA 3QFJB 2ZCHH 2VZOA 5JOPD 1KCVH 4NZTL 2FBOJ 2GK0B 4LGPB 2Z35A 5HI4D 4NO5B 4YXLH 3PF2A 4Y4HB 4X5XA 2AW2A 2Y5TB 3IT8D 1OL0A 1M7IB 3VXTA 4U1IA 1HQ4B 4Y1AD 1BWWA 4X6CB 1KTDB 2EDOA 4ISVB 5HD8D 1I1AC 4QTIH 4XMKL 1YMMB 4JFQB 4QRUA 1DVFC 3UTTB 5KVDH 1E27B 3H2WA 4EDWL 4ZAKC 4CW1A 3QP3A 4ZFZA 2VXTH 5CJOL 5DEGA 5B4MC 4JFFA 2W1NA 5ETUB 3F65A 2GYSA 4JRXD 4TNVF 3BRGC 5K93A 2CRYA 3FT2B 4JFPB 3O6ML 4X4ME 3GSUB 4LHUA 3H3PL 4GQ9L 3VXME 5MERA 2WQ8A 3MLWL 5H2BA 1NCNA 2CSPA 5KSBB 1ONQB 4X5WB 1HDMB 3KNBB 1QPPA 1J11A 4F7EB 5LGHH 3OGCA 1NL0L 4K71C 1XF4B 1H3GA 4GW5B 5ECJE 5DFVC 1ZGLB 5GZND 1F3JB 3RDTA 4YHML 3PHQB 3KPRD 3R1GL 1GVIA 5HI4C 2W0FB 2WP3T 1BOYA 3OF6D 1S8DB 5HY9B 1NAMA 3QXAB 2WBJB 3ZDXF 3WJJC 1NCBH 4C83B 4L3EB 5IBTL 1UB6A 1CFTA 3EDFA 5DD6B 1OP9A 4KI5E 43C9A 2B2XL 2OMBA 4JRYD 4DKDC 3QQ4A 3ARZA 3QXDA 3HRZB 5I1JL 5AEAA 1W8NA 2F54D 4GG6B 3HHRB 4P2RE 4YO0A 5CGMA 4AH2A 4XVJH 5C0BB 3B9KA 1EPFA 1FHGA 1JZ3A 2R23B 5EULV 2HKFL 4RWHA 2H9GB 4MD0B 1H8NA 4NGHH 5KSVA 1MY7A 2XRAH 4WCYH 4UNTA 3WDJA 1J18A 2WUCL 3RWDB 3QISA 4Y2OA 1F00I 5E8OA 1K3ZA 3VWKD 1U91B 1X7QA 4JKWA 2VWEE 4JZNB 1F6AA 5EORH 4IRJB 4M7LT 4LFHD 4ZDHB 1G9NC 2X09A 2C5DC 2YKLH 3PWNA 1TIUA 5I17A 2X7LA 4OF8A 4XNXL 3IJHA 4P46C 4MXWL 4PJDB 1WZ1H 5DDHB 5F7NC 1LO3H 2NY1D 3C6SA 4YXHL 3VXOA 2BSSB 4RGOH 5C0JA 3B9VA 4AENB 1AXTH 4RA0C 2CIIA 2PO6C 1ZHKB 2EYRA 3U1SL 3RIFF 1TTFA 3RVTD 3WFHB 2QQKH 1Q94A 3FB5B 2EYSB 1P2CB 2D7PA 2WP3O 1FYTA 3RWIB 3P4MA 3D39D 3W9EB 1L7IH 4HHAB 3RWHB 4JPIA 1RI8A 2R1WA 3BRDA 1V3LA 4OD2A 3I85A 2NY7H 3MV9E 2MKWA 4YGVB 5C71A 4EI5D 1HXMB 4JM2B 1V7NH 4FQQB 3WFDL 3RZCA 2AQ2A 3CFJB 5F7DB 5GSVB 4Q7DA 4I48A 3QG7L 4LCWE 2HKHH 2PXYB 1U6AL 1ZVHA 5IJVB 5HVWA 1ROWA 1BIIB 5SWSD 1OHQA 1SBSL 1UWXH 4NQDB 3RWFB 1T1ZB 5ITFB 1Q72H 1HKFA 2PYEE 4N0FB 3VWKC 1U8MB 2G5BB 4M6MH 1B9ZA 1BZ7A 3EYUL 1F8TL 4HUXB 5DSCA 1VSCA 4MCZA 1VKXA 3S88L 1G7MB 2R0KL 4OCXH 5HHVL 4PS4L 2GUOA 5HYEA 2B20A 4X6FB 2DQIL 9CGTA 4PTUA 4PJ7B 4P4RA 3GJEA 3FB6B 3V8CA 2R4SH 4FXGA 1OAZH 3BKCL 3W5MA 3LB6D 3RVTC 4ODSL 1VA9A 1OGAD 4DQOH 1FYHB 3DBXA 1HYSC 3DRTA 5H8DA 5D7IE 3NPSC 1K8DA 3CLEL 3UAJC 1FVDB 1HYRC 4RFEA 1RZ8A 4P2OA 5TQ2H 5ESAB 5F8RC 3IDIA 4YAQB 5ESVB 2OL3L 4KDWA 1M7DA 4OLVH 5DA4A 3TIEB 4EI5C 4B5EA 4CL7A 4MVBD 2XOTA 5IR1A 1JPFB 3RUGB 3H0TB 2NYYD 4IIQA 5GRJL 3FCTA 4OLEA 4XCNA 1P5VA 3AY4A 4JZJA 3SDDB 5T1KA 3IDYB 3QWOA 2DQUL 1CGYA 4YPJA 3MCLH 1AKJD 4AEIL 1V3MA 3GGWB 4JPVL 4Z5RB 1A3LH 1PG7X 3G08B 3MLYL 1I9EA 4PG2A 4HX1A 5F7YC 1HHHA 3MLVL 5D5MB 3X3GH 1CWVA 3P30L 1I8LA 1KT2B 4I2XB 1T7XA 3CFKB 3PV7A 1VACB 1BM3H 5E1AB 3QUMH 4TPRH 3V5HA 1W72H 4TSAL 4DVRL 1QO3B 3PJSB 5C08A 4Z0BH 1JE6A 4GKZA 2ZPKH 3NIFE 5KSAC 4CJ1A 1CICD 3LB6C 1DBBL 3RL1B 3BYTA 1HH9B 5IW1B 1PAMA 2ESVD 2NY5C 5MHSE 3ULSB 4OF6A 4WI6A 4G6FB 5M95B 4Y5XA 1D6VH 2O5YH 2P7TA 3I75A 3HB3D 4PJ8A 4UUJA 5HI5D 5DC9B 5C0IB 2AS5M 3U2SA 1I1YB 3ARGB 1T21A 2O93L 4G5ZH 5GGTA 1R3LB 3VA2C 1OQOA 2HMID 4IEFB 4XHQA 1UT9A 1CGXA 1LK2B 3MBXL 5DRZB 5CKGA 4MVBC 1AC0A 1BD2B 3NZHL 5JQ6L 4BJLA 4G6JH 3HC4L 1FGVL 4DK6A 5FO7B 1HKLH 4UNUA 1BJMA 5I1HL 1L7TH 3X17A 5D9SB 1HH6B 4HDIA 2D0FA 3T65B 2X1WL 5CLWA 1MHCA 4MDIA 4DCQA 2YPLE 1MLCB 2DS4A 1IRAY 1NBVL 3EOYG 2NY5H 3QFJA 1GOGA 2N7AA 3MRKB 3V6OC 1KLFA 2IAMD 4K7PY 3T0DA 1PDKA 2R0WH 2IMMA 2GK0A 3DGGA 1ZT7B 3GO1L 2LABA 2KZWA 3RHWK 4CN1A 1FIGL 1MF2H 4NO5A 3X3FL 4KTEL 5J57B 4Y4HA 5EN2B 1F4AA 4U33A 2Y5TA 2YD9A 1M7IA 2DLIA 2P1YA 1HQ4A 4OF3A 4PLNC 4HK0B 4X6CA 4M7JL 1KTDA 4ISVA 4L4VE 2FR4B 5F7UA 1YMMA 4DFHA 1MFNA 4JFQA 4Z7VE 3UTTA 2EIZB 3MV8E 3SDCC 4IRSD 3MOBH 1WCQA 1H0DB 3EYSL 3UO1L 3HUJE 1IARB 2OXGA 5A40E 1K4CB 4HIXL 3O6FC 1HINH 2BRRH 2VN4A 4K3EL 5FGSA 4GLRI 2ICWB 1NUNB 1YEFH 2CDEB 2RBLA 5ETUA 4NQDE 5IGXL 5F7HA 1N2RA 4JFPA 3FT2A 1S7QA 4YLQT 4HG4J 4KK5D 2F5BH 2FH6A 4QWWD 1JP5A 3LKQB 4LU5L 3OHXB 4P9MH 5BW7C 5FYJL 5KSBA 1ZMYA 3BWAB 5T3XD 4X5WA 1HDMA 3KNBA 5D72H 1RZFL 4F3FA 2IAMC 4F7EA 3VI3F 5I9QC 3IU3B 2B8OT 1XF4A 3Q6FB 1IE5A 2Z0BA 1ZGLA 3ALWA 5I1GH 3PHQA 3HI5H 3U36B 5B39G 2H8PA 2W0FA 2XZQL 2X89A 2Y25A 1KGCE 1S8DA 5HY9A 5B8CB 1D5MB 1NFDE 3QXAA 2WBJA 1EJOL 1YNTB 4ELMB 1ZSDB 4L3EA 5C0FB 1ODAA 5DD6A 2HT2D 1TXKA 2LU7A 1NEZB 5E70A 1C7TA 3BZ4B 5T5NF 3HRZA 1DBAL 2VAAB 4BQBA 4HKZB 1AGBB 2RJMA 4GG6A 5C2BL 1C5CH 1CL7H 1DN0A 2BSRB 5K9QI 1KFAH 5ACLA 3S35H 4IRSC 5C0BA 1C12B 5AUMB 4KHTL 2R23A 4ELKB 2H9GA 3O8XD 4MD0A 1UKQA 1S7RB 1RIUH 3ILPB 4FN0A 2ADJB 4QKXB 1IAII 3NACH 3RWDA 2O61A 5D6CB 1U91A 4HMCA 4PD4K 5I1IH 4P2QE 4DN4H 4JZNA 5CJXC 4IRJA 2ZUWA 3ZLQC 4ZDHA 5I0DA 2J5LB 2F15A 4HJJL 4UB0H 3DXAD 2NPLX 4QWWC 4H1LA 4Q0XL 1J5OH 2C4FU 1TMCB 4XPBH 4GMTL 3MRHB 3EHBD 4PJDA 3OAYK 3O2DA 5DDHA 3BGFC 3EFDH 4MX7B 4YDLB 5DHYA 2BSSA 3EFFB 1IEHA 1KN2L 4AENA 5DEFB 4PPTA 4WU7B 5D7SL 3FB5A 3CVHL 4KFZC 2EYSA 1P2CA 5CUSL 3L5WB 3RWIA 1VERA 2HT2C 1Y6NR 2VLJD 3W9EA 3P4LA 5EUKB 5GJTH 4HHAA 3QDHA 4ZS6C 3RWHA 4NO0B 4OQTH 3SO5A 4OKVB 3TH4T 1ZOXA 1QA9B 2Y4SA 3MACH 4LSPH 4YGVA 3BESR 1T83A 1MCPL 4JM2A 4NN6B 4FQQA 3VU2A 1AQDB 4JKPH 1A7PH 5F7DA 5GSVA 2D7QA 3OKYA 1GYAA 4HS3B 2PXYA 4K8RD 5IJVA 1E28B 1BIIA 3GMLB 3QCUL 3E2HC 5L88H 3RWFA 1T1ZA 5ITFA 1T2XA 1BQLH 1PFCA 4KK8C 1QOKA 4N0FA 3U30B 1U8MA 4GG8B 2C1PB 3ZYJA 4XNUL 1IFHL 2G5BA 1WQVT 1QSVA 1BOGB 4HUXA 3MJ9A 1MJ7H 1G7MA 2EC9T 4LPUA 4M4RA 4X6FA 2OX5A 5D7JB 2B39A 1RUQL 4PJ7A 2R69L 3EHBC 4P5TC 4X6CF 4NWTL 1WIUA 1A7NH 4HS8H 4LSRH 4OFVA 4RMQA 4OZ4B 3I9GH 1TCRB 1U8QB 3DECA 4ENED 4KGLA 2UVFA 2NZIA 3SE3C 3WKML 3IRPX 4DUXA 3SDXB 4GXVH 1FVDA 1A7BA 3A6OA 4BK5A 2P4AB 1QG3A 4YAQA 5GIRB 3TIEA 3KPSD 5TQ0L 3S4SB 1JPFA 3RUGA 5HYJA 2J2ZA 5HGBB 3H0TA 4CU7A 5BVJB 5DJ0B 4K8RC 2A38A 3MRIB 5KSBF 1XF5B 3SDDA 4EKXA 3R0NA 1JUFB 4RMUA 1YQ2A 1BQUA 1JPSH 2OL3B 2VDQH 4KDTC 4RRPG 4O02H 1FNFA 1JMZA 3GGWA 3NGBC 1M4KA 3QDJD 1FNSH 1KLGB 2DQDH 1OT1A 2PW2B 4QRQA 2X9YA 3VA6A 5D5MA 2FH8A 2ED7A 1RZ7L 1KT2A 1TPXC 1U3YA 4I2XA 2YXMA 3HAEG 3CFKA 3P0VL 1FORL 1VACA 5E1AA 4E41E 4OBSA 1QO3A 3PJSA 5DJAB 1JFQL 3NIGF 4GG6F 5L2KE 4XHJD 2XN9B 2FBJH 4OLUL 5JO5B 3RL1A 1HH9A 5IW1A 4YHKL 5HYSG 3RA7H 4ENEC 4X8XA 4BSWB 5CZXC 1R0AH 1AD0B 4X7FC 4OUUA 3GMQB 4K8RH 1R5IB 4TULH 5C0IA 4QRRE 2IFFH 1I1YA 3ARGA 1C8PA 4J3XA 1R3LA 2ERJB 2IPTH 2GJ6B 2OBGA 3MUHL 3BQUD 3MSPA 3VXUE 3IFLL 1LK2A 3FFCB 3WMSA 5DRZA 2E7MA 3NVQA 3DVNB 5IJKA 4WW2B 1BD2A 3MFFB 2EH7L 2FLRT 2NY3D 3BEVB 4IOIB 1BAFH 5LKNA 2Z8WC 4L5FL 1EAPB 2YWZA 4L4JA 1JNLL 2VIRB 5BMFL 5FO7A 2JE8A 2Y06L 4NQSB 4PJDF 4M3KB 3U7WL 5D9SA 1DE4B 1HH6A 3ARRA 4ALAH 3HE6C 4GS7C 3K80A 1MLCA 1WBYB 5BOZG 3C6LD 1JL8A 4HGWB 4MAYB 3MRKA 5FYKD 4HJGB 1XEDA 2WINA 3O0RH 1F4WH 4KUZH 1ZT7A 3HMXA 2VB5A 4HC1A 2BOBB 3QPQD 4XHJC 3RBGA 4QXGH 1PVHA 2ZSWB 2L7JA 5EN2A 3W11C 2VZUA 4JM2F 2XQBH 5DQDL 3UJIH 4HK0A 1DFBL 3I6LE 3WS6A 2FR4A 1A8JH 4LLDB 3SE8L 1HILB 1D5ZB 3OJ2C 1I1FB 3GJFA 1WZMA 3BQUC 3CK0L 1CGSH 3KJ4B 2EIZA 4Y8DC 3WSQL 1H0DA 4XNZB 4N1HB 2NY3C 2WMPA 1EGJL 3S35X 5BV7L 1MOEA 2G60L 1BPVA 4L1HA 4PJ7F 4FQXB 2ICWA 4EVNA 2CDEA 3BPOC 1P7QB 1RUAL 1FNHA 4PJ5E 2P49B 4NO3B 2CO7B 4WHYH 5E00B 4JFHE 1BQHB 3LKQA 3OHXA 3C6LC 1YYML 3BWAA 4WFHD 5DD3H 5I1EH 1NCAH 3B2VL 1ZKAA 5JQHC 4NZRL 1U8JB 1F4YL 2W38A 3IU3A 4YWGH 1SMOA 4I3RH 3Q6FA 3MUZ1 5DJ8B 3SGDI 3SE9H 3U36A 3CXHJ 3T0XA 3UMTA 4M6AA 3QPQC 4IOFD 3GNML 1FAIH 2MCPH 5B8CA 1D5MA 3O81A 3CPLB 1YNTA 5E4IA 1ZSDA 4ELMA 4U1KB 3FMGH 3ULVL 4NQEE 3E8UH 3RUGF 5C0FA 4GAGH 1PGRB 4ZXBA 1IGMH 1T7VA 3R8QA 3L3IB 1MFCL 1XR9B 1ND0B 1NEZA 1HQRB 4X6BB 3BZ4A 3VDCA 1S78D 3KXFB 4UILL 4HKZA 1AGBA 3DI2B 3BUYB 5DJCB 2BSRA 4Z7WE 1JRHH 1KEML 4LMQE 5FB8B 1C12A 4AEEA 2BCKB 5AUMA 5JHDE 4XPGH 4ELKA 3MXVL 4M6NH 1S7RA 3ILPA 3MCG1 5D5MF 2ADJA 5SV3A 1XIWB 5FCSH 2R29L 5FYKH 1WWCA 3QUKA 4PJEB 4OZFG 5D6CA 1KULA 2MKLC 4NKDB 3TESA 1CU4L 2Q76A 3H7LA 4MNQD 4LLYB 5KOVC 1XFPA 5MENE 1UWEH 4LAQH 5HPMB 3HNVH 5C0RH 3P0YL 3MRHA 1IAIL 2C3WA 4OQ1A 2CPCA 4KWUA 5E2WH 1KB5L 5JIPA 2X4UB 4Q9QL 4MX7A 2AV1B 3EFFA 2FX7H 1Z9SA 3WLBB 5DEFA 2HAZA 4WU7A 4YHIA 3A6CH 4XNQB 4MAUL 1NGPL 3L5WA 1OCWH 3QULB 5EUKA 4AL8L 1DL7H 4JFED 3U4BL 1S78C 4OV6F 3SOBL 4HWUA 4NO0A 4OKVA 5JHLL 5C07D 5FA4B 4YHOL 4LVNC 1OWRM 1RULH 3CVHB 5ITBL 3OXRB 5FDYA 3BE1H 3OPZL 4C56B 4S1DD 5I71C 4HS3A 2ICCA 3BDBA 4X6DB 1E28A 5DD0L 3GMLA 4WNQB 3PWPD 1RZJH 1CE1L 2G5RA 4LSUL 4L9LB 2DBLL 4GG8A 2C1PA 4XXDA 2Y6SD 4BQ6A 1IGIL 2NZ9D 1BOGA 2CDFB 2C4FT 3D3VB 3V5KB 2YC1B 5FEBA 4YDKH 4F9LC 3OZ9L 1QZ1A 4P59H 2V5SA 4WI4A 1MRCH 5DZLA 3NIDF 4X5LA 5D7JA 2D4FA 3HNTH 3IDJB 4J3OC 3C60D 2DM3A 3S6CA 3BMVA 4HGMA 5IFJB 4YXKL 4LLVB 4S1RL 3ZT6A 1FBIH 3DX6B 4FXLA 4LEXH 1HHKB 2CR3A 4QNPE 1MRFL 1U8QA 5I73B 1X5AA 1QHOA 2DQEH 4PRHD 3F8UB 1MCEA 4LARL 3CGTA 4XPFH 5I0ZA 2DQTL 2ZJSL 3N06B 3BPLC 4TNVK 3SDXA 4LGRB 4MZ2A 4HH8A 1NBYB 4FHBD 4L4TD 1T20B 2BVPB 5EZLB 2VUYA 5GIRA 3EIFA 3BIKB 2YA0A 3TT3H 4I0PA 4Q9CA 3S4SA 1AO7B 3QEQB 4FP8H 1V3JA 4S1DC 5BVJA 5DJ0A 1I9IH 2PTVA 2AI0H 3MRIA 4Z6AT 3BDYH 4Z7QF 1JUFA 3DIFB 3CVIH 1CL7I 4Z7UB 2OL3A 1BFOB 2Y6SC 1KLGA 5JXAH 5AZ2L 3CD4A 3GRWH 1R3KB 2PW2A 1WWBX 3SGKA 3WNKA 4ELMF 1DQDL 2LV4A 3J8F7 1GGBL 1AH1A 3N0PB 2ATKB 3GI9H 2Z93B 3MLTB 3C60C 3TV3H 3SO3B 3BEWB 2VRAA 5DJAA 1IZKA 5JDJA 1E6JH 2XN9A 2H26B 4JVWA 5JO5A 4L3AA 1MIEL 4XC3H 3LD8B 2EDJA 2MTPA 4N0YL 2ZOLB 2LAGB 4BSWA 2HWZL 4ODHL 1AD0A 4MNGB 4R2GD 4OTXH 3GMQA 1R5IA 1WTLA 4PLKD 2DB8A 2GJ6A 5I74B 3FL7A 1P53A 2CIKB 3FFCA 3IETB 4PJFE 3B83A 3NMEA 4RNRB 3MFFA 3BEVA 1J05B 4IOIA 3D0LB 1CVSC 3CSYB 4TSCL 4QGYA 1EAPA 3TEUA 2VIRA 4MS8D 2P45B 2NY4D 3ARUA 4NQSA 1KBGH 4FMFA 3VGEA 4G8GB 2IH3A 1DE4A 3CFCL 4TQEL 2HG5B 4P5KB 4NJAL 3F62A 4M5YL 3UBXG 5CEZD 3T4AB 3QDMD 4N9OB 1NLBH 1WBYA 2Z91B 4RGND 5T5FL 4AYFA 1MAMH 4HGWA 4MAYA 4HJGA 1AE6H 2X4SB 4PJCE 4CJ0A 5E8NB 2HJKB 2VXUH 1ZEAL 5SX4H 3GBLA 2BOBA 4NT6B 5KZCD 1OP3H 5HSFA 1G9NL 2DM7A 3M8OH 3Q6GH 4BQ8A 5FXCH 4QTHB 5HGGS 1PZ5B 1KCSH 1RZKH 4R2GC 1TVHB 3EZ8A 5D70L 5GS2D 1CFQA 2VZVA 3SJVE 2DI8A 1AGEB 4LLDA 4PLKC 1HILA 1D5ZA 1I1FA 3T04D 2PR4L 3MLRL 1RFDH 1MCRA 3S3PA 3KLDA 3N50A 2FATL 3TPKA 3WO3B 1QVOB 3JWDH 4CAGA 3TYGL 4FFYL 4YH6A 3MV7B 4FQXA 1FJ1B 4UTBH 1OAKL 5CD5C 1MAJA 1P7QA 5IHBA 2HT3D 5T1DL 5F7EL 2VR5A 4PJGE 2GY5A 1A5FH 1Q0XH 2RB8A 1IKNC 1PD6A 5KVGH 4NO3A 5E00A 1AI1H 4RGNC 1BQHA 4Q58C 5BV7B 1ULVA 1CFNB 5D7KD 4ZPVB 4Z7OE 2L7UA 3KPMB 3OB0K 1U8JA 4TVPD 1J0JA 1VCAA 4CNIB 3SKNB 3SDXF 1LDPH 3HZVB 2F8VA 3H9SD 3QZWG 3WCYA 3OGOE 2VDMH 1HCVA 3C09C 2XA8L 2R2HB 2X42A 3CPLA 4ODVL 1UEMA 4L8SC 4A2MA 1KJ3H 4U1KA 3QQ9D 1MFEL 1TLKA 2SEBB 3L3IA 1CXKA 1XR9A 5FM5M 1B4JH 1ND0A 4HWBH 1HQRA 1XGYL 4X6BA 1ZLWK 3KXFA 2Y72A 3QIUC 3BUYA 4EIGB 4NNPL 5DJCA 4I18C 1T1WB 2NXYD 3QCVH 4D94A 5FB8A 1OP5K 2BCKA 4OZGB 4LNRB 5CEZH 3F12B 1B0RB 4GRWE 5FFLA 4UT7H 4HULB 1B2WL 1CS6A 1QBAA 2EDRA 1BEYH 3RWJB 1XIWA 2APFA 4X98B 5D1ZB 3JVGC 3C2AL 2EE6A 4PJEA 1MNUL 3GSWB 5EUOA 3GM0A 4KTDH 4PP1D 4WEUD 1P6FA 4NKDA 3FOLA 3QIBB 4LLYA 3DSNA 2WWKT 4K23H 4KPHH 5D4QA 1FZMB 4C54A 5HPMA 5D2NE 3KR3L 1GOHA 3OAZH 3P40A 3WN5C 1I4FB 2NTSP 3HNSH 1KYOJ 1FPTH 2WK2A 1O0VA 3WFEL 2F74A 2X4UA 3NCEB 4Y5VC 2AV1A 4XC1H 2EKSB 1U3HD 3QH3B 3VRIB 3WLBA 4F9PA 2A73B 5IKCB 1MFDH 1VEOA 4WW2F 1AQKH 2A9MH 4XNQA 3QQ9C 1I9JH 1RQ5A 1RAMA 1KB5B 3QULA 3MRBB 1N26A 3L5JA 1Z5LB 4LPYA 2BDNL 2ADFH 5EU6B 3LVEA 1CFVH 2VR4A 5FA4A 4CN6A 3CVHA 3GBNH 2V2TB 4C56A 4JFXB 4NRXB 4FQJL 1GAFL 1P84J 4X6DA 3GHEL 4U31A 1MHPL 3VGDA 1ED3B 4WNQA 4QRPB 5IMMB 3WIFB 4JN1H 4TVPH 4L9LA 4F58H 2YRLA 3QRGH 3QYCA 3V5KA 2CDFA 3D3VA 1FFOB 4NNXB 2YC1A 3H6JA 5B22A 3S96B 2UWEB 3EJYC 3U83A 2F53D 4Y4FB 1ACYL 5F9JB 1G1CA 1JGVH 4JO4H 3FQNB 3S36H 1ZA3B 3IDJA 1JZ7A 3DROA 3AM8A 1UADC 4M7LH 4JPKL 5J11C 4LLVA 2ARJB 3F58H 5A2KH 5DLMH 4KKCD 3DX6A 1NMCC 3NTCH 1LE9B 5KAQF 1WSST 4S0SD 4CKVX 3LKSB 5IP4A 3D18B 2J6EL 4ZD3L 4U1NA 4MB4A 2EEBA 1JGDB 3MBEA 2W65A 1NBYA 3GBMH 1T20A 2BVPA 4AMKL 4G42B 5EZLA 3RZWA 2QQLH 4PTTB 1RMFL 4DGIH 3BIKA 1EFQA 1AO7A 3TBVB 3QEQA 2YK1H 1UH4A 5IBUB 1LE5B 2APXA 5D1XB 1G7LB 3VFMB 4Z7UA 3IKKA 1RVFL 4BKLB 3WFBL 3E6HB 4ZS7H 1BFOA 3N9GH 3ZT5A 3O6KL 1T5XB 4RMSA 1N6QL 1R3KA 2BNQB 2DD8H 1I1AB 3D0VB 5HHQB 4WY7L 3ULUE 1S5IH 3LHPH 2A9NH 5E08H 1JYWA 1DVFB 2ATKA 5HHOD 1CL7L 2Z93A 3OJDB 4XP9H 3MLTA 1PLGL 4ZAKB 3BEWA 1HE7A 1NFIA 3GUTB 3TC9A 4U2ZA 1AGFB 4KKCC 3DMMD 1JWUB 4FQ2H 2H26A 4M7KL 4UIKH 1HHJB 4MNGA 3VXMD 1NLDH 3DLQR 4BFGA 5BS0E 4PJEF 4XVSL 4WFFE 1LHZA 2CIKA 3IETA 2PKDA 1T0PB 2FECI 1HN1A 1TITA 1WIOA 4RNRA 5C9JB 4K71B 1J05A 3D0LA 1YN7B 5L8JB 2IG2L 1JNNH 2OCFD 4HF5H 3T0EE 4JKMA 2XNAB 4G8GA 1OARL 3CZJA 5JXED 2HG5A 4Y1AB 1X3DA 1UACH 3W2DH 3LKPB 4XP1H 4Z95L 4Z9KB 3T4AA 4ONFH 4PJXE 2XQYG 2JIXD 4N0CC 3DSFH 1OAXH 3AU1B 4AK1A 3LN9A 3TGXA 2X4SA 1ZWIB 4HFUH 5MEOA 3C87A 5E8NA 3EKCA 2HJKA 4H88H 4J1UB 3OAUL 3U82B 4NT6A 1MI5D 3V52L 3I84A 4OGXL 3DMMC 4GUPA 3D9AH 2GQHA 4HWEL 4QTHA 5ADPL 1PZ5A 2ZUVA 1RUPH 5T3XL 1RIHL 5GRYA 2P5EE 5AD0B 1TVHA 3O11B 4JRXB 4X6DF 3W5NA 3DUUB 5KAQG 4G8FB 1LEKB 4Y5YC 1AGEA 3ELAT 1QRNB 4HT1H 1U8OB 3MLSL 4LSVL 4OFPA 1B0GB 1D3CA 4AIOA 4WGWB 3EDJA 4KUCD 4P46B 1GL4B 2GAZB 2W07A 4PB9H 1QVOA 3RTQD 3THML 2BHUA 4YHZL 3VMNA 1A7NL 3NABL 1LK3H 2YMXH 3KPRB 5MP6L 2FD6H 3MV7A 3OL2A 5D2LE 2PO6B 1FJ1A 3OG6B 5HHME 1F6LL 4GBXD 3RNQA 4UINL 4DTGL 4NWUH 2W9DL 3UDWC 2V2XB 5DVOA 4JRYB 1EGJA 1C7SA 5BXFB 2VSDA 1BBDL 1CFNA 4ZPVA 4XNMB 3KPMA 3EOTH 3OR7B 4LCWD 1IM9D 2P8PB 1I3RB 4CNIA 3PHOB 1SEQL 5GGRB 2WLYA 2AEPL 3HZVA 1YQVH 3LIZL 3WFZA 5ALCL 4XWGH 3IKCB 1WZLA 2O5ZH 2VWEC 2B1HH 1H8SA 2R2HA 3PGFH 1WT5A 3C08L 4LK4A 5FO8B 4XCCL 1F5WA 3VWKB 3TBTB 4MD4B 4TTGA 1JI1A 4PGBB 2SEBA 2CGRH 3QHZH 4Y4KD 1JTPA 4KVNH 4Z7UF 2PN5A 5ISZE 1IEBB 2W9LA 4HG4K 4PRIE 4M1CD 1T1WA 4TNWF 1JZ2A 2J8UB 1YDPB 4OZGA 4LNRA 3F12A 1B0RA 4ODTH 4EQ2A 1EFXD 2R4RH 1YA5A 4LLQB 2NX5D 3WXWH 3RWJA 1FSKC 2AJ3B 4X98A 5D1ZA 4S1QL 4OSUL 3S97C 2CXKA 3GSWA 1NQBA 2EZ0D 3QIBA 4L1DA 3O41B 3NPSB 3D39B 1K6QH 3EOAB 2R0ZH 1FZMA 3ARED 1XGTB 1I4FA 2VABB 5AWNL 4MQ7B 1TJGL 4EI5B 3SE4C 2P24B 2OTUB 1ZHNB 5C0DB 4MJID 2EKSA 3FO2B 3QH3A 1X4XA 4M1GH 4R90L 3S36X 3VRIA 5I75C 2OI9C 1BVLB 5IKCA 4HQQL 4LLMB 5SWSB 1CLZL 4OUOA 1MREL 5SX5H 4KAQL 4XBPB 4B7IA 1KB5A 2BVEA 1SVCP 5BJTB 5SX4I 4CVWA 1A02N 1Z5LA 1VHPA 2YPVL 2ZG3A 5EU6A 1QTYT 1P4LB 4HZLB 4M1CC 1YZZA 3EO9H 4S0TD 3OKDB 2V2TA 5HVGB 4WUUE 5KW9H 3KYKL 3HC3L 4LSQL 4JFXA 4NRXA 1XGUB 1TZIB 4QOKD 1ED3A 5JOPE 1J9CT 1S7WB 4QRPA 5IMMA 1TVBB 4LLAA 4X9HA 3WIFA 1EEYB 4FQPA 3ARDD 5KSAB 3CX2A 1QR4A 2QBWA 5TF0A 5C6TL 2BOCB 1OGAB 2WIIB 4FQCL 4FQLH 4YEFA 2EYTB 4A2LA 5E9DB 3DTXA 1FFOA 4NNXA 5FYLL 4RMVA 2UWEA 4QHLB 5JZ7C 3UJJL 5HYJE 3C8KB 2IEPA 2E9IA 2DKMA 4Y4FA 4LKXB 3F7YB 5F9JA 1NMBH 2Z92A 4R6UA 4HGKC 3A67L 3AREC 2J88L 1FL3B 4LP4A 3FQNA 4OLXL 3V0AC 3OMZA 4ZFGL 2ARJA 3UTZB 3MPCA 2GJZB 4PJBB 1LE9A 3MYJB 5H94A 3UCRA 1S9VB 1KPVB 4HCRL 2DOCA 4XXCC 5HYQB 1D9KD 3LKSA 3D18A 4NQUA 4OCSH 2YPLD 1AKJB 1ZT4A 4JDZB 3H9HB 1ZHBB 1JGDA 2NNAB 4JRXE 2LAAA 4FTVE 2VDNL 2Y7QB 4G42A 4WWKB 1HK6A 5IMKB 1CQYA 1JF5A 4GRLD 4PTTA 5HHXL 1ZLVK 5CZVH 1N0XL 1NANI 1SHMA 3MROB 4ZOEA 5C0GB 3TBVA 3WIIH 3I2CH 3VD5A 4NZUL 1LE5A 1U92B 1F02I 5D1XA 5E7BA 4KGJA 1G7LA 2XKSA 3VFMA 1JI2A 3F7RA 1I8IB 3LS4L 3E6HA 2OR7A 4D9LH 1FAIL 2Q3AA 4L4VD 4J4PD 5LQBL 4NBZB 4AEHH 1T03L 2DBJA 3T3ME 1R24B 5D96C 5HI3C 3MV8D 2BNQA 1I1AA 3D0VA 3OV6A 4XVUD 5IVOA 4XTRD 5HHQA 2P5WE 4R4FL 1OTUD 4WTWA 1DVFA 3SDCB 1XZ0B 3OJDA 2F54E 5ANME 4ZAKA 2BVUA 3CLFH 5C2UB 3GUTA 5IFAH 3UYPA 1AGFA 1ZT1A 3EO0B 1KJVB 2RCSL 3R06B 1JWUA 1UWGH 5K9JH 4KC3B 3O6FB 3VDAA 1WBZA 3ULVF 5E8EB 3Q3GB 4OZGF 5FYKL 4Y2DD 4ZMAT 1YEJH 1BVZA 2ZP0T 2QR0A 4G80B 3QPXH 4EDXB 3EDDA 1IC4H 4JVPA 4RISL 4EJ1C 2UY7A 4WFGD 3ZTNL 4TUKL 1Q9WB 2F5AL 1TDQA 3ZKNC 2BY0A 1OD7A 2IAMB 1EVTC 4YR6B 1VFBB 3B43A 1KGCD 5C9JA 2XIDA 1I85C 5F96H 1YN7A 1ZANL 4W6XB 1P4IL 1XAUA 1N64H 4C59B 3GI8L 5E1HB 3W0WD 2XNAA 5IWLC 3U0TB 4MA8L 1EZVX 3L9RB 1PG7W 4J4PC 1FFNB 1HIMH 2NW2B 4BUHA 4UZGA 4Y1AA 4UDUB 3LKPA 3B5TA 4W70A 5GS3A 1GGCH 4JG1L 4XTRC 2GITB 4U3CA 1A3RH 4HMEA 3AU1A 4O5LL 1ZLSL 1G9EA 3UJTL 2PTTB 4MB5A 4KJWC 1ZWIA 1EHLH 3IFPB 4NCDA 4KMTL 5TGBB 1EBAA 1RUML 2UY6A 2DLFL 3ARFD 4TVSa 1KIUA 5T1LD 4PJAB 3AS1A 3DYMA 5AD0A 4LSSL 3O11A 1U3JA 3PP4L 3DUUA 2EDHA 5IROC 4G8FA 4NQTA 1LEKA 1QRNA 1A64A 1U8OA 5E8PB 2AXJA 1B0GA 3I3DA 5FGCB 1IBGH 4OFIA 2XG4A 4P46A 5JW4M 3HE7B 1A9BB 2GAZA 2UWEF 4OFYA 3HFMH 3TLRA 4PIRF 25C8L 5HYFA 3BGFB 5FHBH 3BFOA 4IDJH 4XGZA 3KPRA 1JGLH 2ZKHH 3OF6A 2PO6A 5GRZA 3SKOB 4LEXL 4HJ0C 2OJEB 2VSCA 2VLRD 5EOCH 2QHRL 3P4NA 2V2XA 3RRQA 4JRYA 2C26A 1OGAE 3QUXD 4PUBH 5BXFA 5EO9B 3LQAC 2VO5A 4XNMA 4HPYL 1HHGB 1A6ZB 4I1NB 1NUDA 2P8PA 1I3RA 3PHOA 5GGRA 5IMLB 8FABB 4CMHC 1CLOH 2XYCA 3TT3L 2AJZB 3IKCA 3BISA 1X9QA 4QLRA 3IDUA 3MNVB 4FZEL 3E2HB 3ARFC 5CMAB 3UYRL 3TZVC 2D7TL 4MXVE 5FO8A 3TBTA 1JV5B 3WHE1 4MD4A 4PGBA 1DQTA 2N4IA 2NY6C 2OQJB 3ZDZF 5ID1B 1EK3A 4TUJB 4WO4C 1IEBA 4R7DB 2ZCLH 2I26N 4Q9RL 5J06A 3PDOB 3TO4D 1NKOA 4OM0L 4OZIB 2XZCL 2IBZX 3ZTJG 3U0WH 2J8UA 1YDPA 4P5TB 3DHMA 4E42B 2VDPH 4XBGB 3FQUB 4JLRB 4U6YB 2F58H 2JLLA 3V6OE 4LLQA 1TNNA 4F7TB 3QRFM 4KK9D 2AJ3A 1SJXA 1QBML 1TNMA 5GS0L 1KXTB 3C8HA 1E6JL 1UA6H 1I9RH 2J7LA 5FIEA 3DGCR 4YGAB 1RJLB 1JN6B 4KJQD 3D39A 3QUXC 2ESVE 3EOAA 5DWUH 5K9QG 4JDTH 4NC0B 2VDOL 2AXFB 2VABA 4MQ7A 2PETA 1DBMH 4I3SH 4F7PB 4OAWB 1QEWB 3K8LA 3ZL4L 4EI5A 2P24A 2OTUA 1ZHNA 4XWOD 5C0DA 3FO2A 4RAHA 1BVLA 1ADQH 5SWSA 1FLRH 4K7FB 4L3CB 3TNNB 4XBPA 4CDGC 3K81A 4O2CB 5BJTA 1YJDL 3NGBB 4NBYB 1TZGL 2DTSA 2BNRB 3JBG7 1P4LA 5IQ9B 4HZLA 4H0GA 3BSZH 3TO4C 2W91A 1FH5L 4KJPD 2ZCKH 3IXTB 3OKDA 5C0AD 1TPXB 4ETQB 2P46B 4Y16C 1M1SA 1IQWH 1XGUA 4P2CG 1TZIA 3K7UA 1G0DA 2AEQL 3VGGA 3VFGH 1S7WA 1TVBA 1B6DA 1EEYA 3WNMA 5KSAA 4GW4B 5L6YL 1VGEH 4W4OC 3UTSE 1Q1JL 2CJUH 4QRRD 5FUOL 2WIIA 2GTWB 5C7XH 2EYTA 5E9DA 4NUGL 3PL6A 4QHLA 5CFHA 3C8KA 4KJQC 1N5AB 2D7MA 2AEIT 1UKTA 1XT5A 3F7YA 2JJUA 3G6JB 3LMJL 3HZKB 1K85A 32C2B 4UQ2B 1FL3A 5DHVH 1JPTL 3L3DB 4FZ8L 4MXQD 1FO0H 5CS7A 1M71B 4NQCA 2AK4D 1EO5A 1SVZA 2LTQC 4Y8AA 3UTZA 5IVXB 5J89A 1UCBL 3U48A 4BZYA 2GJZA 1XF2B 4PJBA 3MYJA 4LPTA 4IJ3C 4F57L 1S9VA 1YEKL 4LSTH 5HYQA 4J6RH 1HZHH 4DKAA 3ZHLA 3HPJB 1AKJA 1I8MB 4WTZG 2H2SD 3HE6B 4UQ3B 4GS7B 3H9HA 1ZHBA 2AKRB 3S37L 4BSJA 4WWKA 2Y7QA 4N90E 4KJPC 2VISB 2MNUA 2DL2A 2VZ1A 3MROA 4JY6B 5C0GA 4OM1H 1A21A 2J6EA 1KG0B 3V6BR 1QR1B 3FHQA 4XCFL 1W0VB 1U92A 4JJHA 4KV5F 1I8IA 3QXTA 1T1YB 3VG0H 3G5VB 2DQJH 5H35B 3ES6B 3I6LD 3ZT7A 5ID0B 1A14L 3GKWH 5DZNA 4ZYKB 4QEGA 2VDRH 1R24A 3DPBA 2H6PA 4DGVL 1JYXA 1TJIL 2QKIB 3MXWL 3UZQA 3BQUB 3SDCA 1T7WA 4FXKB 3GSQB 1OM3H 3SCMC 1T6VN 2DQHH 2NY3B 4PGCB 3EO0A 1KJVA 2E27L 3R06A 1R3IH 4FQIH 3ZYOA 1Z3GH