1K8A4

Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
92
structure length
92
Chain Sequence
MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF00935 Ribosomal_L44 Ribosomal protein L44
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.80 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 1k8a400
1VQ43 3CCQ3 1VQO3 1S723 3OW22 1M904 1VQK3 1VQL3 1M1K4 2OTJ3 1VQN3 1KD14 3CMA3 3CCL3 3CCJ3 1VQ73 1JJ22 1YHQ3 3CCV3 3CME3 3CC73 1VQ83 1Q864 1VQ63 1Q814 1QVG2 3CCE3 1VQ53 2QA43 3I553 1YI23 1N8R4 1YJW3 2OTL3 3G713 1YIT3 3CD63 1VQP3 2QEX3 1K734 3CC23 3CCR3 1Q824 3CXC2 1KQS2 3G4S3 3CC43 1VQM3 1YJN3 3CCM3 3CPW2 3CCU3 3CCS3 1NJI4 1QVF2 1K9M4 1VQ93 1K8A4 1Q7Y4 3I563 1KC84 1YIJ3 3G6E3 1W2B2 1YJ93
chains in the Genus database with same CATH superfamily
4OUQA 1B20A 2J8XB 3NV0A 5CLKA 2C11A 3EBTA 1IVVA 4J5KA 1Q40B 3D79A 3CCV3 4EYCA 2SARA 1BRKA 3B4OA 3CU3A 4Q53A 5RNTA 5A0OB 3AMOA 3F9SA 1ZO2A 3EB8A 2M7OA 2Q07A 1UDII 4AKZA 1ULIB 3K7CA 6STDA 1K28A 1TFOA 2XGNA 3VF1A 3H51A 1YIT3 3HIIA 3QK9A 3SXXA 1LQGC 3A5EA 1QAKA 1OCVA 1S5AA 1K9M4 2W9PA 2KAAA 1X1UA 2INXA 2Y73A 4CCVA 1MOLA 1AVLA 1TRQA 2P09A 3NBJA 4IPBA 3X42A 1DYUA 1AV4A 3EF8A 4GHOA 1O7GB 2CX0A 3UNLA 5IG3A 1GSPA 3NV0B 5EEOA 1PYLA 3D4AA 2HMKB 3RDEA 3FH1A 3SVAA 1BRJA 6RNTA 2XRXB 4XDWA 4BTWA 1LVNA 1BANA 3MPHA 2XFSA 4AEQA 4N6NB 1BSDA 1HZ1A 2WOFA 3GZRA 5AYRB 3SOYA 2GEXA 5D81A 1OF5B 1VQP3 1JBSA 5KP1A 4G1MB 2JDIH 4LYLB 4LEHA 1YGWA 3V99A 1U8CB 1J2BA 1RSNA 3BLZA 1A2VA 1IQ8A 1GY7A 3ECFA 4HM0B 2CKFB 4HM1B 8RNTA 1QJGA 3KFQC 4N6MA 1X1WA 1RDSA 1GY6A 2D42A 4ORLA 1RGKA 4XBXA 7STDA 1VZZA 3NBRA 1RCLA 1EQKA 2K3DA 5STDA 3AGNA 3F7XA 2LQVA 3EN8A 1NB3I 2RFRA 3CNXA 1YHQ3 4H3UA 1BRSA 4N6TA 1Q864 1RGLA 3UL6A 1JN5A 3DMCA 5AIHA 3X41A 2IY2A 3K9MC 4L8OA 4PEJA 4EC6A 1MWRA 1UI8A 1STDA 3QRDA 1G0TA 1WNHA 2CFWA 2W04A 3JUPA 5AIGA 4KVHA 1E3VA 1GD4A 1RJOA 3G4S3 1BNSA 3CC43 1W6GA 3G16A 3DH2A 1NNVA 3X3YA 4QWTA 2WOHA 3MYTA 4WHAA 1D6YA 1BRIA 1W02A 1IV7A 4LGQA 1AVKA 1D6ZA 1OHPA 1Q9EA 5AYSC 4OVMA 1E3RA 4GB5A 4U13A 2KXGA 1I0VA 4WYKB 1I2FA 1MWUA 3WODG 3DM8A 3PZWA 2OOVA 2MF7A 3CCL3 2HMJB 1Q7HA 1BNFA 2WO0A 1I2EA 3FG3A 2YFIB 3NX0A 1SIIA 1US1A 3F14A 1V74A 1BNJA 4MMZB 2O3OA 4LZIA 1U5OA 3FSDA 1A67A 3D5IA 2H0IA 1MNLA 3CC23 1YVSA 1STFI 3ZFZA 4BTYA 1MWSA 2BO9B 2KF5A 4HAAA 3CCU3 1N9JA 3A76A 4NREA 2GU3A 1C54A 1I0XA 3OWYA 3WOFB 4N6LA 8CHOA 1JB2A 3BU4A 4L7KA 1X1XA 4XDVA 1TU5A 3NQZA 2PNCA 3NXJA 1K41A 4NPBA 4XM4A 4FMAA 2IUJA 3KKGA 2CH9A 1VQN3 4RBNA 1O7NB 3AGOA 1BSAA 3WHOA 1O7HB 1W4NA 3CC73 3WR2A 2E2UA 3HK4A 3G0KA 1W2ZA 3FCSB 1QMAA 2KCDA 3DGNA 1ROAA 1TP6A 2F4YA 1Z1SA 3OV4A 5GSPA 3CCR3 1B3SA 1PY3A 2W2CA 4FCZA 2OQEA 4HKVB 3KIIA 2PZVA 1EEJA 4XBTA 3GZXB 1LNHA 1W01A 1JB5A 2GEYA 4LSOA 2XGLA 1CH0A 3IJEB 1HKXA 3Q3FA 1T2HA 5JPPA 1NWWA 1LQMB 2STDA 3NUVA 1FGQA 2W9QA 1N9EA 3RNTA 5IENA 3B8LA 1RGCA 2GSPA 2HMNB 3FLJA 1B2MA 3J7Yd 1G96A 1VQ53 4RNYA 1IV9A 1FZUA 2WGOA 4BL3A 3LYGA 3DGOA 2H0HA 1VQQA 2P38A 2RSXA 1RGAA 3PCRA 1OF5A 1K734 1ZGXA 1UCKA 1GY5A 3KE7A 3KZTA 4MJDA 2CFGA 4R4KA 4ILFA 1ASKA 1W5ZA 3DXOA 5IERA 3CPW2 2BU4A 5BIRA 3EJVA 1HYFA 1RRHA 5CF2A 2XFTA 1UUGB 1FYSA 3LT9A 1MGRA 1DMQA 3CCQ3 3NHXA 4K90B 1I3FA 1B2SA 1I8VA 2XH9A 3FGYA 1WMPA 1MGWA 3GRDA 2H0GA 2IA7A 4HZBB 3GSPA 1IVXA 1NB5I 1DMMA 3KSED 4EXRA 3EBYA 1UGHI 1YI23 1EA2A 3F40A 1IQXA 4HVNA 4IT7A 4HM2B 1EUIC 2XSOB 2E2TA 1Q824 3MKIA 3NM2A 1FGTA 3UL5A 2V1LA 4HOHA 4HM7B 1LOVA 3FG1A 1LOXA 1ZS7A 3FG4A 2OOVC 1NU3A 7RNTA 1KC84 2OCTA 1BRNL 1DE3A 1GOVA 1GMRA 2Z77A 3CPOA 5TGNA 2R4IA 3LTAA 2KRTA 1BUJA 4KFDA 3OWSA 1FA3A 3Q2PA 4WYKA 3TDGA 1JKGB 3PYJA 3ZG5A 1RGHA 3DGLA 4GSPA 1UCIA 3URPA 3WA2X 3S27A 1YVBI 2IMJA 1Q814 1KSIA 4FCMA 1RTUA 2CIUA 1TTOA 2E2VA 2XSHB 3LMLA 2OTL3 3CD63 3S67A 2W56B 3ER7A 2HOHA 5M18A 3LH4A 1VQM3 1UI7A 2Z76A 3PGBA 5IEOA 1FGRA 3KCHA 3WMDA 1YJN3 3EQQB 1SJWA 3GZBA 3X40A 1NJI4 1OH0A 2ZA4A 1DVCA 3S5CA 3HOHA 2UX0A 3U1WA 3LZAA 1W2B2 1IU7A 2Z6BA 4GL6A 1TIJA 5IG5A 4X2OA 2CX1A 1M904 1VQK3 1VQL3 1KD14 2YFLB 3ALAA 3K63A 3WOEB 1VQ73 1FUSA 2P0XA 4FCJA 4HM3B 1BSBA 1VQ83 2Y74A 4CPKA 4KFFA 1LOWA 2OQEC 3Q90A 3MHEA 1BU4A 1T2IA 4HZ9B 2WGQA 1JNQA 2BHMA 1NDOB 1QAFA 4KZ1A 3WA3A 1RGGA 4ZM8A 3T8NA 2L1SA 5IF6A 1OACA 1OHOA 3PCSA 4R80A 1BRGA 1O7MB 1R4CA 3JVCA 2SBLA 3NQYA 4L8PA 1RMSA 3I563 1B2UA 2KF6A 4BL2A 2BIRA 1F8NA 3T0UA 2OWPA 1BNEA 2W03A 5AEWB 3FZWA 1TUHA 1RN1A 3OW22 4O2HA 5FW5A 2OTJ3 2BMRB 1I70A 1OUNA 2O9UX 1IT7A 3D3LA 1JB4A 1YNVX 4HBRA 5CK6A 5G1KA 4N6V0 4O02B 3O8YA 1WQLB 5AIIA 4MMXB 1GS3A 4JF8A 1W00A 2UGIA 3AHSA 1IQYA 3N9HA 2QEX3 1GD3A 4HM6B 2C4BA 1MWTA 2CG0A 1T5YA 1RNTA 3STDA 3NM7A 2FGTA 3HIGA 5EVHA 2XEPA 1N8QA 1JZOA 2RGQA 2Z7AA 1I3IA 3IMAB 2GBWB 3K5TA 4RZMA 1YJ93 3DY5A 4I5QA 3SYUA 2UUGC 2F98A 5IW9A 1L5GB 4WWUC 1Q42A 1LNIA 4HM4B 4CJNA 4X2HA 3SOAA 2IUKA 1RCKA 5JBSA 4KFEA 2CFLA 1HU9A 2IYJA 1QVG2 1E97A 1RN4A 1UGIA 2RCDA 4FMCA 4K1VA 1NO3A 1O7WB 3EX9A 1JRQA 1JBRA 5LC7A 4HM8B 4EV2A 2RNTA 3LT8A 1DETA 1GMQA 1B27A 1GYBA 5LC6A 3U97A 5D83A 1BNGA 1LRAA 2HMOB 2K54A 4J8TA 1FUWA 1M9GA 2ML5A 2F99A 1YIJ3 2RBIA 1WTHA 3EHCA 1BNIA 1T3BA 1BIRA 3BNEA 2B1XB 2XR8B 4NHFA 2F86B 1ROVA 1M1K4 3E99A 3M8CA 1OPYA 1JKGA 5CXOA 3CCJ3 3JUNA 3KN4A 4TX4A 1O7PB 3RGAA 3CME3 4N6OB 4IIAA 2AADA 5KP4A 1N5HA 1SPUA 3GWRA 5M1AA 3V98A 1PU4A 3CCE3 3DGMA 3SLUA 1RNBA 3I553 2ML6A 4AKYA 3L0RA 5I97A 2ZDJA 2W56A 2YX9A 3EN1B 3NBBA 5EQLA 1SARA 2LYXA 1TRPA 1W6CA 4R1KA 2I9WA 1BOXA 1JV2B 1QVF2 2FXTA 3B7CA 1K8A4 1TJDA 3JUQA 3BNCA 1FW7A 3LTBA 3LTCA 3PS8A 5D82A 1R4YA 1B21A 2FNQA 1UUWB 4FR9A 1C7HA 3SEDA 3WDGB 5BU4A 1VQO3 2YFJB 2L4VA 3G8ZA 5ELJA 3X3XA 5G1LA 3OX9A 3CMA3 9RNTA 1D6UA 4BTXA 1BNRA 5CF1A 4STDA 3EE1A 1A90A 4EV5A 1B2ZA 3Q1CA 2CFDA 2CK3H 3AMOB 3MG2A 3N8BA 5AIFA 1FGOA 3JUOA 1A2PA 1SQWA 4R9KA 3D9RA 1IDPA 1RGFA 1FGMA 2GBXB 4FMDA 5HGRA 1UCJA 4DKIA 3BB9A 1V57A 4I4KA 4O3VA 1KQS2 1BUQA 1EKMA 3DZLA 1M1XB 3I0YA 4R9LA 1ZX2A 4O8SA 2BT3A 2F5WA 3K0ZA 1IYYA 4N6UA 5HOHA 3BNBA 3FKAA 2A15A 1AY7A 3UB1A 5DRVA 5AEUB 1RRLA 4OK0A 4HYZA 3X3ZA 1S723 1ULJB 4WP5A 3AHWA 3B4PA 3FF2A 1OHSA 5ELUA 1CQSA 3MWZA 4RNZA 1GOUA 3HX8A 4XBYA 2KF4A 1G02A 1Y4KA 1LOYA 4N3VA 2CWTA 5IG0A 3N54B 5IEPA 3ROBA 3F8XA 3LOYA 5BXQA 3D5GA 1UW1A 1A2KA 3DGYA 4EW5A 2QA43 2B24B 3G713 1WMNA 3F7SA 4XB5A 1LXEA 4WFOA 1N5PA 1TFKA 1OGZA 1GMPA 2QIYA 7GSPA 4J5GA 1BSCA 3EC9A 1CEWI 5M19A 3CXC2 3CCM3 3HI7A 2BMQB 3V92A 1BVIA 3VGNA 1RN7A 3SX1A 2W0QA 3GZYB 1CYUA 2R41A 5DREA 2GXFA 3ZG0A 2BMOB 1OGXA 3MSOA 1BAOA 2D1WA 1JJ22 3IPTA 1VQ43 1IT8A 2ZHXB 3JUMA 4J9AA 3F8HA 3PXMA 1RKYA 2AAEA 3OXAA 5IG4A 2CWVA 2GU1A 1RGEA 2F56A 1X1YA 4CDLA 2K0MA 1EG9B 1JN5B 1RLSA 5FGOA 3LXUX 2CG1A 2KF3A 1GOYA 1BRHA 1AQZA 1N8R4 1JZDA 3FF0A 4H61A 4JRFA 4K61A 1YJW3 3MG1A 4HM5B 1UCLA 6GSPA 1PFPA 1CYVA 1YGEA 3G6E3 1BSEA 1QALA 4EBGA 5G2GA 1DVDA 2QGUA 3H3HA 3T8UA 1DMNA 5JPUA 3GAXA 3LTDA 2HMMB 2CWUA 3BIRA 4HJLB 2ZL8A 2P0MA 1WMOA 2C10A 3UJMA 1V58A 1IVUA 2XF3A 1ISKA 2F5MA 1Q40A 4BU4A 2BNGA 1RHLA 2CC3A 4BIRA 4RNTA 1AR0A 1KWIA 1B2XA 2CHCA 1VQ63 5KP3A 1BGSA 3MG3A 3KSPA 3CNMA 3RGRA 4LMIA 5AI1A 1I2GA 1W6YA 2P05A 3DUKA 2HMLB 1IVWA 1W7CA 2JQ5A 2W6JH 3OWUA 1JBTA 4FMBA 4MMYB 3S28A 3CCS3 2CFKA 4K1UA 1VQ93 1Q7Y4 1FUTA 3HZPA 3BNDA 2CW9A 3S29A 4MEIA 3VSYA 5BVBA 1SIHA 2MC8A 4KT3B 1IK3A 1UUVB
chains in the Genus database with same CATH topology
4OUQA 3NV0A 5CLKA 2C11A 3EBTA 1IVVA 1Q40B 3CCV3 4EYCA 3B4OA 4Q53A 3CU3A 5A0OB 3AMOA 3F9SA 1ZO2A 3EB8A 2M7OA 2Q07A 4AKZA 1ULIB 3K7CA 6STDA 1K28A 1TFOA 2XGNA 3VF1A 3H51A 1YIT3 3HIIA 3QK9A 3SXXA 1QAKA 1OCVA 1S5AA 1K9M4 2W9PA 2Y73A 2INXA 4CCVA 1MOLA 1AVLA 3NBJA 2P09A 4IPBA 3X42A 1DYUA 1AV4A 3EF8A 1O7GB 3UNLA 5IG3A 3NV0B 5EEOA 2HMKB 3RDEA 3FH1A 3SVAA 2XRXB 4XDWA 4BTWA 1LVNA 3MPHA 2XFSA 4AEQA 4N6NB 2WOFA 3GZRA 5AYRB 3SOYA 2GEXA 5D81A 1OF5B 1VQP3 5KP1A 4G1MB 2JDIH 4LEHA 3V99A 1U8CB 1J2BA 3BLZA 1A2VA 1IQ8A 1GY7A 3ECFA 4HM0B 2CKFB 4HM1B 1QJGA 3KFQC 4N6MA 1GY6A 2D42A 4ORLA 4XBXA 7STDA 1VZZA 3NBRA 1EQKA 5STDA 3F7XA 2LQVA 3EN8A 1NB3I 2RFRA 3CNXA 1YHQ3 4H3UA 4N6TA 1Q864 3UL6A 1JN5A 3DMCA 5AIHA 3X41A 3K9MC 4L8OA 4PEJA 4EC6A 1UI8A 1STDA 3QRDA 1WNHA 2CFWA 2W04A 3JUPA 5AIGA 4KVHA 1E3VA 1GD4A 1RJOA 3G4S3 3CC43 1W6GA 3G16A 3X3YA 4QWTA 2WOHA 3MYTA 4WHAA 1D6YA 1W02A 1IV7A 4LGQA 1AVKA 1D6ZA 1OHPA 5AYSC 4OVMA 1E3RA 4GB5A 4U13A 2KXGA 4WYKB 3WODG 3DM8A 3PZWA 2OOVA 2MF7A 3CCL3 2HMJB 2WO0A 3FG3A 2YFIB 3NX0A 1SIIA 1US1A 3F14A 1V74A 4MMZB 2O3OA 4LZIA 1U5OA 3FSDA 1A67A 1MNLA 1STFI 4BTYA 2BO9B 3CCU3 1N9JA 3A76A 4NREA 2GU3A 3OWYA 3WOFB 4N6LA 8CHOA 1JB2A 4L7KA 4XDVA 1TU5A 3NQZA 2PNCA 3NXJA 1K41A 4XM4A 2IUJA 4FMAA 3KKGA 2CH9A 1VQN3 4RBNA 1O7NB 1O7HB 1W4NA 3CC73 2E2UA 3HK4A 3G0KA 1W2ZA 3FCSB 1QMAA 2KCDA 3DGNA 1ROAA 1TP6A 1Z1SA 3OV4A 3CCR3 2W2CA 4FCZA 2OQEA 4HKVB 3KIIA 2PZVA 4XBTA 3GZXB 1LNHA 1W01A 1JB5A 2GEYA 4LSOA 2XGLA 3IJEB 1HKXA 5JPPA 1NWWA 2STDA 3NUVA 1FGQA 2W9QA 1N9EA 5IENA 3B8LA 2HMNB 3FLJA 3J7Yd 1G96A 1VQ53 4RNYA 1IV9A 2WGOA 3LYGA 3DGOA 2RSXA 2P38A 3PCRA 1OF5A 1K734 1GY5A 3KE7A 3KZTA 4MJDA 2CFGA 4R4KA 1ASKA 1W5ZA 3DXOA 5IERA 3CPW2 3EJVA 1RRHA 5CF2A 2XFTA 3CCQ3 3LT9A 1DMQA 3NHXA 4K90B 3FGYA 2XH9A 1WMPA 3GRDA 2IA7A 4HZBB 1IVXA 1NB5I 1DMMA 3KSED 4EXRA 3EBYA 1YI23 1EA2A 3F40A 1IQXA 4HVNA 4IT7A 4HM2B 2XSOB 2E2TA 1Q824 3MKIA 3NM2A 1FGTA 3UL5A 2V1LA 4HM7B 3FG1A 1LOXA 3FG4A 2OOVC 1NU3A 1KC84 2OCTA 2Z77A 3CPOA 5TGNA 2R4IA 3LTAA 2KRTA 4KFDA 3OWSA 1FA3A 3Q2PA 4WYKA 3TDGA 1JKGB 3PYJA 3DGLA 3WA2X 3S27A 1YVBI 2IMJA 1Q814 1KSIA 4FCMA 2CIUA 2E2VA 2XSHB 3LMLA 2OTL3 3CD63 3S67A 2W56B 3ER7A 3LH4A 1VQM3 1UI7A 2Z76A 3PGBA 5IEOA 1FGRA 3WMDA 1YJN3 3EQQB 1SJWA 3GZBA 3X40A 1NJI4 1OH0A 1DVCA 3S5CA 2UX0A 3U1WA 3LZAA 1W2B2 1IU7A 2Z6BA 4GL6A 1TIJA 5IG5A 4X2OA 1M904 1VQK3 1VQL3 1KD14 2YFLB 3ALAA 3K63A 3WOEB 1VQ73 2P0XA 4FCJA 4HM3B 1VQ83 2Y74A 4KFFA 2OQEC 3Q90A 3MHEA 4HZ9B 2WGQA 1JNQA 2BHMA 1NDOB 1QAFA 4KZ1A 3WA3A 4ZM8A 3T8NA 5IF6A 1OACA 1OHOA 3PCSA 4R80A 1R4CA 1O7MB 3JVCA 3NQYA 2SBLA 4L8PA 3I563 1F8NA 3T0UA 2OWPA 2W03A 5AEWB 3FZWA 1TUHA 3OW22 4O2HA 5FW5A 2OTJ3 2BMRB 2O9UX 1OUNA 3D3LA 1IT7A 4HBRA 1JB4A 5CK6A 4N6V0 4O02B 3O8YA 1WQLB 5AIIA 4MMXB 1GS3A 4JF8A 1W00A 1IQYA 3N9HA 2QEX3 1GD3A 4HM6B 2CG0A 1T5YA 3STDA 3NM7A 2FGTA 3HIGA 5EVHA 2XEPA 1N8QA 2Z7AA 2RGQA 3K5TA 3IMAB 2GBWB 4RZMA 1YJ93 3DY5A 2F98A 5IW9A 1L5GB 4WWUC 1Q42A 4HM4B 4X2HA 3SOAA 2IUKA 5JBSA 4KFEA 2CFLA 1HU9A 1QVG2 1E97A 4FMCA 2RCDA 4K1VA 1NO3A 1O7WB 3EX9A 1JRQA 5LC7A 4HM8B 4EV2A 3LT8A 1GYBA 5LC6A 3U97A 5D83A 2HMOB 2K54A 4J8TA 1FUWA 1M9GA 2ML5A 2F99A 1YIJ3 3EHCA 1WTHA 3BNEA 2B1XB 2XR8B 4NHFA 2F86B 1ROVA 1M1K4 3E99A 3M8CA 1OPYA 1JKGA 5CXOA 3CCJ3 3JUNA 3KN4A 4TX4A 1O7PB 3RGAA 3CME3 4N6OB 4IIAA 5KP4A 1N5HA 1SPUA 3GWRA 3V98A 1PU4A 3CCE3 3DGMA 3SLUA 3I553 2ML6A 4AKYA 3L0RA 5I97A 2ZDJA 2W56A 2YX9A 3EN1B 3NBBA 5EQLA 2LYXA 1W6CA 4R1KA 2I9WA 1JV2B 1QVF2 2FXTA 3B7CA 1K8A4 3JUQA 3BNCA 3LTBA 3LTCA 3PS8A 5D82A 2FNQA 1UUWB 4FR9A 1C7HA 3SEDA 3WDGB 1VQO3 2YFJB 2L4VA 3G8ZA 5ELJA 3X3XA 3OX9A 3CMA3 1D6UA 4BTXA 5CF1A 4STDA 3EE1A 1A90A 4EV5A 3Q1CA 2CFDA 2CK3H 3AMOB 3MG2A 3N8BA 5AIFA 1FGOA 3JUOA 1SQWA 4R9KA 3D9RA 1IDPA 1FGMA 2GBXB 4FMDA 5HGRA 3BB9A 4I4KA 4O3VA 1KQS2 1BUQA 1EKMA 3DZLA 1M1XB 3I0YA 4R9LA 1ZX2A 4O8SA 2BT3A 3K0ZA 4N6UA 3BNBA 3FKAA 2A15A 3UB1A 5DRVA 5AEUB 1RRLA 4OK0A 4HYZA 3X3ZA 1S723 1ULJB 4WP5A 3FF2A 3B4PA 1OHSA 5ELUA 1CQSA 3MWZA 4RNZA 3HX8A 4XBYA 1Y4KA 4N3VA 5IEPA 5IG0A 2CWTA 3N54B 3ROBA 3F8XA 3LOYA 5BXQA 1UW1A 1A2KA 2QA43 2B24B 3G713 1WMNA 3F7SA 4XB5A 1LXEA 4WFOA 1N5PA 1TFKA 1OGZA 2QIYA 3CC23 3CXC2 3EC9A 1CEWI 3CCM3 3HI7A 2BMQB 3V92A 3VGNA 1CYUA 1RN7A 3SX1A 2W0QA 3GZYB 5DREA 2GXFA 2BMOB 1OGXA 3MSOA 2D1WA 1JJ22 1VQ43 3IPTA 1IT8A 3JUMA 4J9AA 3F8HA 3PXMA 1RKYA 3OXAA 5IG4A 2CWVA 2GU1A 4CDLA 2K0MA 1EG9B 1JN5B 5FGOA 3LXUX 2CG1A 1N8R4 3FF0A 4H61A 4JRFA 4K61A 1YJW3 3MG1A 4HM5B 1PFPA 1CYVA 1YGEA 3G6E3 1QALA 4EBGA 5G2GA 1DVDA 2QGUA 3H3HA 3T8UA 1DMNA 5JPUA 3GAXA 3LTDA 2HMMB 2CWUA 4HJLB 2ZL8A 2P0MA 1WMOA 2C10A 3UJMA 1IVUA 2XF3A 1ISKA 1Q40A 2BNGA 2CC3A 1AR0A 1KWIA 2CHCA 1VQ63 5KP3A 3MG3A 3KSPA 3CNMA 3RGRA 4LMIA 5AI1A 1W6YA 2P05A 3DUKA 2HMLB 1IVWA 1W7CA 2JQ5A 2W6JH 3OWUA 4FMBA 4MMYB 3S28A 3CCS3 2CFKA 4K1UA 1VQ93 1Q7Y4 3HZPA 3VSYA 3BNDA 2CW9A 3S29A 4MEIA 5BVBA 1SIHA 2MC8A 1IK3A 1UUVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ4 3;  3CCQ 3;  1VQO 3;  1S72 3;  3OW2 2;  1M90 4;  1VQK 3;  1VQL 3;  1M1K 4;  2OTJ 3;  1VQN 3;  1KD1 4;  3CMA 3;  3CCL 3;  3CCJ 3;  1VQ7 3;  1JJ2 2;  1YHQ 3;  3CCV 3;  3CME 3;  3CC7 3;  1VQ8 3;  1Q86 4;  1VQ6 3;  1Q81 4;  1QVG 2;  3CCE 3;  1VQ5 3;  2QA4 3;  3I55 3;  1YI2 3;  1N8R 4;  1YJW 3;  2OTL 3;  3G71 3;  1YIT 3;  3CD6 3;  1VQP 3;  2QEX 3;  1K73 4;  3CC2 3;  3CCR 3;  1Q82 4;  3CXC 2;  1KQS 2;  3G4S 3;  3CC4 3;  1VQM 3;  1YJN 3;  3CCM 3;  3CPW 2;  3CCU 3;  3CCS 3;  1NJI 4;  1QVF 2;  1K9M 4;  1VQ9 3;  1K8A 4;  1Q7Y 4;  3I56 3;  1KC8 4;  1YIJ 3;  3G6E 3;  1W2B 2;  1YJ9 3; 
#chains in the Genus database with same CATH topology
 4OUQ A;  1B20 A;  2J8X B;  3NV0 A;  5CLK A;  2C11 A;  3EBT A;  1IVV A;  4J5K A;  1Q40 B;  3D79 A;  3CCV 3;  4EYC A;  2SAR A;  1BRK A;  3B4O A;  3CU3 A;  4Q53 A;  5RNT A;  5A0O B;  3AMO A;  3F9S A;  1ZO2 A;  3EB8 A;  2M7O A;  2Q07 A;  1UDI I;  4AKZ A;  1ULI B;  3K7C A;  6STD A;  1K28 A;  1TFO A;  2XGN A;  3VF1 A;  3H51 A;  1YIT 3;  3HII A;  3QK9 A;  3SXX A;  1LQG C;  3A5E A;  1QAK A;  1OCV A;  1S5A A;  1K9M 4;  2W9P A;  2KAA A;  1X1U A;  2INX A;  2Y73 A;  4CCV A;  1MOL A;  1AVL A;  1TRQ A;  2P09 A;  3NBJ A;  4IPB A;  3X42 A;  1DYU A;  1AV4 A;  3EF8 A;  4GHO A;  1O7G B;  2CX0 A;  3UNL A;  5IG3 A;  1GSP A;  3NV0 B;  5EEO A;  1PYL A;  3D4A A;  2HMK B;  3RDE A;  3FH1 A;  3SVA A;  1BRJ A;  6RNT A;  2XRX B;  4XDW A;  4BTW A;  1LVN A;  1BAN A;  3MPH A;  2XFS A;  4AEQ A;  4N6N B;  1BSD A;  1HZ1 A;  2WOF A;  3GZR A;  5AYR B;  3SOY A;  2GEX A;  5D81 A;  1OF5 B;  1VQP 3;  1JBS A;  5KP1 A;  4G1M B;  2JDI H;  4LYL B;  4LEH A;  1YGW A;  3V99 A;  1U8C B;  1J2B A;  1RSN A;  3BLZ A;  1A2V A;  1IQ8 A;  1GY7 A;  3ECF A;  4HM0 B;  2CKF B;  4HM1 B;  8RNT A;  1QJG A;  3KFQ C;  4N6M A;  1X1W A;  1RDS A;  1GY6 A;  2D42 A;  4ORL A;  1RGK A;  4XBX A;  7STD A;  1VZZ A;  3NBR A;  1RCL A;  1EQK A;  2K3D A;  5STD A;  3AGN A;  3F7X A;  2LQV A;  3EN8 A;  1NB3 I;  2RFR A;  3CNX A;  1YHQ 3;  4H3U A;  1BRS A;  4N6T A;  1Q86 4;  1RGL A;  3UL6 A;  1JN5 A;  3DMC A;  5AIH A;  3X41 A;  2IY2 A;  3K9M C;  4L8O A;  4PEJ A;  4EC6 A;  1MWR A;  1UI8 A;  1STD A;  3QRD A;  1G0T A;  1WNH A;  2CFW A;  2W04 A;  3JUP A;  5AIG A;  4KVH A;  1E3V A;  1GD4 A;  1RJO A;  3G4S 3;  1BNS A;  3CC4 3;  1W6G A;  3G16 A;  3DH2 A;  1NNV A;  3X3Y A;  4QWT A;  2WOH A;  3MYT A;  4WHA A;  1D6Y A;  1BRI A;  1W02 A;  1IV7 A;  4LGQ A;  1AVK A;  1D6Z A;  1OHP A;  1Q9E A;  5AYS C;  4OVM A;  1E3R A;  4GB5 A;  4U13 A;  2KXG A;  1I0V A;  4WYK B;  1I2F A;  1MWU A;  3WOD G;  3DM8 A;  3PZW A;  2OOV A;  2MF7 A;  3CCL 3;  2HMJ B;  1Q7H A;  1BNF A;  2WO0 A;  1I2E A;  3FG3 A;  2YFI B;  3NX0 A;  1SII A;  1US1 A;  3F14 A;  1V74 A;  1BNJ A;  4MMZ B;  2O3O A;  4LZI A;  1U5O A;  3FSD A;  1A67 A;  3D5I A;  2H0I A;  1MNL A;  3CC2 3;  1YVS A;  1STF I;  3ZFZ A;  4BTY A;  1MWS A;  2BO9 B;  2KF5 A;  4HAA A;  3CCU 3;  1N9J A;  3A76 A;  4NRE A;  2GU3 A;  1C54 A;  1I0X A;  3OWY A;  3WOF B;  4N6L A;  8CHO A;  1JB2 A;  3BU4 A;  4L7K A;  1X1X A;  4XDV A;  1TU5 A;  3NQZ A;  2PNC A;  3NXJ A;  1K41 A;  4NPB A;  4XM4 A;  4FMA A;  2IUJ A;  3KKG A;  2CH9 A;  1VQN 3;  4RBN A;  1O7N B;  3AGO A;  1BSA A;  3WHO A;  1O7H B;  1W4N A;  3CC7 3;  3WR2 A;  2E2U A;  3HK4 A;  3G0K A;  1W2Z A;  3FCS B;  1QMA A;  2KCD A;  3DGN A;  1ROA A;  1TP6 A;  2F4Y A;  1Z1S A;  3OV4 A;  5GSP A;  3CCR 3;  1B3S A;  1PY3 A;  2W2C A;  4FCZ A;  2OQE A;  4HKV B;  3KII A;  2PZV A;  1EEJ A;  4XBT A;  3GZX B;  1LNH A;  1W01 A;  1JB5 A;  2GEY A;  4LSO A;  2XGL A;  1CH0 A;  3IJE B;  1HKX A;  3Q3F A;  1T2H A;  5JPP A;  1NWW A;  1LQM B;  2STD A;  3NUV A;  1FGQ A;  2W9Q A;  1N9E A;  3RNT A;  5IEN A;  3B8L A;  1RGC A;  2GSP A;  2HMN B;  3FLJ A;  1B2M A;  3J7Y d;  1G96 A;  1VQ5 3;  4RNY A;  1IV9 A;  1FZU A;  2WGO A;  4BL3 A;  3LYG A;  3DGO A;  2H0H A;  1VQQ A;  2P38 A;  2RSX A;  1RGA A;  3PCR A;  1OF5 A;  1K73 4;  1ZGX A;  1UCK A;  1GY5 A;  3KE7 A;  3KZT A;  4MJD A;  2CFG A;  4R4K A;  4ILF A;  1ASK A;  1W5Z A;  3DXO A;  5IER A;  3CPW 2;  2BU4 A;  5BIR A;  3EJV A;  1HYF A;  1RRH A;  5CF2 A;  2XFT A;  1UUG B;  1FYS A;  3LT9 A;  1MGR A;  1DMQ A;  3CCQ 3;  3NHX A;  4K90 B;  1I3F A;  1B2S A;  1I8V A;  2XH9 A;  3FGY A;  1WMP A;  1MGW A;  3GRD A;  2H0G A;  2IA7 A;  4HZB B;  3GSP A;  1IVX A;  1NB5 I;  1DMM A;  3KSE D;  4EXR A;  3EBY A;  1UGH I;  1YI2 3;  1EA2 A;  3F40 A;  1IQX A;  4HVN A;  4IT7 A;  4HM2 B;  1EUI C;  2XSO B;  2E2T A;  1Q82 4;  3MKI A;  3NM2 A;  1FGT A;  3UL5 A;  2V1L A;  4HOH A;  4HM7 B;  1LOV A;  3FG1 A;  1LOX A;  1ZS7 A;  3FG4 A;  2OOV C;  1NU3 A;  7RNT A;  1KC8 4;  2OCT A;  1BRN L;  1DE3 A;  1GOV A;  1GMR A;  2Z77 A;  3CPO A;  5TGN A;  2R4I A;  3LTA A;  2KRT A;  1BUJ A;  4KFD A;  3OWS A;  1FA3 A;  3Q2P A;  4WYK A;  3TDG A;  1JKG B;  3PYJ A;  3ZG5 A;  1RGH A;  3DGL A;  4GSP A;  1UCI A;  3URP A;  3WA2 X;  3S27 A;  1YVB I;  2IMJ A;  1Q81 4;  1KSI A;  4FCM A;  1RTU A;  2CIU A;  1TTO A;  2E2V A;  2XSH B;  3LML A;  2OTL 3;  3CD6 3;  3S67 A;  2W56 B;  3ER7 A;  2HOH A;  5M18 A;  3LH4 A;  1VQM 3;  1UI7 A;  2Z76 A;  3PGB A;  5IEO A;  1FGR A;  3KCH A;  3WMD A;  1YJN 3;  3EQQ B;  1SJW A;  3GZB A;  3X40 A;  1NJI 4;  1OH0 A;  2ZA4 A;  1DVC A;  3S5C A;  3HOH A;  2UX0 A;  3U1W A;  3LZA A;  1W2B 2;  1IU7 A;  2Z6B A;  4GL6 A;  1TIJ A;  5IG5 A;  4X2O A;  2CX1 A;  1M90 4;  1VQK 3;  1VQL 3;  1KD1 4;  2YFL B;  3ALA A;  3K63 A;  3WOE B;  1VQ7 3;  1FUS A;  2P0X A;  4FCJ A;  4HM3 B;  1BSB A;  1VQ8 3;  2Y74 A;  4CPK A;  4KFF A;  1LOW A;  2OQE C;  3Q90 A;  3MHE A;  1BU4 A;  1T2I A;  4HZ9 B;  2WGQ A;  1JNQ A;  2BHM A;  1NDO B;  1QAF A;  4KZ1 A;  3WA3 A;  1RGG A;  4ZM8 A;  3T8N A;  2L1S A;  5IF6 A;  1OAC A;  1OHO A;  3PCS A;  4R80 A;  1BRG A;  1O7M B;  1R4C A;  3JVC A;  2SBL A;  3NQY A;  4L8P A;  1RMS A;  3I56 3;  1B2U A;  2KF6 A;  4BL2 A;  2BIR A;  1F8N A;  3T0U A;  2OWP A;  1BNE A;  2W03 A;  5AEW B;  3FZW A;  1TUH A;  1RN1 A;  3OW2 2;  4O2H A;  5FW5 A;  2OTJ 3;  2BMR B;  1I70 A;  1OUN A;  2O9U X;  1IT7 A;  3D3L A;  1JB4 A;  1YNV X;  4HBR A;  5CK6 A;  5G1K A;  4N6V 0;  4O02 B;  3O8Y A;  1WQL B;  5AII A;  4MMX B;  1GS3 A;  4JF8 A;  1W00 A;  2UGI A;  3AHS A;  1IQY A;  3N9H A;  2QEX 3;  1GD3 A;  4HM6 B;  2C4B A;  1MWT A;  2CG0 A;  1T5Y A;  1RNT A;  3STD A;  3NM7 A;  2FGT A;  3HIG A;  5EVH A;  2XEP A;  1N8Q A;  1JZO A;  2RGQ A;  2Z7A A;  1I3I A;  3IMA B;  2GBW B;  3K5T A;  4RZM A;  1YJ9 3;  3DY5 A;  4I5Q A;  3SYU A;  2UUG C;  2F98 A;  5IW9 A;  1L5G B;  4WWU C;  1Q42 A;  1LNI A;  4HM4 B;  4CJN A;  4X2H A;  3SOA A;  2IUK A;  1RCK A;  5JBS A;  4KFE A;  2CFL A;  1HU9 A;  2IYJ A;  1QVG 2;  1E97 A;  1RN4 A;  1UGI A;  2RCD A;  4FMC A;  4K1V A;  1NO3 A;  1O7W B;  3EX9 A;  1JRQ A;  1JBR A;  5LC7 A;  4HM8 B;  4EV2 A;  2RNT A;  3LT8 A;  1DET A;  1GMQ A;  1B27 A;  1GYB A;  5LC6 A;  3U97 A;  5D83 A;  1BNG A;  1LRA A;  2HMO B;  2K54 A;  4J8T A;  1FUW A;  1M9G A;  2ML5 A;  2F99 A;  1YIJ 3;  2RBI A;  1WTH A;  3EHC A;  1BNI A;  1T3B A;  1BIR A;  3BNE A;  2B1X B;  2XR8 B;  4NHF A;  2F86 B;  1ROV A;  1M1K 4;  3E99 A;  3M8C A;  1OPY A;  1JKG A;  5CXO A;  3CCJ 3;  3JUN A;  3KN4 A;  4TX4 A;  1O7P B;  3RGA A;  3CME 3;  4N6O B;  4IIA A;  2AAD A;  5KP4 A;  1N5H A;  1SPU A;  3GWR A;  5M1A A;  3V98 A;  1PU4 A;  3CCE 3;  3DGM A;  3SLU A;  1RNB A;  3I55 3;  2ML6 A;  4AKY A;  3L0R A;  5I97 A;  2ZDJ A;  2W56 A;  2YX9 A;  3EN1 B;  3NBB A;  5EQL A;  1SAR A;  2LYX A;  1TRP A;  1W6C A;  4R1K A;  2I9W A;  1BOX A;  1JV2 B;  1QVF 2;  2FXT A;  3B7C A;  1K8A 4;  1TJD A;  3JUQ A;  3BNC A;  1FW7 A;  3LTB A;  3LTC A;  3PS8 A;  5D82 A;  1R4Y A;  1B21 A;  2FNQ A;  1UUW B;  4FR9 A;  1C7H A;  3SED A;  3WDG B;  5BU4 A;  1VQO 3;  2YFJ B;  2L4V A;  3G8Z A;  5ELJ A;  3X3X A;  5G1L A;  3OX9 A;  3CMA 3;  9RNT A;  1D6U A;  4BTX A;  1BNR A;  5CF1 A;  4STD A;  3EE1 A;  1A90 A;  4EV5 A;  1B2Z A;  3Q1C A;  2CFD A;  2CK3 H;  3AMO B;  3MG2 A;  3N8B A;  5AIF A;  1FGO A;  3JUO A;  1A2P A;  1SQW A;  4R9K A;  3D9R A;  1IDP A;  1RGF A;  1FGM A;  2GBX B;  4FMD A;  5HGR A;  1UCJ A;  4DKI A;  3BB9 A;  1V57 A;  4I4K A;  4O3V A;  1KQS 2;  1BUQ A;  1EKM A;  3DZL A;  1M1X B;  3I0Y A;  4R9L A;  1ZX2 A;  4O8S A;  2BT3 A;  2F5W A;  3K0Z A;  1IYY A;  4N6U A;  5HOH A;  3BNB A;  3FKA A;  2A15 A;  1AY7 A;  3UB1 A;  5DRV A;  5AEU B;  1RRL A;  4OK0 A;  4HYZ A;  3X3Z A;  1S72 3;  1ULJ B;  4WP5 A;  3AHW A;  3B4P A;  3FF2 A;  1OHS A;  5ELU A;  1CQS A;  3MWZ A;  4RNZ A;  1GOU A;  3HX8 A;  4XBY A;  2KF4 A;  1G02 A;  1Y4K A;  1LOY A;  4N3V A;  2CWT A;  5IG0 A;  3N54 B;  5IEP A;  3ROB A;  3F8X A;  3LOY A;  5BXQ A;  3D5G A;  1UW1 A;  1A2K A;  3DGY A;  4EW5 A;  2QA4 3;  2B24 B;  3G71 3;  1WMN A;  3F7S A;  4XB5 A;  1LXE A;  4WFO A;  1N5P A;  1TFK A;  1OGZ A;  1GMP A;  2QIY A;  7GSP A;  4J5G A;  1BSC A;  3EC9 A;  1CEW I;  5M19 A;  3CXC 2;  3CCM 3;  3HI7 A;  2BMQ B;  3V92 A;  1BVI A;  3VGN A;  1RN7 A;  3SX1 A;  2W0Q A;  3GZY B;  1CYU A;  2R41 A;  5DRE A;  2GXF A;  3ZG0 A;  2BMO B;  1OGX A;  3MSO A;  1BAO A;  2D1W A;  1JJ2 2;  3IPT A;  1VQ4 3;  1IT8 A;  2ZHX B;  3JUM A;  4J9A A;  3F8H A;  3PXM A;  1RKY A;  2AAE A;  3OXA A;  5IG4 A;  2CWV A;  2GU1 A;  1RGE A;  2F56 A;  1X1Y A;  4CDL A;  2K0M A;  1EG9 B;  1JN5 B;  1RLS A;  5FGO A;  3LXU X;  2CG1 A;  2KF3 A;  1GOY A;  1BRH A;  1AQZ A;  1N8R 4;  1JZD A;  3FF0 A;  4H61 A;  4JRF A;  4K61 A;  1YJW 3;  3MG1 A;  4HM5 B;  1UCL A;  6GSP A;  1PFP A;  1CYV A;  1YGE A;  3G6E 3;  1BSE A;  1QAL A;  4EBG A;  5G2G A;  1DVD A;  2QGU A;  3H3H A;  3T8U A;  1DMN A;  5JPU A;  3GAX A;  3LTD A;  2HMM B;  2CWU A;  3BIR A;  4HJL B;  2ZL8 A;  2P0M A;  1WMO A;  2C10 A;  3UJM A;  1V58 A;  1IVU A;  2XF3 A;  1ISK A;  2F5M A;  1Q40 A;  4BU4 A;  2BNG A;  1RHL A;  2CC3 A;  4BIR A;  4RNT A;  1AR0 A;  1KWI A;  1B2X A;  2CHC A;  1VQ6 3;  5KP3 A;  1BGS A;  3MG3 A;  3KSP A;  3CNM A;  3RGR A;  4LMI A;  5AI1 A;  1I2G A;  1W6Y A;  2P05 A;  3DUK A;  2HML B;  1IVW A;  1W7C A;  2JQ5 A;  2W6J H;  3OWU A;  1JBT A;  4FMB A;  4MMY B;  3S28 A;  3CCS 3;  2CFK A;  4K1U A;  1VQ9 3;  1Q7Y 4;  1FUT A;  3HZP A;  3BND A;  2CW9 A;  3S29 A;  4MEI A;  3VSY A;  5BVB A;  1SIH A;  2MC8 A;  4KT3 B;  1IK3 A;  1UUV B; 
#chains in the Genus database with same CATH homology
 4OUQ A;  3NV0 A;  5CLK A;  2C11 A;  3EBT A;  1IVV A;  1Q40 B;  3CCV 3;  4EYC A;  3B4O A;  4Q53 A;  3CU3 A;  5A0O B;  3AMO A;  3F9S A;  1ZO2 A;  3EB8 A;  2M7O A;  2Q07 A;  4AKZ A;  1ULI B;  3K7C A;  6STD A;  1K28 A;  1TFO A;  2XGN A;  3VF1 A;  3H51 A;  1YIT 3;  3HII A;  3QK9 A;  3SXX A;  1QAK A;  1OCV A;  1S5A A;  1K9M 4;  2W9P A;  2Y73 A;  2INX A;  4CCV A;  1MOL A;  1AVL A;  3NBJ A;  2P09 A;  4IPB A;  3X42 A;  1DYU A;  1AV4 A;  3EF8 A;  1O7G B;  3UNL A;  5IG3 A;  3NV0 B;  5EEO A;  2HMK B;  3RDE A;  3FH1 A;  3SVA A;  2XRX B;  4XDW A;  4BTW A;  1LVN A;  3MPH A;  2XFS A;  4AEQ A;  4N6N B;  2WOF A;  3GZR A;  5AYR B;  3SOY A;  2GEX A;  5D81 A;  1OF5 B;  1VQP 3;  5KP1 A;  4G1M B;  2JDI H;  4LEH A;  3V99 A;  1U8C B;  1J2B A;  3BLZ A;  1A2V A;  1IQ8 A;  1GY7 A;  3ECF A;  4HM0 B;  2CKF B;  4HM1 B;  1QJG A;  3KFQ C;  4N6M A;  1GY6 A;  2D42 A;  4ORL A;  4XBX A;  7STD A;  1VZZ A;  3NBR A;  1EQK A;  5STD A;  3F7X A;  2LQV A;  3EN8 A;  1NB3 I;  2RFR A;  3CNX A;  1YHQ 3;  4H3U A;  4N6T A;  1Q86 4;  3UL6 A;  1JN5 A;  3DMC A;  5AIH A;  3X41 A;  3K9M C;  4L8O A;  4PEJ A;  4EC6 A;  1UI8 A;  1STD A;  3QRD A;  1WNH A;  2CFW A;  2W04 A;  3JUP A;  5AIG A;  4KVH A;  1E3V A;  1GD4 A;  1RJO A;  3G4S 3;  3CC4 3;  1W6G A;  3G16 A;  3X3Y A;  4QWT A;  2WOH A;  3MYT A;  4WHA A;  1D6Y A;  1W02 A;  1IV7 A;  4LGQ A;  1AVK A;  1D6Z A;  1OHP A;  5AYS C;  4OVM A;  1E3R A;  4GB5 A;  4U13 A;  2KXG A;  4WYK B;  3WOD G;  3DM8 A;  3PZW A;  2OOV A;  2MF7 A;  3CCL 3;  2HMJ B;  2WO0 A;  3FG3 A;  2YFI B;  3NX0 A;  1SII A;  1US1 A;  3F14 A;  1V74 A;  4MMZ B;  2O3O A;  4LZI A;  1U5O A;  3FSD A;  1A67 A;  1MNL A;  1STF I;  4BTY A;  2BO9 B;  3CCU 3;  1N9J A;  3A76 A;  4NRE A;  2GU3 A;  3OWY A;  3WOF B;  4N6L A;  8CHO A;  1JB2 A;  4L7K A;  4XDV A;  1TU5 A;  3NQZ A;  2PNC A;  3NXJ A;  1K41 A;  4XM4 A;  2IUJ A;  4FMA A;  3KKG A;  2CH9 A;  1VQN 3;  4RBN A;  1O7N B;  1O7H B;  1W4N A;  3CC7 3;  2E2U A;  3HK4 A;  3G0K A;  1W2Z A;  3FCS B;  1QMA A;  2KCD A;  3DGN A;  1ROA A;  1TP6 A;  1Z1S A;  3OV4 A;  3CCR 3;  2W2C A;  4FCZ A;  2OQE A;  4HKV B;  3KII A;  2PZV A;  4XBT A;  3GZX B;  1LNH A;  1W01 A;  1JB5 A;  2GEY A;  4LSO A;  2XGL A;  3IJE B;  1HKX A;  5JPP A;  1NWW A;  2STD A;  3NUV A;  1FGQ A;  2W9Q A;  1N9E A;  5IEN A;  3B8L A;  2HMN B;  3FLJ A;  3J7Y d;  1G96 A;  1VQ5 3;  4RNY A;  1IV9 A;  2WGO A;  3LYG A;  3DGO A;  2RSX A;  2P38 A;  3PCR A;  1OF5 A;  1K73 4;  1GY5 A;  3KE7 A;  3KZT A;  4MJD A;  2CFG A;  4R4K A;  1ASK A;  1W5Z A;  3DXO A;  5IER A;  3CPW 2;  3EJV A;  1RRH A;  5CF2 A;  2XFT A;  3CCQ 3;  3LT9 A;  1DMQ A;  3NHX A;  4K90 B;  3FGY A;  2XH9 A;  1WMP A;  3GRD A;  2IA7 A;  4HZB B;  1IVX A;  1NB5 I;  1DMM A;  3KSE D;  4EXR A;  3EBY A;  1YI2 3;  1EA2 A;  3F40 A;  1IQX A;  4HVN A;  4IT7 A;  4HM2 B;  2XSO B;  2E2T A;  1Q82 4;  3MKI A;  3NM2 A;  1FGT A;  3UL5 A;  2V1L A;  4HM7 B;  3FG1 A;  1LOX A;  3FG4 A;  2OOV C;  1NU3 A;  1KC8 4;  2OCT A;  2Z77 A;  3CPO A;  5TGN A;  2R4I A;  3LTA A;  2KRT A;  4KFD A;  3OWS A;  1FA3 A;  3Q2P A;  4WYK A;  3TDG A;  1JKG B;  3PYJ A;  3DGL A;  3WA2 X;  3S27 A;  1YVB I;  2IMJ A;  1Q81 4;  1KSI A;  4FCM A;  2CIU A;  2E2V A;  2XSH B;  3LML A;  2OTL 3;  3CD6 3;  3S67 A;  2W56 B;  3ER7 A;  3LH4 A;  1VQM 3;  1UI7 A;  2Z76 A;  3PGB A;  5IEO A;  1FGR A;  3WMD A;  1YJN 3;  3EQQ B;  1SJW A;  3GZB A;  3X40 A;  1NJI 4;  1OH0 A;  1DVC A;  3S5C A;  2UX0 A;  3U1W A;  3LZA A;  1W2B 2;  1IU7 A;  2Z6B A;  4GL6 A;  1TIJ A;  5IG5 A;  4X2O A;  1M90 4;  1VQK 3;  1VQL 3;  1KD1 4;  2YFL B;  3ALA A;  3K63 A;  3WOE B;  1VQ7 3;  2P0X A;  4FCJ A;  4HM3 B;  1VQ8 3;  2Y74 A;  4KFF A;  2OQE C;  3Q90 A;  3MHE A;  4HZ9 B;  2WGQ A;  1JNQ A;  2BHM A;  1NDO B;  1QAF A;  4KZ1 A;  3WA3 A;  4ZM8 A;  3T8N A;  5IF6 A;  1OAC A;  1OHO A;  3PCS A;  4R80 A;  1R4C A;  1O7M B;  3JVC A;  3NQY A;  2SBL A;  4L8P A;  3I56 3;  1F8N A;  3T0U A;  2OWP A;  2W03 A;  5AEW B;  3FZW A;  1TUH A;  3OW2 2;  4O2H A;  5FW5 A;  2OTJ 3;  2BMR B;  2O9U X;  1OUN A;  3D3L A;  1IT7 A;  4HBR A;  1JB4 A;  5CK6 A;  4N6V 0;  4O02 B;  3O8Y A;  1WQL B;  5AII A;  4MMX B;  1GS3 A;  4JF8 A;  1W00 A;  1IQY A;  3N9H A;  2QEX 3;  1GD3 A;  4HM6 B;  2CG0 A;  1T5Y A;  3STD A;  3NM7 A;  2FGT A;  3HIG A;  5EVH A;  2XEP A;  1N8Q A;  2Z7A A;  2RGQ A;  3K5T A;  3IMA B;  2GBW B;  4RZM A;  1YJ9 3;  3DY5 A;  2F98 A;  5IW9 A;  1L5G B;  4WWU C;  1Q42 A;  4HM4 B;  4X2H A;  3SOA A;  2IUK A;  5JBS A;  4KFE A;  2CFL A;  1HU9 A;  1QVG 2;  1E97 A;  4FMC A;  2RCD A;  4K1V A;  1NO3 A;  1O7W B;  3EX9 A;  1JRQ A;  5LC7 A;  4HM8 B;  4EV2 A;  3LT8 A;  1GYB A;  5LC6 A;  3U97 A;  5D83 A;  2HMO B;  2K54 A;  4J8T A;  1FUW A;  1M9G A;  2ML5 A;  2F99 A;  1YIJ 3;  3EHC A;  1WTH A;  3BNE A;  2B1X B;  2XR8 B;  4NHF A;  2F86 B;  1ROV A;  1M1K 4;  3E99 A;  3M8C A;  1OPY A;  1JKG A;  5CXO A;  3CCJ 3;  3JUN A;  3KN4 A;  4TX4 A;  1O7P B;  3RGA A;  3CME 3;  4N6O B;  4IIA A;  5KP4 A;  1N5H A;  1SPU A;  3GWR A;  3V98 A;  1PU4 A;  3CCE 3;  3DGM A;  3SLU A;  3I55 3;  2ML6 A;  4AKY A;  3L0R A;  5I97 A;  2ZDJ A;  2W56 A;  2YX9 A;  3EN1 B;  3NBB A;  5EQL A;  2LYX A;  1W6C A;  4R1K A;  2I9W A;  1JV2 B;  1QVF 2;  2FXT A;  3B7C A;  1K8A 4;  3JUQ A;  3BNC A;  3LTB A;  3LTC A;  3PS8 A;  5D82 A;  2FNQ A;  1UUW B;  4FR9 A;  1C7H A;  3SED A;  3WDG B;  1VQO 3;  2YFJ B;  2L4V A;  3G8Z A;  5ELJ A;  3X3X A;  3OX9 A;  3CMA 3;  1D6U A;  4BTX A;  5CF1 A;  4STD A;  3EE1 A;  1A90 A;  4EV5 A;  3Q1C A;  2CFD A;  2CK3 H;  3AMO B;  3MG2 A;  3N8B A;  5AIF A;  1FGO A;  3JUO A;  1SQW A;  4R9K A;  3D9R A;  1IDP A;  1FGM A;  2GBX B;  4FMD A;  5HGR A;  3BB9 A;  4I4K A;  4O3V A;  1KQS 2;  1BUQ A;  1EKM A;  3DZL A;  1M1X B;  3I0Y A;  4R9L A;  1ZX2 A;  4O8S A;  2BT3 A;  3K0Z A;  4N6U A;  3BNB A;  3FKA A;  2A15 A;  3UB1 A;  5DRV A;  5AEU B;  1RRL A;  4OK0 A;  4HYZ A;  3X3Z A;  1S72 3;  1ULJ B;  4WP5 A;  3FF2 A;  3B4P A;  1OHS A;  5ELU A;  1CQS A;  3MWZ A;  4RNZ A;  3HX8 A;  4XBY A;  1Y4K A;  4N3V A;  5IEP A;  5IG0 A;  2CWT A;  3N54 B;  3ROB A;  3F8X A;  3LOY A;  5BXQ A;  1UW1 A;  1A2K A;  2QA4 3;  2B24 B;  3G71 3;  1WMN A;  3F7S A;  4XB5 A;  1LXE A;  4WFO A;  1N5P A;  1TFK A;  1OGZ A;  2QIY A;  3CC2 3;  3CXC 2;  3EC9 A;  1CEW I;  3CCM 3;  3HI7 A;  2BMQ B;  3V92 A;  3VGN A;  1CYU A;  1RN7 A;  3SX1 A;  2W0Q A;  3GZY B;  5DRE A;  2GXF A;  2BMO B;  1OGX A;  3MSO A;  2D1W A;  1JJ2 2;  1VQ4 3;  3IPT A;  1IT8 A;  3JUM A;  4J9A A;  3F8H A;  3PXM A;  1RKY A;  3OXA A;  5IG4 A;  2CWV A;  2GU1 A;  4CDL A;  2K0M A;  1EG9 B;  1JN5 B;  5FGO A;  3LXU X;  2CG1 A;  1N8R 4;  3FF0 A;  4H61 A;  4JRF A;  4K61 A;  1YJW 3;  3MG1 A;  4HM5 B;  1PFP A;  1CYV A;  1YGE A;  3G6E 3;  1QAL A;  4EBG A;  5G2G A;  1DVD A;  2QGU A;  3H3H A;  3T8U A;  1DMN A;  5JPU A;  3GAX A;  3LTD A;  2HMM B;  2CWU A;  4HJL B;  2ZL8 A;  2P0M A;  1WMO A;  2C10 A;  3UJM A;  1IVU A;  2XF3 A;  1ISK A;  1Q40 A;  2BNG A;  2CC3 A;  1AR0 A;  1KWI A;  2CHC A;  1VQ6 3;  5KP3 A;  3MG3 A;  3KSP A;  3CNM A;  3RGR A;  4LMI A;  5AI1 A;  1W6Y A;  2P05 A;  3DUK A;  2HML B;  1IVW A;  1W7C A;  2JQ5 A;  2W6J H;  3OWU A;  4FMB A;  4MMY B;  3S28 A;  3CCS 3;  2CFK A;  4K1U A;  1VQ9 3;  1Q7Y 4;  3HZP A;  3VSY A;  3BND A;  2CW9 A;  3S29 A;  4MEI A;  5BVB A;  1SIH A;  2MC8 A;  1IK3 A;  1UUV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...