1K8AG

Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
172
structure length
172
Chain Sequence
b'PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 38
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1k8aG01
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1k8aG02
1Q86G 1K8AG 3PIPE 1YIJE 2ZJRE 2ZJQE 5H1SI 1VQLE 1NJIG 3J7ZG 2ZJPE 1KQSE 1KD1G 1YJNE 1VQ9E 3OW2E 1VQ5E 2OTLE 5HL7E 1VQME 4U67E 1S72E 3CCQE 1RL6A 1YHQE 5DM6E 1VQ8E 4IOCE 1Q7YG 5GAEG 3CMAE 3CC7E 3CCME 1VQKE 3I55E 1YITE 3CF5E 1VQ4E 5GAHG 3G6EE 1N8RG 3CCRE 1Q81G 1K9MG 3CC4E 1W2BE 4IO9E 3G4SE 1KC8G 5DM7E 4WFAE 1VQNE 1JJ2E 3G71E 4IOAE 3CCEE 1QVFE 1VQPE 4WFNE 1YI2E 4WCEE 2OTJE 3CCVE 3CPWE 2QA4E 3CXCE 1YJWE 1M1KG 3CCLE 5JVGE 3DLLE 5JVHE 3I56E 2QEXE 1YJ9E 1K73G 1VQOE 1Q82G 1VQ6E 3CCJE 5GADG 1VQ7E 3CC2E 5AN9B 3CMEE 4UY8G 3CCUE 3CD6E 5GAGG 1M90G 4WFBE 3CCSE 2CQLA 5MLCH 4WF9E 3PIOE 1QVGE
chains in the Genus database with same CATH superfamily
2OY7A 2FKJA 1Q86G 1K8AG 3PIPE 1FJ1E 1YIJE 2ZJRE 2ZJQE 5H1SI 2OL6O 1VQLE 1NJIG 3J7ZG 2HKDA 2PI3O 2ZJPE 1KQSE 1KD1G 1YJNE 1VQ9E 3OW2E 2OY8A 1VQ5E 2OTLE 5HL7E 3IG9A 1VQME 3CKGA 4U67E 1S72E 2I5ZO 3CCQE 1RL6A 1YHQE 5DM6E 3IGEA 1VQ8E 4IOCE 1Q7YG 5GAEG 3CMAE 3CC7E 3CCME 1VQKE 2AF5A 3I55E 1YITE 2FKGA 3CF5E 1VQ4E 5GAHG 2OY1O 3G6EE 2OYBO 1N8RG 3CCRE 1Q81G 1K9MG 3CC4E 5B11O 1W2BE 4IO9E 3G4SE 1KC8G 5DM7E 4WFAE 1VQNE 1JJ2E 5B10O 1OSPO 3G71E 2OY5O 4IOAE 3CCEE 1QVFE 1VQPE 4WFNE 1YI2E 4WCEE 2G8CO 2OL7A 3CCVE 2OTJE 3CPWE 2QA4E 5B3MO 3CXCE 1YJWE 1M1KG 3CCLE 3AUMO 5JVGE 1P4PA 3DLLE 5JVHE 3I56E 3EC5A 2QEXE 1YJ9E 1K73G 3CKFA 1VQOE 1Q82G 1VQ6E 3CCJE 5GADG 1VQ7E 5B2AO 3CC2E 5AN9B 3CMEE 4UY8G 2I5VO 3CCUE 3CD6E 5GAGG 1M90G 4WFBE 1RJLC 2OL8O 3CCSE 2CQLA 5MLCH 4WF9E 3PIOE 1QVGE
chains in the Genus database with same CATH topology
1Q86G 1K8AG 3PIPE 1YIJE 2ZJRE 2ZJQE 5H1SI 1VQLE 1NJIG 3J7ZG 2ZJPE 1KQSE 1KD1G 1YJNE 1VQ9E 3OW2E 1VQ5E 2OTLE 5HL7E 1VQME 4U67E 1S72E 3CCQE 1RL6A 1YHQE 5DM6E 1VQ8E 4IOCE 1Q7YG 5GAEG 3CMAE 3CC7E 3CCME 1VQKE 3I55E 1YITE 3CF5E 1VQ4E 5GAHG 3G6EE 1N8RG 3CCRE 1Q81G 1K9MG 3CC4E 1W2BE 4IO9E 3G4SE 1KC8G 5DM7E 4WFAE 1VQNE 1JJ2E 3G71E 4IOAE 3CCEE 1QVFE 1VQPE 4WFNE 1YI2E 4WCEE 2OTJE 3CCVE 3CPWE 2QA4E 3CXCE 1YJWE 1M1KG 3CCLE 5JVGE 3DLLE 5JVHE 3I56E 2QEXE 1YJ9E 1K73G 1VQOE 1Q82G 1VQ6E 3CCJE 5GADG 1VQ7E 3CC2E 5AN9B 3CMEE 4UY8G 3CCUE 3CD6E 5GAGG 1M90G 4WFBE 3CCSE 2CQLA 5MLCH 4WF9E 3PIOE 1QVGE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 G;  1K8A G;  3PIP E;  1YIJ E;  2ZJR E;  2ZJQ E;  5H1S I;  1VQL E;  1NJI G;  3J7Z G;  2ZJP E;  1KQS E;  1KD1 G;  1YJN E;  1VQ9 E;  3OW2 E;  1VQ5 E;  2OTL E;  5HL7 E;  1VQM E;  4U67 E;  1S72 E;  3CCQ E;  1RL6 A;  1YHQ E;  5DM6 E;  1VQ8 E;  4IOC E;  1Q7Y G;  5GAE G;  3CMA E;  3CC7 E;  3CCM E;  1VQK E;  3I55 E;  1YIT E;  3CF5 E;  1VQ4 E;  5GAH G;  3G6E E;  1N8R G;  3CCR E;  1Q81 G;  1K9M G;  3CC4 E;  1W2B E;  4IO9 E;  3G4S E;  1KC8 G;  5DM7 E;  4WFA E;  1VQN E;  1JJ2 E;  3G71 E;  4IOA E;  3CCE E;  1QVF E;  1VQP E;  4WFN E;  1YI2 E;  4WCE E;  2OTJ E;  3CCV E;  3CPW E;  2QA4 E;  3CXC E;  1YJW E;  1M1K G;  3CCL E;  5JVG E;  3DLL E;  5JVH E;  3I56 E;  2QEX E;  1YJ9 E;  1K73 G;  1VQO E;  1Q82 G;  1VQ6 E;  3CCJ E;  5GAD G;  1VQ7 E;  3CC2 E;  5AN9 B;  3CME E;  4UY8 G;  3CCU E;  3CD6 E;  5GAG G;  1M90 G;  4WFB E;  3CCS E;  2CQL A;  5MLC H;  4WF9 E;  3PIO E;  1QVG E; 
#chains in the Genus database with same CATH topology
 2OY7 A;  2FKJ A;  1Q86 G;  1K8A G;  3PIP E;  1FJ1 E;  1YIJ E;  2ZJR E;  2ZJQ E;  5H1S I;  2OL6 O;  1VQL E;  1NJI G;  3J7Z G;  2HKD A;  2PI3 O;  2ZJP E;  1KQS E;  1KD1 G;  1YJN E;  1VQ9 E;  3OW2 E;  2OY8 A;  1VQ5 E;  2OTL E;  5HL7 E;  3IG9 A;  1VQM E;  3CKG A;  4U67 E;  1S72 E;  2I5Z O;  3CCQ E;  1RL6 A;  1YHQ E;  5DM6 E;  3IGE A;  1VQ8 E;  4IOC E;  1Q7Y G;  5GAE G;  3CMA E;  3CC7 E;  3CCM E;  1VQK E;  2AF5 A;  3I55 E;  1YIT E;  2FKG A;  3CF5 E;  1VQ4 E;  5GAH G;  2OY1 O;  3G6E E;  2OYB O;  1N8R G;  3CCR E;  1Q81 G;  1K9M G;  3CC4 E;  5B11 O;  1W2B E;  4IO9 E;  3G4S E;  1KC8 G;  5DM7 E;  4WFA E;  1VQN E;  1JJ2 E;  5B10 O;  1OSP O;  3G71 E;  2OY5 O;  4IOA E;  3CCE E;  1QVF E;  1VQP E;  4WFN E;  1YI2 E;  4WCE E;  2G8C O;  2OL7 A;  3CCV E;  2OTJ E;  3CPW E;  2QA4 E;  5B3M O;  3CXC E;  1YJW E;  1M1K G;  3CCL E;  3AUM O;  5JVG E;  1P4P A;  3DLL E;  5JVH E;  3I56 E;  3EC5 A;  2QEX E;  1YJ9 E;  1K73 G;  3CKF A;  1VQO E;  1Q82 G;  1VQ6 E;  3CCJ E;  5GAD G;  1VQ7 E;  5B2A O;  3CC2 E;  5AN9 B;  3CME E;  4UY8 G;  2I5V O;  3CCU E;  3CD6 E;  5GAG G;  1M90 G;  4WFB E;  1RJL C;  2OL8 O;  3CCS E;  2CQL A;  5MLC H;  4WF9 E;  3PIO E;  1QVG E; 
#chains in the Genus database with same CATH homology
 1Q86 G;  1K8A G;  3PIP E;  1YIJ E;  2ZJR E;  2ZJQ E;  5H1S I;  1VQL E;  1NJI G;  3J7Z G;  2ZJP E;  1KQS E;  1KD1 G;  1YJN E;  1VQ9 E;  3OW2 E;  1VQ5 E;  2OTL E;  5HL7 E;  1VQM E;  4U67 E;  1S72 E;  3CCQ E;  1RL6 A;  1YHQ E;  5DM6 E;  1VQ8 E;  4IOC E;  1Q7Y G;  5GAE G;  3CMA E;  3CC7 E;  3CCM E;  1VQK E;  3I55 E;  1YIT E;  3CF5 E;  1VQ4 E;  5GAH G;  3G6E E;  1N8R G;  3CCR E;  1Q81 G;  1K9M G;  3CC4 E;  1W2B E;  4IO9 E;  3G4S E;  1KC8 G;  5DM7 E;  4WFA E;  1VQN E;  1JJ2 E;  3G71 E;  4IOA E;  3CCE E;  1QVF E;  1VQP E;  4WFN E;  1YI2 E;  4WCE E;  2OTJ E;  3CCV E;  3CPW E;  2QA4 E;  3CXC E;  1YJW E;  1M1K G;  3CCL E;  5JVG E;  3DLL E;  5JVH E;  3I56 E;  2QEX E;  1YJ9 E;  1K73 G;  1VQO E;  1Q82 G;  1VQ6 E;  3CCJ E;  5GAD G;  1VQ7 E;  3CC2 E;  5AN9 B;  3CME E;  4UY8 G;  3CCU E;  3CD6 E;  5GAG G;  1M90 G;  4WFB E;  3CCS E;  2CQL A;  5MLC H;  4WF9 E;  3PIO E;  1QVG E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...