1K8AR

Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 17
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2001-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1k8aR00
1Q86R 3G6EQ 1K8AR 3OW2P 1S72Q 1YHQQ 1K73R 2OTJQ 3CC2Q 1VQ8Q 1W2BP 1VQKQ 3G4SQ 1VQNQ 3CPWP 1KQSP 3CC4Q 1YJ9Q 3CMEQ 3CCLQ 3CCUQ 3CCMQ 1YIJQ 1Q7YR 1VQ5Q 3CD6Q 1VQMQ 1YJWQ 3CCRQ 1NJIR 1YI2Q 1Q82R 1QVFP 3G71Q 2QA4Q 1KD1R 3CCEQ 1JJ2P 3I55Q 1QVGP 3CC7Q 1VQLQ 3I56Q 3CCQQ 3CXCP 1VQ6Q 1M1KR 1VQ4Q 1VQPQ 1Q81R 2QEXQ 1YITQ 1K9MR 2OTLQ 1KC8R 1VQ7Q 1M90R 3CCSQ 1N8RR 1VQ9Q 1VQOQ 1YJNQ 3CMAQ 3CCVQ 3CCJQ
chains in the Genus database with same CATH superfamily
4N4IA 4E6RA 3MEUA 2YUOA 4M78B 1S72Q 2DJZA 3VRZA 2QQAA 1U1TA 2V1QA 5IHKA 2LX9A 1I5OB 2QQRA 1YHQT 4OB3B 2A37A 1YJNA 3SWNB 3N5BB 4A4EA 1WJQA 1VQ4Q 3RKXA 2YXYA 2DX1A 1YBYA 4XTZA 2WSEE 2XKOC 3VKIA 3C95A 2LRQA 2RJEA 2XI9A 3NMZC 1SKUB 1G3SA 2K5LA 3TSWA 1QKWA 3NGPA 2X51A 1K9MU 2DL4A 1M3CA 2QA4T 1JU5C 4KT0E 3PFSA 3M0RA 1NLPC 4E2FB 3EG2A 1KG1A 3OY9A 3INZA 4HVUA 1ZSZB 2JMCA 2CZ7B 4EMGA 2MWOA 2ZAEA 1VQMA 3RBBB 2P0KA 2GCXA 5GAMf 2VXFA 3EGDB 7AT1B 2LJ0A 2DZCA 4QQ6A 3P8HA 4R0KA 2HEQA 2DM1A 2DO3A 4EMHA 5GJWB 2CP2A 3SHWA 3CQTA 4RG2A 2OTLA 1G3YA 5KCHA 1OPKA 3EGXA 2L0AA 2RNAA 2J6FA 2P0PA 2VUBA 5FU6B 4DQ2A 1MV3A 4DEYA 4J6YA 3M0TA 4LXCA 5GAMh 2A36A 4CC4B 4M78G 2FEIA 4NL3A 4AT1B 1SRMA 3RERA 5J39A 5IHNA 1G8XA 1WPYA 2ED1A 2LQKA 3HTRA 2QK0A 4BD3A 3CCSA 2FHDA 4J9HA 5GAN2 4J83A 8AT1B 3META 3CCQA 2RM4A 3P8BB 3L1AA 4LN2A 1VQKT 2RQWA 2YHTA 2KAFA 1VQMT 1YFNA 3PVQA 1YP5A 4PJOB 3HFNA 4MMKA 1ZX6A 3TQ7P 1K9AA 4AFSC 1H3ZA 2PNIA 5GANf 3CPFA 2K6DA 2QI2A 2EKHA 2DTOA 2CREA 1JRIA 4C92C 4JPBW 1ZBXA 4J9CA 5AYFA 3JCMc 4O5VA 3MKDA 1VQ7Q 2E65A 4ZTFA 3OYEA 2FPDA 4OMPA 1KFZA 1K73R 3LW5E 4ZN3A 4B6MA 3CBMA 1OOTA 2V8KA 1UEBA 3KXTA 4E7SA 1NJIR 2GFUA 3TREA 3X20B 5CK9A 3OYAA 3HRTA 5CAIA 5GANh 1UJYA 4HKEA 3UF4A 2OAUA 4J8OA 1LPLA 4BI4A 5LJ5e 1RAEB 4M7DC 3I35A 4HCKA 2EBPA 2EPDA 4BI3A 2E64A 2KK4A 1VIEA 3I5RA 1XTDA 1JJ2P 1QVGP 2RI3A 1RAFB 3PT9A 1TUGB 1R77A 4J9FA 1VQ4A 2EJFA 1XQHA 3S3NA 3UATA 4BUGA 1YJNQ 3UWNA 5IN1A 4C92E 1ZUUA 2RQUA 4NL2A 4DEXA 1Y57A 1VYTA 4X1VA 1A0NB 5GAOr 2IIMA 2OI3A 1X2QA 4A4FA 2ECZA 2E6NA 1MNDA 5CIUA 1YJWT 4F04B 4J5YA 2P84A 2Y90A 5AT1B 4KH1B 5GAMd 1BBZA 3VS1A 2LCLA 2DXCA 5FWCA 3ZEHA 1NYFA 2BKDN 3SEMA 1UE9A 1BYMA 3EG1A 4CC3A 3FLGA 1JXMA 5GAN8 1UJ0A 3OS2A 2JUFA 1U5SA 2RJFA 3RMQA 1ZA2B 3CC7Q 2KVQG 1HSQA 1GBRA 4R55A 5GMKi 1UDLA 2GF7A 1KQSS 4M75D 5LL6S 4J9IA 4OGCA 3WVEB 2JJ9A 5FRMA 5LJ5j 5A2QE 2A3LA 1W4SA 2H3EB 1WQ7A 3CCMT 1SHFA 1YWOA 1VYVA 3LH0A 1OPLA 4HT9A 3GIBA 3M55A 3CD6T 5A0LA 2DJQA 2LVMA 1H8KA 4TVRA 3CMET 2A0FB 1VQLT 1G5VA 1U1SA 4OMFB 3UA6A 5LJ5f 1WQWA 1JQQA 3THKA 1GBQA 4F16A 5CKHA 2LCSA 3CCRT 3IQLA 3SWNC 5GJVB 1N9SA 2NUPA 2BIVA 3JCMd 2JVVA 1WIEA 4JUVA 2HKNA 1BI0A 3LLRA 3H0HA 1M3BA 4PLIA 2ESWA 4M78A 2COYA 1KC8U 3H6ZA 5A0GA 4F17A 2JMAA 2VV5A 2LQNA 1QVGS 2VKNA 1JEGA 2SRCA 4BI8B 1CSKA 1O75A 4GLKA 1FYNA 1PRLC 1ZLMA 1D0XA 1D0ZA 2DEQA 3DKMA 1WXUA 4J6XA 5D6XA 4EMKA 1H92A 2FZCB 5GAOl 1FWZA 1PSEA 2J06A 2MYSA 3M9QA 1RLQC 3JCMW 5KYWA 1SEMA 1M9SA 2M0OA 3MP6A 4JRQA 2HZYA 4KGVB 3ZFJA 1VYUA 3MCAB 3LH5A 3SD4A 3FDRA 3CXCS 1G3WA 2XG8D 3V7RA 2CSIA 4JJBA 1Q82C 3FEOA 1AVZC 1ZUYA 1UB4A 1NG2A 1PCXA 4Y28E 2LCCA 2YDLA 1BI1A 3CC7T 1BU1A 2RJCA 3VS4A 2K2MA 2K7AA 2KNBB 2RO0A 2YRVA 2QDYB 5LJ5h 1JB0E 1JO8A 1WA7A 4C8QC 4M7AD 3M0PA 4PJLA 1ZSGA 2ROLA 4FL6A 1VQ6T 2DL8A 4IIMA 4OMNA 3KBGA 1WXBA 4C8QA 2RQRA 4J6WA 5KYUB 2KR3A 3L2QA 1M27C 3CPWS 1D1CA 5CVIA 1PHTA 2QXFA 3CCJT 1Q86C 4OVAA 1IGQA 3REBB 4RUGA 3L2RA 4CC2A 2O88A 3OYCA 2D9TA 2FZGB 3VV0A 1M30A 2HBPA 2HL3A 3VYGA 4PJJA 1VQNQ 2KY9A 1PG5B 1GCQA 4JS4A 3OSSC 5LJ3e 3NPFA 3OYKA 4M7AE 2DIGA 1MHNA 1JJ2S 2C0OA 2VWFA 2EYZA 3G71T 4A53A 4OB1B 5HK0A 2HDAA 4CI0C 2DTIA 2EWNA 2K79A 1K76A 1W2BA 1M3AA 4M75A 3JCMf 1OULA 3JB9H 4BE1A 4JLIA 4A54A 1QMCA 3ASKA 3T9NA 4EDUA 1AOJA 1AEYA 4M77C 1SG5A 1VA7A 4LDUA 2LJ1A 3VS2A 4XU3A 4QVZA 1WZOA 1D1BA 3CC2T 3L2WA 3HSBA 2OX7A 3MP8A 1IGUA 4QKUA 1SF9A 1T0HA 3JCMb 1JJ2A 3OW2A 4FSSA 4XQ3A 5CKBA 3C12A 2AHJB 3CCLQ 5ECAA 1G83A 2IG0A 4C8QF 3PE0A 1WHGA 1OU9A 3CCEA 4PJOF 5D6YA 1VQPQ 3CC4A 1C1AA 3M59A 3QUIA 3CC7A 1BIAA 1UGQB 3OYNA 1QWEA 4PNOA 2M02A 2EVRA 2CP5A 2AKKA 4KRTA 2F2XA 3EGDA 2YSQA 2COWA 1UHFA 1YJWQ 2CZ0B 2L8DA 4FYXB 2ZPFB 1R8OB 3QO3A 1BI3A 2DMOA 2P0QA 2JTFA 2C0TA 3QSUA 3RNJA 3CBPA 1MV0B 2YWWA 3CCJA 3OW2P 2YRCA 4BY6B 1HXDA 3NHNA 3JCMe 2QQSA 4RTYA 3SB2A 3QDFA 5CKFA 1K73C 3CMAA 2EQIA 4X34A 3L2VA 4M77G 2DA9A 2EGAA 3CCQQ 2LNVA 2HQHA 1HJDA 2DZ9A 2DIQA 2ZPIB 3OYFA 2F69A 3O5ZA 1M90R 2HSPA 2NYSA 1KHIA 4DBQA 4PJMA 3CCST 2JS0A 3UT1A 1GFCA 1VQOT 2GNCA 4QQDA 1KD1C 2DYBA 3QHSA 1JXOA 2NWMA 4MDXA 3AHUA 2X4WA 4AMCA 2VXEA 3CD6Q 4M77D 2DBKA 4BE0A 1VQLA 1YI2Q 2DE0X 3G71Q 3Q1JA 2RHXA 2QYZA 1YIJA 1I8FA 2E3HA 2OTLQ 4P5NA 1OYXA 5J3BA 4BB7A 5CKDA 1C0MA 2DBMA 1YITT 4M7DD 2DAQA 1YHQQ 1IREB 4PFZA 1ZA1B 5CQXA 1ZQ1A 4ZTJA 1Q81U 1GXIE 1C6VX 2K2VA 1E6GA 2CYZB 2LNHB 2O9SA 1K8AU 4C92F 4E7LA 1PRMC 3CCET 3OBYA 4DOVA 3ZBDA 2PTKA 4C8QG 4MZTA 4C92D 1OU8A 3CPWA 2LJ3A 3EG0A 3FJPA 1SSFA 2BZXA 5GAN4 1EX4A 5LJ3g 1N8RR 4C8QD 1RI9A 4M7AC 3CMAQ 1KQ2A 1VQ5T 2L3SA 2ROTA 2DFUA 4VUBA 1BCMA 1TSFA 2F5KA 2HBWA 2L3PA 5KYWB 4FYWB 1PWTA 1QKXA 1TU0B 1Q82R 3EFSA 1WLPB 2L89A 2MPXC 4JDSA 4X9CA 2A28A 4RMOA 1OZ2A 3M57A 1FXXA 3CXCA 4F7UA 1R0BG 1UECA 5I2SA 1AWXA 2CZ6B 3M0SA 3OYBA 1YJWA 2DEUA 1TS9A 1TG0A 4ME7A 3OYJA 4M7AF 3FRNA 1TWBA 4LD6A 3L2ZA 1RAHB 2CT4A 3CPWP 1U06A 2QTXA 2XDBA 1WDXA 1T3LA 4LDXA 3F70A 5IT9E 1Q95G 4RKUE 1VUBA 1KC8R 3QIIA 4IKFA 3J7AF 4II1A 1VQOQ 2ENMA 2DF6A 2DD5A 5GAOp 2MAMA 1XNIA 5FU7B 1WX6A 4MZPA 2D1XA 3MHXA 4Z02A 3QDRB 3TVTA 4PKCC 5GAOq 2ZPEB 4OF1A 2NLUA 3QJ6A 3CXCP 1AT1B 2XK0A 1MGQA 4QQGA 3EFOA 3TCJA 3LGFA 4FT4A 1FMVA 4J9GA 1RI0A 2DXTA 3CMEA 5D6WA 3PIPA 4BDZA 2RJDA 2QEXA 4N0AA 1IXDA 1M8MA 2JTEA 2X3XD 1HYOA 3C94A 5KH6A 2KEAA 2E5KA 4JZ4A 3VS0A 4GY5A 1LNXA 1XOVA 2XU8A 1QLYA 1N8RC 2PQWA 2PU9B 4ZN1A 9ATCB 1S72A 2YLBA 2KRSA 3A1PA 1VQ9A 3H9NA 4M7AA 5I21A 1MMGA 2HSEB 3JCMh 3CCUQ 2M9UA 2KXCA 1IZ6A 1R0CB 3V8JA 2O31A 2F1LA 2LT4A 1N27A 4OMQA 5C0MA 3NTKA 1YCYA 4GBQA 4NS5A 4FCYA 1BCOA 5KYYA 3M0QA 3QYHB 4HCZA 5LJ3h 4KGXB 1Y71A 1B3QA 3G4SQ 3JAME 1M2OA 3ULRB 2X4XA 4XTWA 4OGEA 4WCIA 3JV3A 4LD9K 1SHGA 3CC4T 2GGRA 2DERA 2B86A 2COZA 2K9GA 2EW3A 1VQ6Q 2I2LA 1X43A 4J9DA 1RAGB 2QQ9A 4FW2A 4F7UB 5C6SA 2JZ2A 3MJXA 2DXBA 3FIFA 1Q86R 1W6XA 1K8AR 1VQ8T 2KT1A 1M5Q1 1Y96A 3X26B 3VRYA 2CP6A 1TUCA 2K5FA 3GP8A 3EHQA 4XTUA 1HD3A 3CCRQ 4JRPA 4HXJA 2RA2A 4JJDA 1K4US 1VQ4T 1WFWA 1X75C 2KDSA 2V8JA 1K9MR 1YCSB 5GAMg 4M7DG 4Z88A 3A8GB 4X9DA 2I0NA 2MMPA 2CT3A 2NUTB 1VIFA 2KSSA 1W2BP 3CEYA 1VQ6A 1MMNA 3PNWC 2DNUA 2VGMA 2QA4A 1Q7YC 1KD1R 2DVEA 1UGSB 1WHMA 5FROA 3PGGA 3H0FA 2G3RA 4C0GA 4BDYA 1AZEA 3RESA 5GANg 3G4SA 3OYGA 2XDDA 4ATOA 3G7ZA 2KRNA 1ZSZC 4AFZC 4OMMA 2DYIA 2D8JA 2W0ZA 3REAB 1O9SA 1PKTA 2EAYA 1M1KC 4C92G 1KSWA 4C5HA 1VQ9T 2HQXA 1YITA 3HP9A 4XAXB 2MWPA 1U3OA 4JZ3A 4RCBA 2GBQA 2XD0A 2X9HA 5KYXB 1WGSA 3OYLA 2CUDA 4PJOE 2JOYA 4EMKC 5GAN3 2XMFA 3H41A 1TUDA 3FB9A 1I1JA 1RAAB 3EH1A 1NPRA 1NYGA 2IPOB 4L5GA 3JRZA 2MCNA 2RHIA 2F2WA 4B9XA 5IXFA 2AT1B 4M75G 4IIOA 1UUEA 1BKBA 1OQKA 3I56T 2YRDA 2HKQB 5CR2A 2XHCA 5GANj 2PUOB 1NZ9A 1B7TA 2R5AA 1MMDA 3C4SA 1SRLA 2C06A 2HAXA 3OA6A 2MK5A 2LZ6B 2DL5A 3M58A 2L3QA 2IVWA 4M77A 4N0AC 3I55A 1K9MC 3RIRA 3GNGA 5DY9A 3QBYA 4IUTA 2J6KA 3FJ5A 1UFFA 3PMTA 3L2UA 4QW2A 1VQOA 1CKBA 2E70A 2RH2A 3DB4A 4UC4A 1NJIC 2DVJA 2XDPA 4PJOC 4E7ZA 4JJCA 2B8AA 4RTUA 5GMKe 1BI2A 2JM8A 3EGXB 4CC7A 1KHCA 4ANJA 2FYKA 2EQMA 4M75C 2OTJA 3LWIA 1SPKA 4JRKA 5KYYB 1EZZB 3EHRA 3DLLA 3QXEB 3DB3A 4XU2A 2H3JA 2F5TX 4HVVA 1BIBA 2QEXQ 4RTWA 5DM7R 5FU7C 4WF2A 2KBTA 1VQNT 2AZVA 3I55T 2CH4A 2M0YA 2XICA 3RMSA 3CC2Q 2LP5A 4Z8AA 3RDVA 2L5QA 3VS3A 2VASA 3KFVA 2R5MA 5KYUA 4Y91A 4XK8E 4AFUC 3JCMg 3HRUA 4DA4A 2RQVA 3OS5A 1VOMA 3CCLT 4XTXA 2DRMA 4ELYC 2AIRB 4QVDA 4ESRA 1FMKA 3D7SB 3MEWA 3URGA 1D3BA 4MMLA 2O01E 8ATCB 2G6FX 4OB0B 5KCOA 1F1BB 2OTJT 2QASA 4E7IA 2WACA 2O2OA 1VQ7A 4M78F 3QYGB 1WJRA 4E47A 4EMKB 3EG3A 3GF5A 4XTVA 1BB9A 2QAZA 3V7SA 2JXBA 3HRSA 4F7UG 5KYNA 3G6EA 1QVGA 3HKSA 5GMKh 2KQWA 1W70A 2RD1A 1UGPB 3L42A 3LGLA 5GANe 1RADB 2JS2A 4RTTA 2FO0A 5KE2A 3G71A 3JCMP 1VQLQ 2CS7A 4F7UE 1QP2A 4FT2A 3CD6A 2V8IA 5IHIA 4PJOA 3SFMA 1VQKA 6AT1B 1IO6A 2E12A 1Z9ZA 5DLQE 4MDWA 3BDLA 1KC8C 1VQKQ 3E19A 3GBQA 4C92A 2X4JA 2KMTA 2M51A 1VQ7T 2HQEA 2HD0A 3E9FA 2FB7A 3OMCA 3G1JA 3TSZA 5GMKl 1M2VB 2MI6A 2OJ2A 1NJIU 4LDYA 3TEEA 1IHWA 3CCJQ 3WVDB 1SSHA 5KE3A 1ARKA 1X01A 2E4HA 2E1HA 1VQNA 2WSFE 1P92A 4J7IA 5CO7A 4D8KA 4WTOB 4HT8A 2PZ1A 1I81A 4N4HA 2R57A 1YJ9T 1I0CA 1Q81R 5D7UA 3RKWA 2HMAA 2F2VA 1K0XA 3CCLA 1WHJA 3ER0A 2MIOA 3TU4K 2E3IA 3R6NA 3HFOA 1J3TA 4IUPA 1CKAA 1YIJQ 5LJ3d 3QKJA 3BFMA 4RTVA 2QGFB 1M1KR 1PM3A 2E10A 2EJGA 1YJNT 5GAOn 2DILA 4ZGEB 1PD0A 5HY6A 1M4ZA 3H8ZA 1QVFS 2JW4A 1Y07A 4A4HA 5A0DA 1M1GA 3CCVA 2EQKA 5I2MA 2BTTA 3A5ZB 4F14A 1RABB 1UTIA 4EPCA 1KQSP 3MEAA 3CMAT 2RHUA 4M75F 4E7HA 2EQJA 4FSXA 1N6AA 1AWJA 4D8DA 2PVGB 3OYYA 1I5LA 2CSQA 1UHCA 2FRYA 2XIDA 4J7FA 1I07A 1NPPA 2BE7D 1GCPA 2RK1A 4IURA 2EKOA 2RB6A 3M0UA 2K3XA 5I11A 2CP0A 5IXBA 2M1HA 3M56A 1B34B 3I9QA 2KGTA 1K8AC 1AWOA 1S72T 1PC0A 2FL7A 2EFIA 1OX8A 3GNFB 2KT8A 3ZL7C 5GAMj 5DLOA 4K11A 2ED0A 4GLMA 1WHKA 2QG9B 3M53A 2EIFA 5GAN6 4FU6A 3CCMA 1KD1U 3OS1A 3CCVT 4M7DA 1UGVA 2MOXA 2QTVA 1GL5A 2EGCA 1E7OA 5GANd 2ABLA 4PJNA 2KRMA 1B34A 3M4YA 1NBEB 3NFCA 5GAN5 4F7UF 2QDLA 1RACB 5CQYA 5GAOm 2E41A 4LUDA 3OMGA 4XTYA 2HL5C 3CCQT 3CCRA 2EYQA 2NUPB 1AHJB 1V76A 3GPLA 4FW1A 4IUVA 4C5IA 1Y96B 1W1FA 4QVCA 2X35A 5FWBA 5FLXE 4R56A 2KI7A 1K73U 1MMAA 1FX7A 4LDVA 1QWFA 1FMWA 2J05A 1VQ5A 1X6BA 4JJNK 2DK3A 3BDUA 4OP0A 3J81E 4AG2C 1V29B 2BE9B 1TOVA 2JNGA 1M8VA 3VJPA 1G3TA 4M78C 2O4XB 3VUZA 1QW1A 3DLMA 3NTHA 2M16A 2CP7A 3CCUT 2GFAA 1NEGA 4N4GA 3EG9A 2GTJA 3M5AA 1X2KA 3JCMX 4C92B 4PJOG 4C5EA 2HNIA 3SDZA 4HA8A 2EJ9A 4RCCA 4FYYB 3SWNA 1AZGB 3HHTB 2RI2A 3JSCA 4XU1A 3FC3A 3I5SA 2ZCFB 4C8QB 2JTMA 2V26A 3I56Q 5EC7A 4O6JA 1G2BA 2LTOA 3E1SA 2QGGA 3M54A 4A4GA 2DETA 3EG9B 3KUFA 4ELZC 4ORZA 2FRWA 4M4ZA 2X3WD 3VS5A 1D0YA 3OBWA 4V2SA 4FIBA 4PFPA 1M90U 4DBHA 3CMEQ 1VQ5Q 4JS5A 1NEBA 2RHYA 4BE2A 3V8KA 1W2BS 3OW2S 5GMKj 1M90C 2LMJA 2PUKB 1ABQA 1QCFA 3VYHB 4DOWA 2RK2A 3V8LA 3OB9A 3CCVQ 5EG2A 4DBFA 5HK3A 2BZYA 3M4GA 3JB9D 2LQWA 3ME9A 3EAEA 3U23A 3C0CA 1QCOA 1LVKA 5GMKm 3J80E 4AG1C 2DL7A 2QQBA 5I22A 4LUEA 1YHQA 3QWYA 4LDWA 2CGHA 1KIKA 2RN8A 2CDTA 4HCCA 2FG0A 4ZGDB 3AT1B 4A4KA 5LJ3j 3LX7A 3QG1A 4C8QE 3CBOA 3V7CA 2Y4XA 1VQ9Q 2FVUA 1YI2A 2LQ8A 1RL2A 2E5QA 4M77B 1Q81C 1QP3A 1PNJA 2K3BA 4KH0B 3MO8A 1Z9QA 1NM7A 2CP3A 2WSCE 1OV3A 4PL6A 3NTIA 2O4XA 2YUNA 2AKLA 4M7DB 1RUWA 1UGRB 2R58A 2FPFA 4M78D 1VQ8A 2DKGA 4HCBA 1PKSA 2FPEA 3JB9J 2K4YA 3JB9I 2OTJQ 1ABOA 2ATCB 2AZSA 2ZPBB 3OYHA 2RQTA 1EIFA 5LJ3f 2JN0A 2RMOA 1D1AA 1WI7A 3LWHA 3OSVA 1D09B 2K3YA 1AD5A 4Q5WA 2PVOB 2LDMA 1Y0MA 5IH2A 5LJ5g 4M75E 1Q86U 3GLXA 3A8LB 4M7DE 2C0IA 3OS0A 2K57A 2H8HA 1YNZA 1BK2A 3LYIA 4M7AB 4E7KA 4IUUA 4M77E 4MZMA 2ZZDA 1VQMQ 2E6ZA 3R6OA 2EYXA 5L8RE 1ZHIA 4JLGA 3G4ST 5FU6C 1MNEA 3PMIA 4A63B 3QZ5B 1QQJA 3MPUB 4M78E 2JT4A 5KYXA 3S3MA 1YN8A 2SEMA 1E6HA 3E2UA 2ZPHB 1EFNA 5CKEA 2BZ8A 4RTXA 4J9EA 2DD4A 1MUZA 4RTZA 4YTLA 5HCKA 3PTAA 4C0ZA 3UPUA 2CH4W 3QWXX 2CKKA 1N8RU 3RKYA 2NUZA 2VVKA 1T3SA 1YJ9A 1H3HA 4C0DC 4E7JA 3CCSQ 4OMLA 4HVWA 3JB9G 1IRXA 3GOXA 2VB6A 3JCMJ 2GQVA 1QCNA 2O9VA 4C5GA 3EFRA 1YJ9Q 4CRIA 1YI2T 3RR6A 5M9OA 3PIOA 2P4TA 3VS6A 3X28B 3OYMA 5IAYA 3EH2A 3P8DA 4JRIA 4ZGJB 3OYIA 1YITQ 1TTHB 1X6GA 3I56A 2RPNA 2DRKA 1OI1A 3MP1A 4KUDK 2OTLT 4NOYA 4PJOD 1RAIB 1X27A 3G6EQ 2EGEA 3VUBA 3X24B 1YWPA 3H0IA 2LT1A 1N5ZA 3A8OB 1KQSA 5FW9A 3I55Q 4RG8A 1D3BB 3JCMQ 1VQPA 4FYVB 1KK7A 2EYYA 3RUXA 5FRNA 1ACMB 5GAMe 2GTOA 1B07A 3S3OA 2D8HA 1Q7YU 1LJOA 4PK4A 4Z89A 3CC4Q 1XJWB 2L3RA 1NLOC 1N9RA 2J7IA 3OQ5A 1OZ3A 2RF0A 3BE3A 2DTHA 1U8RA 2D6FA 4KUIA 3VU3C 3CC2A 1T0JA 4Y92A 3QJYA 2A08A 1VQ8Q 2CUBA 2OAWA 4D6WA 1ZSZA 1IB8A 1TXQA 1H641 1IHVA 2EYWA 4AFQC 4EIKA 4IUQA 1HK9A 2K5IA 4M7AG 1LCKA 1LOJA 1TH7A 1WHHA 1UG1A 4L6V5 1WYXA 2V1RA 2LC4A 2W10A 4QT7A 1RLPC 1Q82U 3EFOB 2JM9A 4KBMB 1DJ7B 1X69A 1Q7YR 5HKCA 1QVFP 2KROA 2LX7A 3E9GA 2CZ1B 2X4YA 2GQIA 3JB9F 2D0QB 4KGZB 4LE9A 3HL8A 1WJSA 2AK5A 3S6WA 3PVLA 1Y7XA 2Z0WA 5CCAA 1KJWA 1KQ1A 2VC8A 4C0DB 2KE9A 3A8MB 4FM4B 4J9BA 2RHZA 4BY6C 2QA4Q 2BUDA 4M75B 3CCEQ 1ZBJA 3QZ9B 3JCMV 4L59A 3WXMB 1GCQC 1WXTA 1JBMA 3G6ET 3A98A 1M1FA 1WHLA 1VQPT 3BY7A 2QEXT 4DBRA 1S1NA 4B9WA 1M1KU 2P4RA 1ZUKA 4M7DF 2DLPA 1QVFA 2YT6A 2PVDB 2L2PA 2RI5A 1GFDA 2KXDA 2FZKB 1QVPA 1WNLA 1M2VA 4M77F 2NUTA 4BACA 4PFOA 1YIJT 4PLLA 2HCKA 3UA7A 1OX9A 2J6OA 2VGNA 3A8HB 1NE8A 2KYBA 1V1CA 3CCMQ 2Y4YA 2YUQA 2DPPB 3OYDA 1GRIA 2ZGWA 2D0NA 2DL3A 4XU0A 2EQUA 4C0FA 2A7YA 5LJ5d 5J26A 3CCUA 3HPWA 1K1ZA 2KYMA 4ZNXA 2DXUA 3X25B 3VS7A 1I4K1 2YLCA 1PD1A 2VYTA 2YUPA 3BW1A 3O8VA 4OMOA 4LNPA 1PSFA 5GAN7 2MF2A 5L23A 1K0SA 1X6OA 1AWWA 2ZPGB 3QPHA 4OB2B 3EGUA 3MEVA 3UDCA 1OEBA 4KULA
chains in the Genus database with same CATH topology
1Q86R 3G6EQ 1K8AR 3OW2P 1S72Q 1YHQQ 1K73R 2OTJQ 3CC2Q 1VQ8Q 1W2BP 1VQKQ 3G4SQ 1VQNQ 3CPWP 1KQSP 3CC4Q 1YJ9Q 3CMEQ 3CCLQ 3CCUQ 3CCMQ 1YIJQ 1Q7YR 1VQ5Q 3CD6Q 1VQMQ 1YJWQ 3CCRQ 1NJIR 1YI2Q 1Q82R 1QVFP 3G71Q 2QA4Q 1KD1R 3CCEQ 1JJ2P 3I55Q 1QVGP 3CC7Q 1VQLQ 3I56Q 3CCQQ 3CXCP 1VQ6Q 1M1KR 1VQ4Q 1VQPQ 1Q81R 2QEXQ 1YITQ 1K9MR 2OTLQ 1KC8R 1VQ7Q 1M90R 3CCSQ 1N8RR 1VQ9Q 1VQOQ 1YJNQ 3CMAQ 3CCVQ 3CCJQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q86 R;  3G6E Q;  1K8A R;  3OW2 P;  1S72 Q;  1YHQ Q;  1K73 R;  2OTJ Q;  3CC2 Q;  1VQ8 Q;  1W2B P;  1VQK Q;  3G4S Q;  1VQN Q;  3CPW P;  1KQS P;  3CC4 Q;  1YJ9 Q;  3CME Q;  3CCL Q;  3CCU Q;  3CCM Q;  1YIJ Q;  1Q7Y R;  1VQ5 Q;  3CD6 Q;  1VQM Q;  1YJW Q;  3CCR Q;  1NJI R;  1YI2 Q;  1Q82 R;  1QVF P;  3G71 Q;  2QA4 Q;  1KD1 R;  3CCE Q;  1JJ2 P;  3I55 Q;  1QVG P;  3CC7 Q;  1VQL Q;  3I56 Q;  3CCQ Q;  3CXC P;  1VQ6 Q;  1M1K R;  1VQ4 Q;  1VQP Q;  1Q81 R;  2QEX Q;  1YIT Q;  1K9M R;  2OTL Q;  1KC8 R;  1VQ7 Q;  1M90 R;  3CCS Q;  1N8R R;  1VQ9 Q;  1VQO Q;  1YJN Q;  3CMA Q;  3CCV Q;  3CCJ Q; 
#chains in the Genus database with same CATH topology
 4N4I A;  4E6R A;  3MEU A;  2YUO A;  4M78 B;  1S72 Q;  2DJZ A;  3VRZ A;  2QQA A;  1U1T A;  2V1Q A;  5IHK A;  2LX9 A;  1I5O B;  2QQR A;  1YHQ T;  4OB3 B;  2A37 A;  1YJN A;  3SWN B;  3N5B B;  4A4E A;  1WJQ A;  1VQ4 Q;  3RKX A;  2YXY A;  2DX1 A;  1YBY A;  4XTZ A;  2WSE E;  2XKO C;  3VKI A;  3C95 A;  2LRQ A;  2RJE A;  2XI9 A;  3NMZ C;  1SKU B;  1G3S A;  2K5L A;  3TSW A;  1QKW A;  3NGP A;  2X51 A;  1K9M U;  2DL4 A;  1M3C A;  2QA4 T;  1JU5 C;  4KT0 E;  3PFS A;  3M0R A;  1NLP C;  4E2F B;  3EG2 A;  1KG1 A;  3OY9 A;  3INZ A;  4HVU A;  1ZSZ B;  2JMC A;  2CZ7 B;  4EMG A;  2MWO A;  2ZAE A;  1VQM A;  3RBB B;  2P0K A;  2GCX A;  5GAM f;  2VXF A;  3EGD B;  7AT1 B;  2LJ0 A;  2DZC A;  4QQ6 A;  3P8H A;  4R0K A;  2HEQ A;  2DM1 A;  2DO3 A;  4EMH A;  5GJW B;  2CP2 A;  3SHW A;  3CQT A;  4RG2 A;  2OTL A;  1G3Y A;  5KCH A;  1OPK A;  3EGX A;  2L0A A;  2RNA A;  2J6F A;  2P0P A;  2VUB A;  5FU6 B;  4DQ2 A;  1MV3 A;  4DEY A;  4J6Y A;  3M0T A;  4LXC A;  5GAM h;  2A36 A;  4CC4 B;  4M78 G;  2FEI A;  4NL3 A;  4AT1 B;  1SRM A;  3RER A;  5J39 A;  5IHN A;  1G8X A;  1WPY A;  2ED1 A;  2LQK A;  3HTR A;  2QK0 A;  4BD3 A;  3CCS A;  2FHD A;  4J9H A;  5GAN 2;  4J83 A;  8AT1 B;  3MET A;  3CCQ A;  2RM4 A;  3P8B B;  3L1A A;  4LN2 A;  1VQK T;  2RQW A;  2YHT A;  2KAF A;  1VQM T;  1YFN A;  3PVQ A;  1YP5 A;  4PJO B;  3HFN A;  4MMK A;  1ZX6 A;  3TQ7 P;  1K9A A;  4AFS C;  1H3Z A;  2PNI A;  5GAN f;  3CPF A;  2K6D A;  2QI2 A;  2EKH A;  2DTO A;  2CRE A;  1JRI A;  4C92 C;  4JPB W;  1ZBX A;  4J9C A;  5AYF A;  3JCM c;  4O5V A;  3MKD A;  1VQ7 Q;  2E65 A;  4ZTF A;  3OYE A;  2FPD A;  4OMP A;  1KFZ A;  1K73 R;  3LW5 E;  4ZN3 A;  4B6M A;  3CBM A;  1OOT A;  2V8K A;  1UEB A;  3KXT A;  4E7S A;  1NJI R;  2GFU A;  3TRE A;  3X20 B;  5CK9 A;  3OYA A;  3HRT A;  5CAI A;  5GAN h;  1UJY A;  4HKE A;  3UF4 A;  2OAU A;  4J8O A;  1LPL A;  4BI4 A;  5LJ5 e;  1RAE B;  4M7D C;  3I35 A;  4HCK A;  2EBP A;  2EPD A;  4BI3 A;  2E64 A;  2KK4 A;  1VIE A;  3I5R A;  1XTD A;  1JJ2 P;  1QVG P;  2RI3 A;  1RAF B;  3PT9 A;  1TUG B;  1R77 A;  4J9F A;  1VQ4 A;  2EJF A;  1XQH A;  3S3N A;  3UAT A;  4BUG A;  1YJN Q;  3UWN A;  5IN1 A;  4C92 E;  1ZUU A;  2RQU A;  4NL2 A;  4DEX A;  1Y57 A;  1VYT A;  4X1V A;  1A0N B;  5GAO r;  2IIM A;  2OI3 A;  1X2Q A;  4A4F A;  2ECZ A;  2E6N A;  1MND A;  5CIU A;  1YJW T;  4F04 B;  4J5Y A;  2P84 A;  2Y90 A;  5AT1 B;  4KH1 B;  5GAM d;  1BBZ A;  3VS1 A;  2LCL A;  2DXC A;  5FWC A;  3ZEH A;  1NYF A;  2BKD N;  3SEM A;  1UE9 A;  1BYM A;  3EG1 A;  4CC3 A;  3FLG A;  1JXM A;  5GAN 8;  1UJ0 A;  3OS2 A;  2JUF A;  1U5S A;  2RJF A;  3RMQ A;  1ZA2 B;  3CC7 Q;  2KVQ G;  1HSQ A;  1GBR A;  4R55 A;  5GMK i;  1UDL A;  2GF7 A;  1KQS S;  4M75 D;  5LL6 S;  4J9I A;  4OGC A;  3WVE B;  2JJ9 A;  5FRM A;  5LJ5 j;  5A2Q E;  2A3L A;  1W4S A;  2H3E B;  1WQ7 A;  3CCM T;  1SHF A;  1YWO A;  1VYV A;  3LH0 A;  1OPL A;  4HT9 A;  3GIB A;  3M55 A;  3CD6 T;  5A0L A;  2DJQ A;  2LVM A;  1H8K A;  4TVR A;  3CME T;  2A0F B;  1VQL T;  1G5V A;  1U1S A;  4OMF B;  3UA6 A;  5LJ5 f;  1WQW A;  1JQQ A;  3THK A;  1GBQ A;  4F16 A;  5CKH A;  2LCS A;  3CCR T;  3IQL A;  3SWN C;  5GJV B;  1N9S A;  2NUP A;  2BIV A;  3JCM d;  2JVV A;  1WIE A;  4JUV A;  2HKN A;  1BI0 A;  3LLR A;  3H0H A;  1M3B A;  4PLI A;  2ESW A;  4M78 A;  2COY A;  1KC8 U;  3H6Z A;  5A0G A;  4F17 A;  2JMA A;  2VV5 A;  2LQN A;  1QVG S;  2VKN A;  1JEG A;  2SRC A;  4BI8 B;  1CSK A;  1O75 A;  4GLK A;  1FYN A;  1PRL C;  1ZLM A;  1D0X A;  1D0Z A;  2DEQ A;  3DKM A;  1WXU A;  4J6X A;  5D6X A;  4EMK A;  1H92 A;  2FZC B;  5GAO l;  1FWZ A;  1PSE A;  2J06 A;  2MYS A;  3M9Q A;  1RLQ C;  3JCM W;  5KYW A;  1SEM A;  1M9S A;  2M0O A;  3MP6 A;  4JRQ A;  2HZY A;  4KGV B;  3ZFJ A;  1VYU A;  3MCA B;  3LH5 A;  3SD4 A;  3FDR A;  3CXC S;  1G3W A;  2XG8 D;  3V7R A;  2CSI A;  4JJB A;  1Q82 C;  3FEO A;  1AVZ C;  1ZUY A;  1UB4 A;  1NG2 A;  1PCX A;  4Y28 E;  2LCC A;  2YDL A;  1BI1 A;  3CC7 T;  1BU1 A;  2RJC A;  3VS4 A;  2K2M A;  2K7A A;  2KNB B;  2RO0 A;  2YRV A;  2QDY B;  5LJ5 h;  1JB0 E;  1JO8 A;  1WA7 A;  4C8Q C;  4M7A D;  3M0P A;  4PJL A;  1ZSG A;  2ROL A;  4FL6 A;  1VQ6 T;  2DL8 A;  4IIM A;  4OMN A;  3KBG A;  1WXB A;  4C8Q A;  2RQR A;  4J6W A;  5KYU B;  2KR3 A;  3L2Q A;  1M27 C;  3CPW S;  1D1C A;  5CVI A;  1PHT A;  2QXF A;  3CCJ T;  1Q86 C;  4OVA A;  1IGQ A;  3REB B;  4RUG A;  3L2R A;  4CC2 A;  2O88 A;  3OYC A;  2D9T A;  2FZG B;  3VV0 A;  1M30 A;  2HBP A;  2HL3 A;  3VYG A;  4PJJ A;  1VQN Q;  2KY9 A;  1PG5 B;  1GCQ A;  4JS4 A;  3OSS C;  5LJ3 e;  3NPF A;  3OYK A;  4M7A E;  2DIG A;  1MHN A;  1JJ2 S;  2C0O A;  2VWF A;  2EYZ A;  3G71 T;  4A53 A;  4OB1 B;  5HK0 A;  2HDA A;  4CI0 C;  2DTI A;  2EWN A;  2K79 A;  1K76 A;  1W2B A;  1M3A A;  4M75 A;  3JCM f;  1OUL A;  3JB9 H;  4BE1 A;  4JLI A;  4A54 A;  1QMC A;  3ASK A;  3T9N A;  4EDU A;  1AOJ A;  1AEY A;  4M77 C;  1SG5 A;  1VA7 A;  4LDU A;  2LJ1 A;  3VS2 A;  4XU3 A;  4QVZ A;  1WZO A;  1D1B A;  3CC2 T;  3L2W A;  3HSB A;  2OX7 A;  3MP8 A;  1IGU A;  4QKU A;  1SF9 A;  1T0H A;  3JCM b;  1JJ2 A;  3OW2 A;  4FSS A;  4XQ3 A;  5CKB A;  3C12 A;  2AHJ B;  3CCL Q;  5ECA A;  1G83 A;  2IG0 A;  4C8Q F;  3PE0 A;  1WHG A;  1OU9 A;  3CCE A;  4PJO F;  5D6Y A;  1VQP Q;  3CC4 A;  1C1A A;  3M59 A;  3QUI A;  3CC7 A;  1BIA A;  1UGQ B;  3OYN A;  1QWE A;  4PNO A;  2M02 A;  2EVR A;  2CP5 A;  2AKK A;  4KRT A;  2F2X A;  3EGD A;  2YSQ A;  2COW A;  1UHF A;  1YJW Q;  2CZ0 B;  2L8D A;  4FYX B;  2ZPF B;  1R8O B;  3QO3 A;  1BI3 A;  2DMO A;  2P0Q A;  2JTF A;  2C0T A;  3QSU A;  3RNJ A;  3CBP A;  1MV0 B;  2YWW A;  3CCJ A;  3OW2 P;  2YRC A;  4BY6 B;  1HXD A;  3NHN A;  3JCM e;  2QQS A;  4RTY A;  3SB2 A;  3QDF A;  5CKF A;  1K73 C;  3CMA A;  2EQI A;  4X34 A;  3L2V A;  4M77 G;  2DA9 A;  2EGA A;  3CCQ Q;  2LNV A;  2HQH A;  1HJD A;  2DZ9 A;  2DIQ A;  2ZPI B;  3OYF A;  2F69 A;  3O5Z A;  1M90 R;  2HSP A;  2NYS A;  1KHI A;  4DBQ A;  4PJM A;  3CCS T;  2JS0 A;  3UT1 A;  1GFC A;  1VQO T;  2GNC A;  4QQD A;  1KD1 C;  2DYB A;  3QHS A;  1JXO A;  2NWM A;  4MDX A;  3AHU A;  2X4W A;  4AMC A;  2VXE A;  3CD6 Q;  4M77 D;  2DBK A;  4BE0 A;  1VQL A;  1YI2 Q;  2DE0 X;  3G71 Q;  3Q1J A;  2RHX A;  2QYZ A;  1YIJ A;  1I8F A;  2E3H A;  2OTL Q;  4P5N A;  1OYX A;  5J3B A;  4BB7 A;  5CKD A;  1C0M A;  2DBM A;  1YIT T;  4M7D D;  2DAQ A;  1YHQ Q;  1IRE B;  4PFZ A;  1ZA1 B;  5CQX A;  1ZQ1 A;  4ZTJ A;  1Q81 U;  1GXI E;  1C6V X;  2K2V A;  1E6G A;  2CYZ B;  2LNH B;  2O9S A;  1K8A U;  4C92 F;  4E7L A;  1PRM C;  3CCE T;  3OBY A;  4DOV A;  3ZBD A;  2PTK A;  4C8Q G;  4MZT A;  4C92 D;  1OU8 A;  3CPW A;  2LJ3 A;  3EG0 A;  3FJP A;  1SSF A;  2BZX A;  5GAN 4;  1EX4 A;  5LJ3 g;  1N8R R;  4C8Q D;  1RI9 A;  4M7A C;  3CMA Q;  1KQ2 A;  1VQ5 T;  2L3S A;  2ROT A;  2DFU A;  4VUB A;  1BCM A;  1TSF A;  2F5K A;  2HBW A;  2L3P A;  5KYW B;  4FYW B;  1PWT A;  1QKX A;  1TU0 B;  1Q82 R;  3EFS A;  1WLP B;  2L89 A;  2MPX C;  4JDS A;  4X9C A;  2A28 A;  4RMO A;  1OZ2 A;  3M57 A;  1FXX A;  3CXC A;  4F7U A;  1R0B G;  1UEC A;  5I2S A;  1AWX A;  2CZ6 B;  3M0S A;  3OYB A;  1YJW A;  2DEU A;  1TS9 A;  1TG0 A;  4ME7 A;  3OYJ A;  4M7A F;  3FRN A;  1TWB A;  4LD6 A;  3L2Z A;  1RAH B;  2CT4 A;  3CPW P;  1U06 A;  2QTX A;  2XDB A;  1WDX A;  1T3L A;  4LDX A;  3F70 A;  5IT9 E;  1Q95 G;  4RKU E;  1VUB A;  1KC8 R;  3QII A;  4IKF A;  3J7A F;  4II1 A;  1VQO Q;  2ENM A;  2DF6 A;  2DD5 A;  5GAO p;  2MAM A;  1XNI A;  5FU7 B;  1WX6 A;  4MZP A;  2D1X A;  3MHX A;  4Z02 A;  3QDR B;  3TVT A;  4PKC C;  5GAO q;  2ZPE B;  4OF1 A;  2NLU A;  3QJ6 A;  3CXC P;  1AT1 B;  2XK0 A;  1MGQ A;  4QQG A;  3EFO A;  3TCJ A;  3LGF A;  4FT4 A;  1FMV A;  4J9G A;  1RI0 A;  2DXT A;  3CME A;  5D6W A;  3PIP A;  4BDZ A;  2RJD A;  2QEX A;  4N0A A;  1IXD A;  1M8M A;  2JTE A;  2X3X D;  1HYO A;  3C94 A;  5KH6 A;  2KEA A;  2E5K A;  4JZ4 A;  3VS0 A;  4GY5 A;  1LNX A;  1XOV A;  2XU8 A;  1QLY A;  1N8R C;  2PQW A;  2PU9 B;  4ZN1 A;  9ATC B;  1S72 A;  2YLB A;  2KRS A;  3A1P A;  1VQ9 A;  3H9N A;  4M7A A;  5I21 A;  1MMG A;  2HSE B;  3JCM h;  3CCU Q;  2M9U A;  2KXC A;  1IZ6 A;  1R0C B;  3V8J A;  2O31 A;  2F1L A;  2LT4 A;  1N27 A;  4OMQ A;  5C0M A;  3NTK A;  1YCY A;  4GBQ A;  4NS5 A;  4FCY A;  1BCO A;  5KYY A;  3M0Q A;  3QYH B;  4HCZ A;  5LJ3 h;  4KGX B;  1Y71 A;  1B3Q A;  3G4S Q;  3JAM E;  1M2O A;  3ULR B;  2X4X A;  4XTW A;  4OGE A;  4WCI A;  3JV3 A;  4LD9 K;  1SHG A;  3CC4 T;  2GGR A;  2DER A;  2B86 A;  2COZ A;  2K9G A;  2EW3 A;  1VQ6 Q;  2I2L A;  1X43 A;  4J9D A;  1RAG B;  2QQ9 A;  4FW2 A;  4F7U B;  5C6S A;  2JZ2 A;  3MJX A;  2DXB A;  3FIF A;  1Q86 R;  1W6X A;  1K8A R;  1VQ8 T;  2KT1 A;  1M5Q 1;  1Y96 A;  3X26 B;  3VRY A;  2CP6 A;  1TUC A;  2K5F A;  3GP8 A;  3EHQ A;  4XTU A;  1HD3 A;  3CCR Q;  4JRP A;  4HXJ A;  2RA2 A;  4JJD A;  1K4U S;  1VQ4 T;  1WFW A;  1X75 C;  2KDS A;  2V8J A;  1K9M R;  1YCS B;  5GAM g;  4M7D G;  4Z88 A;  3A8G B;  4X9D A;  2I0N A;  2MMP A;  2CT3 A;  2NUT B;  1VIF A;  2KSS A;  1W2B P;  3CEY A;  1VQ6 A;  1MMN A;  3PNW C;  2DNU A;  2VGM A;  2QA4 A;  1Q7Y C;  1KD1 R;  2DVE A;  1UGS B;  1WHM A;  5FRO A;  3PGG A;  3H0F A;  2G3R A;  4C0G A;  4BDY A;  1AZE A;  3RES A;  5GAN g;  3G4S A;  3OYG A;  2XDD A;  4ATO A;  3G7Z A;  2KRN A;  1ZSZ C;  4AFZ C;  4OMM A;  2DYI A;  2D8J A;  2W0Z A;  3REA B;  1O9S A;  1PKT A;  2EAY A;  1M1K C;  4C92 G;  1KSW A;  4C5H A;  1VQ9 T;  2HQX A;  1YIT A;  3HP9 A;  4XAX B;  2MWP A;  1U3O A;  4JZ3 A;  4RCB A;  2GBQ A;  2XD0 A;  2X9H A;  5KYX B;  1WGS A;  3OYL A;  2CUD A;  4PJO E;  2JOY A;  4EMK C;  5GAN 3;  2XMF A;  3H41 A;  1TUD A;  3FB9 A;  1I1J A;  1RAA B;  3EH1 A;  1NPR A;  1NYG A;  2IPO B;  4L5G A;  3JRZ A;  2MCN A;  2RHI A;  2F2W A;  4B9X A;  5IXF A;  2AT1 B;  4M75 G;  4IIO A;  1UUE A;  1BKB A;  1OQK A;  3I56 T;  2YRD A;  2HKQ B;  5CR2 A;  2XHC A;  5GAN j;  2PUO B;  1NZ9 A;  1B7T A;  2R5A A;  1MMD A;  3C4S A;  1SRL A;  2C06 A;  2HAX A;  3OA6 A;  2MK5 A;  2LZ6 B;  2DL5 A;  3M58 A;  2L3Q A;  2IVW A;  4M77 A;  4N0A C;  3I55 A;  1K9M C;  3RIR A;  3GNG A;  5DY9 A;  3QBY A;  4IUT A;  2J6K A;  3FJ5 A;  1UFF A;  3PMT A;  3L2U A;  4QW2 A;  1VQO A;  1CKB A;  2E70 A;  2RH2 A;  3DB4 A;  4UC4 A;  1NJI C;  2DVJ A;  2XDP A;  4PJO C;  4E7Z A;  4JJC A;  2B8A A;  4RTU A;  5GMK e;  1BI2 A;  2JM8 A;  3EGX B;  4CC7 A;  1KHC A;  4ANJ A;  2FYK A;  2EQM A;  4M75 C;  2OTJ A;  3LWI A;  1SPK A;  4JRK A;  5KYY B;  1EZZ B;  3EHR A;  3DLL A;  3QXE B;  3DB3 A;  4XU2 A;  2H3J A;  2F5T X;  4HVV A;  1BIB A;  2QEX Q;  4RTW A;  5DM7 R;  5FU7 C;  4WF2 A;  2KBT A;  1VQN T;  2AZV A;  3I55 T;  2CH4 A;  2M0Y A;  2XIC A;  3RMS A;  3CC2 Q;  2LP5 A;  4Z8A A;  3RDV A;  2L5Q A;  3VS3 A;  2VAS A;  3KFV A;  2R5M A;  5KYU A;  4Y91 A;  4XK8 E;  4AFU C;  3JCM g;  3HRU A;  4DA4 A;  2RQV A;  3OS5 A;  1VOM A;  3CCL T;  4XTX A;  2DRM A;  4ELY C;  2AIR B;  4QVD A;  4ESR A;  1FMK A;  3D7S B;  3MEW A;  3URG A;  1D3B A;  4MML A;  2O01 E;  8ATC B;  2G6F X;  4OB0 B;  5KCO A;  1F1B B;  2OTJ T;  2QAS A;  4E7I A;  2WAC A;  2O2O A;  1VQ7 A;  4M78 F;  3QYG B;  1WJR A;  4E47 A;  4EMK B;  3EG3 A;  3GF5 A;  4XTV A;  1BB9 A;  2QAZ A;  3V7S A;  2JXB A;  3HRS A;  4F7U G;  5KYN A;  3G6E A;  1QVG A;  3HKS A;  5GMK h;  2KQW A;  1W70 A;  2RD1 A;  1UGP B;  3L42 A;  3LGL A;  5GAN e;  1RAD B;  2JS2 A;  4RTT A;  2FO0 A;  5KE2 A;  3G71 A;  3JCM P;  1VQL Q;  2CS7 A;  4F7U E;  1QP2 A;  4FT2 A;  3CD6 A;  2V8I A;  5IHI A;  4PJO A;  3SFM A;  1VQK A;  6AT1 B;  1IO6 A;  2E12 A;  1Z9Z A;  5DLQ E;  4MDW A;  3BDL A;  1KC8 C;  1VQK Q;  3E19 A;  3GBQ A;  4C92 A;  2X4J A;  2KMT A;  2M51 A;  1VQ7 T;  2HQE A;  2HD0 A;  3E9F A;  2FB7 A;  3OMC A;  3G1J A;  3TSZ A;  5GMK l;  1M2V B;  2MI6 A;  2OJ2 A;  1NJI U;  4LDY A;  3TEE A;  1IHW A;  3CCJ Q;  3WVD B;  1SSH A;  5KE3 A;  1ARK A;  1X01 A;  2E4H A;  2E1H A;  1VQN A;  2WSF E;  1P92 A;  4J7I A;  5CO7 A;  4D8K A;  4WTO B;  4HT8 A;  2PZ1 A;  1I81 A;  4N4H A;  2R57 A;  1YJ9 T;  1I0C A;  1Q81 R;  5D7U A;  3RKW A;  2HMA A;  2F2V A;  1K0X A;  3CCL A;  1WHJ A;  3ER0 A;  2MIO A;  3TU4 K;  2E3I A;  3R6N A;  3HFO A;  1J3T A;  4IUP A;  1CKA A;  1YIJ Q;  5LJ3 d;  3QKJ A;  3BFM A;  4RTV A;  2QGF B;  1M1K R;  1PM3 A;  2E10 A;  2EJG A;  1YJN T;  5GAO n;  2DIL A;  4ZGE B;  1PD0 A;  5HY6 A;  1M4Z A;  3H8Z A;  1QVF S;  2JW4 A;  1Y07 A;  4A4H A;  5A0D A;  1M1G A;  3CCV A;  2EQK A;  5I2M A;  2BTT A;  3A5Z B;  4F14 A;  1RAB B;  1UTI A;  4EPC A;  1KQS P;  3MEA A;  3CMA T;  2RHU A;  4M75 F;  4E7H A;  2EQJ A;  4FSX A;  1N6A A;  1AWJ A;  4D8D A;  2PVG B;  3OYY A;  1I5L A;  2CSQ A;  1UHC A;  2FRY A;  2XID A;  4J7F A;  1I07 A;  1NPP A;  2BE7 D;  1GCP A;  2RK1 A;  4IUR A;  2EKO A;  2RB6 A;  3M0U A;  2K3X A;  5I11 A;  2CP0 A;  5IXB A;  2M1H A;  3M56 A;  1B34 B;  3I9Q A;  2KGT A;  1K8A C;  1AWO A;  1S72 T;  1PC0 A;  2FL7 A;  2EFI A;  1OX8 A;  3GNF B;  2KT8 A;  3ZL7 C;  5GAM j;  5DLO A;  4K11 A;  2ED0 A;  4GLM A;  1WHK A;  2QG9 B;  3M53 A;  2EIF A;  5GAN 6;  4FU6 A;  3CCM A;  1KD1 U;  3OS1 A;  3CCV T;  4M7D A;  1UGV A;  2MOX A;  2QTV A;  1GL5 A;  2EGC A;  1E7O A;  5GAN d;  2ABL A;  4PJN A;  2KRM A;  1B34 A;  3M4Y A;  1NBE B;  3NFC A;  5GAN 5;  4F7U F;  2QDL A;  1RAC B;  5CQY A;  5GAO m;  2E41 A;  4LUD A;  3OMG A;  4XTY A;  2HL5 C;  3CCQ T;  3CCR A;  2EYQ A;  2NUP B;  1AHJ B;  1V76 A;  3GPL A;  4FW1 A;  4IUV A;  4C5I A;  1Y96 B;  1W1F A;  4QVC A;  2X35 A;  5FWB A;  5FLX E;  4R56 A;  2KI7 A;  1K73 U;  1MMA A;  1FX7 A;  4LDV A;  1QWF A;  1FMW A;  2J05 A;  1VQ5 A;  1X6B A;  4JJN K;  2DK3 A;  3BDU A;  4OP0 A;  3J81 E;  4AG2 C;  1V29 B;  2BE9 B;  1TOV A;  2JNG A;  1M8V A;  3VJP A;  1G3T A;  4M78 C;  2O4X B;  3VUZ A;  1QW1 A;  3DLM A;  3NTH A;  2M16 A;  2CP7 A;  3CCU T;  2GFA A;  1NEG A;  4N4G A;  3EG9 A;  2GTJ A;  3M5A A;  1X2K A;  3JCM X;  4C92 B;  4PJO G;  4C5E A;  2HNI A;  3SDZ A;  4HA8 A;  2EJ9 A;  4RCC A;  4FYY B;  3SWN A;  1AZG B;  3HHT B;  2RI2 A;  3JSC A;  4XU1 A;  3FC3 A;  3I5S A;  2ZCF B;  4C8Q B;  2JTM A;  2V26 A;  3I56 Q;  5EC7 A;  4O6J A;  1G2B A;  2LTO A;  3E1S A;  2QGG A;  3M54 A;  4A4G A;  2DET A;  3EG9 B;  3KUF A;  4ELZ C;  4ORZ A;  2FRW A;  4M4Z A;  2X3W D;  3VS5 A;  1D0Y A;  3OBW A;  4V2S A;  4FIB A;  4PFP A;  1M90 U;  4DBH A;  3CME Q;  1VQ5 Q;  4JS5 A;  1NEB A;  2RHY A;  4BE2 A;  3V8K A;  1W2B S;  3OW2 S;  5GMK j;  1M90 C;  2LMJ A;  2PUK B;  1ABQ A;  1QCF A;  3VYH B;  4DOW A;  2RK2 A;  3V8L A;  3OB9 A;  3CCV Q;  5EG2 A;  4DBF A;  5HK3 A;  2BZY A;  3M4G A;  3JB9 D;  2LQW A;  3ME9 A;  3EAE A;  3U23 A;  3C0C A;  1QCO A;  1LVK A;  5GMK m;  3J80 E;  4AG1 C;  2DL7 A;  2QQB A;  5I22 A;  4LUE A;  1YHQ A;  3QWY A;  4LDW A;  2CGH A;  1KIK A;  2RN8 A;  2CDT A;  4HCC A;  2FG0 A;  4ZGD B;  3AT1 B;  4A4K A;  5LJ3 j;  3LX7 A;  3QG1 A;  4C8Q E;  3CBO A;  3V7C A;  2Y4X A;  1VQ9 Q;  2FVU A;  1YI2 A;  2LQ8 A;  1RL2 A;  2E5Q A;  4M77 B;  1Q81 C;  1QP3 A;  1PNJ A;  2K3B A;  4KH0 B;  3MO8 A;  1Z9Q A;  1NM7 A;  2CP3 A;  2WSC E;  1OV3 A;  4PL6 A;  3NTI A;  2O4X A;  2YUN A;  2AKL A;  4M7D B;  1RUW A;  1UGR B;  2R58 A;  2FPF A;  4M78 D;  1VQ8 A;  2DKG A;  4HCB A;  1PKS A;  2FPE A;  3JB9 J;  2K4Y A;  3JB9 I;  2OTJ Q;  1ABO A;  2ATC B;  2AZS A;  2ZPB B;  3OYH A;  2RQT A;  1EIF A;  5LJ3 f;  2JN0 A;  2RMO A;  1D1A A;  1WI7 A;  3LWH A;  3OSV A;  1D09 B;  2K3Y A;  1AD5 A;  4Q5W A;  2PVO B;  2LDM A;  1Y0M A;  5IH2 A;  5LJ5 g;  4M75 E;  1Q86 U;  3GLX A;  3A8L B;  4M7D E;  2C0I A;  3OS0 A;  2K57 A;  2H8H A;  1YNZ A;  1BK2 A;  3LYI A;  4M7A B;  4E7K A;  4IUU A;  4M77 E;  4MZM A;  2ZZD A;  1VQM Q;  2E6Z A;  3R6O A;  2EYX A;  5L8R E;  1ZHI A;  4JLG A;  3G4S T;  5FU6 C;  1MNE A;  3PMI A;  4A63 B;  3QZ5 B;  1QQJ A;  3MPU B;  4M78 E;  2JT4 A;  5KYX A;  3S3M A;  1YN8 A;  2SEM A;  1E6H A;  3E2U A;  2ZPH B;  1EFN A;  5CKE A;  2BZ8 A;  4RTX A;  4J9E A;  2DD4 A;  1MUZ A;  4RTZ A;  4YTL A;  5HCK A;  3PTA A;  4C0Z A;  3UPU A;  2CH4 W;  3QWX X;  2CKK A;  1N8R U;  3RKY A;  2NUZ A;  2VVK A;  1T3S A;  1YJ9 A;  1H3H A;  4C0D C;  4E7J A;  3CCS Q;  4OML A;  4HVW A;  3JB9 G;  1IRX A;  3GOX A;  2VB6 A;  3JCM J;  2GQV A;  1QCN A;  2O9V A;  4C5G A;  3EFR A;  1YJ9 Q;  4CRI A;  1YI2 T;  3RR6 A;  5M9O A;  3PIO A;  2P4T A;  3VS6 A;  3X28 B;  3OYM A;  5IAY A;  3EH2 A;  3P8D A;  4JRI A;  4ZGJ B;  3OYI A;  1YIT Q;  1TTH B;  1X6G A;  3I56 A;  2RPN A;  2DRK A;  1OI1 A;  3MP1 A;  4KUD K;  2OTL T;  4NOY A;  4PJO D;  1RAI B;  1X27 A;  3G6E Q;  2EGE A;  3VUB A;  3X24 B;  1YWP A;  3H0I A;  2LT1 A;  1N5Z A;  3A8O B;  1KQS A;  5FW9 A;  3I55 Q;  4RG8 A;  1D3B B;  3JCM Q;  1VQP A;  4FYV B;  1KK7 A;  2EYY A;  3RUX A;  5FRN A;  1ACM B;  5GAM e;  2GTO A;  1B07 A;  3S3O A;  2D8H A;  1Q7Y U;  1LJO A;  4PK4 A;  4Z89 A;  3CC4 Q;  1XJW B;  2L3R A;  1NLO C;  1N9R A;  2J7I A;  3OQ5 A;  1OZ3 A;  2RF0 A;  3BE3 A;  2DTH A;  1U8R A;  2D6F A;  4KUI A;  3VU3 C;  3CC2 A;  1T0J A;  4Y92 A;  3QJY A;  2A08 A;  1VQ8 Q;  2CUB A;  2OAW A;  4D6W A;  1ZSZ A;  1IB8 A;  1TXQ A;  1H64 1;  1IHV A;  2EYW A;  4AFQ C;  4EIK A;  4IUQ A;  1HK9 A;  2K5I A;  4M7A G;  1LCK A;  1LOJ A;  1TH7 A;  1WHH A;  1UG1 A;  4L6V 5;  1WYX A;  2V1R A;  2LC4 A;  2W10 A;  4QT7 A;  1RLP C;  1Q82 U;  3EFO B;  2JM9 A;  4KBM B;  1DJ7 B;  1X69 A;  1Q7Y R;  5HKC A;  1QVF P;  2KRO A;  2LX7 A;  3E9G A;  2CZ1 B;  2X4Y A;  2GQI A;  3JB9 F;  2D0Q B;  4KGZ B;  4LE9 A;  3HL8 A;  1WJS A;  2AK5 A;  3S6W A;  3PVL A;  1Y7X A;  2Z0W A;  5CCA A;  1KJW A;  1KQ1 A;  2VC8 A;  4C0D B;  2KE9 A;  3A8M B;  4FM4 B;  4J9B A;  2RHZ A;  4BY6 C;  2QA4 Q;  2BUD A;  4M75 B;  3CCE Q;  1ZBJ A;  3QZ9 B;  3JCM V;  4L59 A;  3WXM B;  1GCQ C;  1WXT A;  1JBM A;  3G6E T;  3A98 A;  1M1F A;  1WHL A;  1VQP T;  3BY7 A;  2QEX T;  4DBR A;  1S1N A;  4B9W A;  1M1K U;  2P4R A;  1ZUK A;  4M7D F;  2DLP A;  1QVF A;  2YT6 A;  2PVD B;  2L2P A;  2RI5 A;  1GFD A;  2KXD A;  2FZK B;  1QVP A;  1WNL A;  1M2V A;  4M77 F;  2NUT A;  4BAC A;  4PFO A;  1YIJ T;  4PLL A;  2HCK A;  3UA7 A;  1OX9 A;  2J6O A;  2VGN A;  3A8H B;  1NE8 A;  2KYB A;  1V1C A;  3CCM Q;  2Y4Y A;  2YUQ A;  2DPP B;  3OYD A;  1GRI A;  2ZGW A;  2D0N A;  2DL3 A;  4XU0 A;  2EQU A;  4C0F A;  2A7Y A;  5LJ5 d;  5J26 A;  3CCU A;  3HPW A;  1K1Z A;  2KYM A;  4ZNX A;  2DXU A;  3X25 B;  3VS7 A;  1I4K 1;  2YLC A;  1PD1 A;  2VYT A;  2YUP A;  3BW1 A;  3O8V A;  4OMO A;  4LNP A;  1PSF A;  5GAN 7;  2MF2 A;  5L23 A;  1K0S A;  1X6O A;  1AWW A;  2ZPG B;  3QPH A;  4OB2 B;  3EGU A;  3MEV A;  3UDC A;  1OEB A;  4KUL A; 
#chains in the Genus database with same CATH homology
 1Q86 R;  3G6E Q;  1K8A R;  3OW2 P;  1S72 Q;  1YHQ Q;  1K73 R;  2OTJ Q;  3CC2 Q;  1VQ8 Q;  1W2B P;  1VQK Q;  3G4S Q;  1VQN Q;  3CPW P;  1KQS P;  3CC4 Q;  1YJ9 Q;  3CME Q;  3CCL Q;  3CCU Q;  3CCM Q;  1YIJ Q;  1Q7Y R;  1VQ5 Q;  3CD6 Q;  1VQM Q;  1YJW Q;  3CCR Q;  1NJI R;  1YI2 Q;  1Q82 R;  1QVF P;  3G71 Q;  2QA4 Q;  1KD1 R;  3CCE Q;  1JJ2 P;  3I55 Q;  1QVG P;  3CC7 Q;  1VQL Q;  3I56 Q;  3CCQ Q;  3CXC P;  1VQ6 Q;  1M1K R;  1VQ4 Q;  1VQP Q;  1Q81 R;  2QEX Q;  1YIT Q;  1K9M R;  2OTL Q;  1KC8 R;  1VQ7 Q;  1M90 R;  3CCS Q;  1N8R R;  1VQ9 Q;  1VQO Q;  1YJN Q;  3CMA Q;  3CCV Q;  3CCJ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...