1K8AR

Co-crystal structure of carbomycin a bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2001-10-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1k8aR00
3CCSQ 3CCLQ 1VQ8Q 1W2BP 1K8AR 3CCEQ 1K73R 3CCJQ 1VQOQ 1NJIR 1VQ4Q 3CCUQ 3CCQQ 3CXCP 3OW2P 1YJ9Q 3CC7Q 1YJWQ 1M90R 1N8RR 1KQSP 3CCRQ 1YITQ 1VQ7Q 3CMEQ 1VQMQ 1K9MR 1QVGP 1VQLQ 1YIJQ 3CCMQ 1JJ2P 3CCVQ 1YHQQ 3CD6Q 3G4SQ 3CMAQ 1Q81R 1KC8R 1VQKQ 3G71Q 1Q86R 3G6EQ 1YJNQ 1VQ9Q 1VQPQ 1KD1R 2OTLQ 3CC2Q 3CC4Q 1Q7YR 1VQNQ 1QVFP 2QA4Q 2QEXQ 1M1KR 1VQ5Q 1YI2Q 1VQ6Q 1S72Q 3CPWP 3I55Q 1Q82R 2OTJQ 3I56Q
chains in the Genus database with same CATH superfamily
1SSFA 2EGEA 5IH2A 3QUIA 2AIRB 2O9VA 3SFMA 1LCKA 1BB9A 1Y71A 4MDXA 4MMKA 1VQ8A 1M1FA 1OU8A 3CBMA 2ZCFB 1B3QA 1QCFA 3LH0A 5GANf 1BI3A 2QDLA 2EBPA 2PQWA 3VRYA 3CC2Q 5GAN4 4RKUE 3S3NA 4XTYA 2DA9A 5GAMe 2RD1A 1LNXA 1JQQA 2GQIA 2VASA 4C0ZA 1SHGA 3PMTA 4HT9A 2DVEA 2WSFE 1K9MU 1KQSP 1ZHIA 2QQBA 1TSFA 2J6FA 4PK4A 3SEMA 3VS5A 2MIOA 2E1HA 2YRCA 2PZ1A 5HCKA 3JSCA 3JB9H 3CCMT 2VB6A 3QYHB 1WHMA 5LJ3f 2JVVA 5EG2A 2L2PA 4M7DC 3EG9B 3I5SA 2QGGA 5FU6C 2O88A 3UA7A 4A4EA 2JNGA 4LE9A 3R6OA 1PKTA 5GANe 1MGQA 1OPLA 1T0JA 4TVRA 4FU6A 4D8KA 2SEMA 1UGVA 2JT4A 3UF4A 5KYUB 5CIUA 4C5GA 5LJ5d 2DBMA 1UG1A 1K8AU 2X3WD 5FU7C 3L2WA 3QDFA 1K73U 2AT1B 3CCUQ 4RTZA 1VQ8T 3TEEA 5LJ5h 2MK5A 3RDVA 9ATCB 2GGRA 2HCKA 3FLGA 2E3HA 1CSKA 2D8JA 2YUPA 5LJ3e 1X75C 2YHTA 2RA2A 4XTZA 3C4SA 2CP0A 2LRQA 2COZA 3KUFA 2G6FX 1FMVA 3A8OB 4FW1A 4QVCA 3P8DA 3M4YA 4FYXB 1U1SA 3VS0A 3CMAQ 1V1CA 4YTLA 1VQPQ 5GAN5 1W4SA 1WNLA 5DM7R 1ARKA 2QA4Q 2RQUA 2OTLT 2ZPEB 2YLCA 3M0SA 1WDXA 1ZA1B 2VWFA 1RLQC 3PVLA 2KXCA 4ESRA 2DRMA 2RHIA 3E9GA 2LQ8A 7AT1B 1JXOA 2IVWA 2ZPIB 5AYFA 1VA7A 2O2OA 3H6ZA 4C0DC 4QQ6A 2CP6A 1Q81U 3INZA 1X43A 4E7HA 1EX4A 1LOJA 1PM3A 5FU7B 1M1KC 4DBFA 4E7ZA 2CUBA 3EG0A 3JCMb 2P4RA 2OTJQ 1UEBA 2R57A 4IIMA 3JCMh 4C0GA 3ER0A 4HCKA 3JCMc 1K4US 4ZN3A 5KE3A 3HFOA 3LGFA 3CCSA 3OB9A 1T0HA 3V8JA 1D3BA 4LDVA 5KCHA 2QTVA 2RQRA 1WI7A 2K5LA 3TSWA 2F1LA 1U1TA 1HYOA 4C92D 2KGTA 4C5IA 3EFOA 5GAMd 1A0NB 3CQTA 1IHVA 1NPRA 2DFUA 4PL6A 2KAFA 3SD4A 3OYYA 1YHQA 2DAQA 1XTDA 4C5HA 1B34A 1UFFA 1Y7XA 2DO3A 5LL6S 4ATOA 1C0MA 1FWZA 4ZGJB 3CPWS 1PHTA 2DK3A 2XU8A 2KEAA 1QMCA 2HD0A 2BZYA 1NLPC 1WLPB 5KYXA 3G4SQ 2LCCA 1ZSGA 2E4HA 1PRMC 2B8AA 4AG2C 4ORZA 4LDYA 4A4FA 1K73C 2F2VA 1QVGA 2YUQA 4PJOF 2R5MA 1P92A 2FZGB 3JCMJ 3CCST 1RUWA 4BUGA 2MI6A 3BW1A 1AD5A 5GMKe 2DJQA 1H3HA 3EGDA 3FEOA 2FO0A 2KYBA 5IXBA 4DA4A 3V8LA 3M0QA 1YJNQ 4JS5A 3CMEA 1Q7YU 3HTRA 2RHYA 3EG3A 3RMSA 1PSEA 1X2KA 1HSQA 5KYYA 1YWPA 1ZQ1A 1R77A 2CT3A 1U3OA 1V29B 3PNWC 5J39A 4OGCA 1UDLA 2CH4W 3CCRQ 3AT1B 2D8HA 2DERA 2M0YA 2O4XA 2CYZB 3RKYA 1KD1U 2FZCB 4J9DA 2YSQA 3GF5A 4DOVA 4LDUA 3E19A 4J9IA 1D3BB 3TREA 2GBQA 2VYTA 3NTHA 2LX9A 3D7SB 4XTUA 2RJDA 4LD6A 3HRTA 3OS5A 1BI2A 4J7IA 3G71Q 1GCQA 3EFOB 4C8QC 3S3MA 4AFQC 1I5LA 1SEMA 4LDWA 3GIBA 3WVDB 4IIOA 1PWTA 1QVPA 2AK5A 1HXDA 3HRSA 1E6GA 3REBB 1ZUKA 4C5EA 1R0BG 1X6OA 1N6AA 2Y4XA 2CP5A 1B34B 2JZ2A 3OYDA 4Q5WA 2VKNA 2X51A 1M2VA 4Z8AA 3CCQT 4RTVA 3CEYA 2DTIA 3CMET 2DYIA 4J83A 2XDBA 2FPEA 2GFUA 1M1KR 5KYXB 2NUPA 4QT7A 3F70A 1T3SA 2K2VA 5GAOp 2DTHA 4NS5A 2BUDA 4F14A 1AWWA 2JXBA 4M77F 4NOYA 4PJLA 3OQ5A 2ZPFB 3OYMA 1TH7A 3L2UA 2QTXA 1WHGA 2E10A 2P0QA 1VQ9A 3EGDB 1BBZA 5FW9A 5KH6A 3EFRA 1VQNA 1RLPC 4RCBA 4C92A 5D6YA 3PIOA 2YUNA 1O75A 3UA6A 1G3TA 3OSSC 3CCEA 5KYYB 2HQHA 4CC3A 4UC4A 2I0NA 1ZSZC 5KE2A 3CCJA 1ZBXA 2RF0A 4F17A 2FEIA 2M02A 3BDUA 2CZ6B 5CKEA 1GRIA 2DX1A 2O4XB 1TS9A 3NHNA 4AFUC 4HCZA 5GAN8 2G3RA 3QBYA 4MDWA 2E64A 2L3RA 4XU3A 4MZTA 1JB0E 5J26A 3ULRB 4RTYA 2CZ1B 1RABB 3QKJA 1JEGA 4OMPA 3EGXA 1MUZA 1RAAB 1WHHA 2OTLQ 3L2RA 3M55A 5GAMg 4MZPA 1WA7A 1ZUUA 4FYYB 1TXQA 4XTWA 1YFNA 4M75E 4PKCC 1OZ3A 2LC4A 1K73R 4WTOB 1R0CB 1U8RA 4M75A 1NBEB 4JJCA 2KMTA 4C92G 1MMGA 2LVMA 1VQKQ 2JM9A 4N0AC 3OYNA 2QQRA 5CVIA 1VQMA 4FL6A 1G8XA 2XKOC 1VQ9T 1M2VB 2DIQA 1VQNT 3ASKA 2XIDA 3UDCA 2VXFA 1SG5A 2L0AA 1DJ7B 4A53A 1ZLMA 2NUPB 1WJSA 2E6NA 3MCAB 4LNPA 5GANj 3CCJT 5I11A 1EZZB 3G1JA 5LJ5e 2QEXQ 4M4ZA 1KHIA 4LUEA 1B07A 1Q82C 1AHJB 2LT1A 5D7UA 4M75C 4E47A 2P4TA 2HQEA 1SRLA 2DL5A 1VQ4Q 2QASA 2EQKA 4PJNA 1QKWA 4BY6C 4OMQA 2X4JA 1M2OA 1UECA 3CCMQ 3ZFJA 1YJ9T 2A28A 2YRVA 3A5ZB 4C92B 2EGCA 1YITA 1NEBA 2EIFA 2GNCA 2JJ9A 5LJ3j 3X20B 1YIJT 3CCVA 2EQMA 1I07A 2RN8A 3CPWP 1PRLC 2DPPB 2JUFA 3BDLA 3MKDA 1QW1A 3I55A 3EAEA 3VUBA 2VV5A 1N27A 4K11A 4FM4B 3OS0A 3L1AA 1FX7A 2RPNA 3M0RA 2KBTA 1NLOC 1VQMT 4GLKA 4Z89A 5GAN3 2NUTA 4F7UA 4OB1B 1VQ8Q 3HRUA 3EGXB 4WCIA 3M53A 2RH2A 3RR6A 1M90U 4KBMB 5GAMf 2RK2A 1MNDA 1YJWQ 2DILA 4M78D 3CCLA 1G3SA 4PJOD 4PFOA 1V76A 1QVGS 4CC7A 3QWYA 2KYMA 4KUIA 4M75B 2DEUA 3CC4Q 3MEWA 5I21A 4IUVA 1NE8A 1WJRA 3QZ5B 5IN1A 3CXCA 4BY6B 3KFVA 4BE1A 2LNVA 2EKOA 2X4YA 2K57A 2SRCA 3HKSA 1J3TA 3FRNA 1IZ6A 3OYBA 4RTWA 2CREA 2LDMA 2KRNA 4PLLA 1LVKA 3A8LB 1YITT 4EDUA 3DLLA 3MEAA 2EWNA 4BI3A 4E7SA 3RNJA 3RKWA 3CCVT 2YT6A 5IXFA 3QPHA 3I5RA 2EYYA 4X9DA 4F04B 5IHNA 4HVVA 1YI2A 1S72A 2RHXA 1NJIC 4F7UG 5CO7A 3M0PA 3I56T 3QJYA 3REAB 3FB9A 2FYKA 1ZX6A 4AG1C 3GOXA 2MF2A 5GMKi 2NWMA 3N5BB 4F7UF 1WFWA 3QG1A 1VQ7A 4R55A 1RAFB 5CKHA 4FW2A 3VS3A 2AKLA 3OYGA 4J9FA 2P0KA 4J9HA 3PIPA 1YWOA 2W0ZA 4E7JA 3CCLT 1BCMA 2I2LA 2V1QA 3VYGA 4Y92A 1XJWB 1T3LA 1KK7A 4A54A 5DLOA 2C0OA 2ESWA 1IO6A 1N5ZA 2LNHB 5M9OA 4RMOA 4R56A 4JLGA 5IHIA 2YXYA 3CC2A 2V1RA 2KT8A 1WYXA 2HSPA 2EFIA 2MMPA 2NUTB 4F7UB 2D9TA 2BKDN 2CSQA 4GLMA 1UE9A 3CBOA 5GMKj 5CR2A 4M77D 1Q86U 1FXXA 4EMKA 3MEVA 4F16A 3I35A 3E9FA 3OY9A 3DB3A 4M7DF 2KQWA 1Q82R 5KYNA 1YI2T 2HSEB 2PNIA 2BTTA 5FROA 4ZNXA 1TOVA 3TU4K 1OI1A 2WSEE 2DNUA 1NEGA 1VQ7T 2HDAA 2HAXA 3G7ZA 3M9QA 2DJZA 1AOJA 3BE3A 4FIBA 2EGAA 3GNGA 4N4HA 3JCMW 3T9NA 1N8RC 1Q95G 4J9BA 4EMKC 1UGPB 3GBQA 4A4KA 3TQ7P 1QVFA 5CK9A 3JCMd 2EPDA 4DOWA 2EYXA 2DF6A 2DD4A 3BY7A 4M7AD 2P84A 3CC2T 3OW2A 2E41A 2CDTA 4JJBA 2RJCA 3WVEB 4DBRA 4LN2A 3EH2A 4M78A 4PJOA 3PMIA 2FHDA 2RHZA 4RG8A 3ME9A 2HEQA 5FWCA 2ABLA 3JB9D 3QSUA 4FSXA 1RI9A 1X27A 3CMAA 2CZ0B 2LCLA 1VQPA 4PJMA 1I0CA 3OBYA 3M58A 4RCCA 2D0QB 4IURA 2QA4A 3CPFA 2QQAA 1GFCA 4JDSA 1G5VA 1D09B 4DBHA 1LPLA 1K9MC 4IUTA 5CAIA 4XK8E 4DBQA 4DEXA 4KH0B 2E5KA 3RKXA 2FVUA 3HHTB 1NZ9A 2A37A 1UHFA 2C0IA 3RBBB 3CBPA 2EAYA 3QYGB 4N4GA 2LP5A 3R6NA 4EMKB 4RG2A 2Y4YA 1SKUB 4JLIA 3P8BB 1C1AA 3PGGA 2IPOB 1D1CA 2MPXC 2XHCA 2DL7A 4AT1B 4NL3A 3CCQQ 1NJIR 2A08A 2OTJA 2PVGB 5C0MA 3LLRA 3CMEQ 5A0LA 1UHCA 2XMFA 4BDZA 2HBWA 4M78G 1KHCA 1M3BA 1YBYA 2BE7D 4PJOG 4KRTA 3LGLA 1K8AC 1WXUA 1RI0A 3GLXA 4M78F 2F5KA 4ELZC 1JJ2A 1F1BB 1UGRB 4MMLA 2YRDA 4KGVB 1IHWA 1C6VX 2K6DA 1D0ZA 1AZEA 1M3AA 2KSSA 3CMAT 4J5YA 2EYZA 1NPPA 1OU9A 5A0DA 1GCPA 2K9GA 1QWEA 3UT1A 5KCOA 1QVGP 3L2QA 2XDDA 4A4GA 1WHLA 2QQ9A 3GP8A 3DLMA 2RMOA 3H41A 4M77A 3OYCA 2R58A 1ZUYA 2LJ1A 2X4WA 3KXTA 1YHQT 2YWWA 4M78B 3G4SA 3FDRA 3ZL7C 4PJOB 3JV3A 3C12A 2M9UA 1PC0A 4CC4B 3IQLA 4FT4A 2COYA 5D6WA 2OJ2A 1U5SA 2HKNA 2OTJT 3M59A 1B7TA 1FMWA 1PSFA 2F5TX 3CXCS 5LJ5g 1Q81C 2KNBB 1BYMA 5LJ5j 4JRIA 2KY9A 2ZGWA 1WQWA 4HKEA 1IREB 2A36A 2DMOA 1R8OB 1OZ2A 1PD1A 1ACMB 1HJDA 2ZZDA 4EPCA 4E7IA 2J06A 1BK2A 2Z0WA 1N8RR 4QQGA 2ZPBB 2PU9B 4QW2A 1K1ZA 3EGUA 1D0XA 3CC7A 3CCRA 2GQVA 2GCXA 3OA6A 2IG0A 1VQNQ 2K2MA 2RI3A 1OX9A 4M77G 4M7AA 2BIVA 4XTVA 3CCJQ 1Y57A 1VQOQ 1GCQC 2J05A 2EJGA 1M27C 4O6JA 4C8QF 4PLIA 6AT1B 2ATCB 2E5QA 2CP2A 4FYVB 3DKMA 1N9SA 1VIFA 3UWNA 2LQWA 3CD6A 3GPLA 3G71A 4KUDK 3SDZA 1AWOA 2KROA 4C92E 2AZVA 1VIEA 3A8MB 1VQ5A 3JCMg 1YJ9Q 4JRQA 1YN8A 1K9MR 1BCOA 2DBKA 2DLPA 3HFNA 4ANJA 1YIJQ 1WQ7A 2JTFA 1QWFA 2MWOA 5EC7A 4BI8B 1CKAA 3RUXA 1K0SA 1VQLA 1I81A 1W2BA 2L5QA 2JS0A 4DQ2A 3RESA 1UJ0A 4OMOA 8AT1B 4M77B 4OMMA 3NMZC 1IXDA 1OX8A 2DYBA 5D6XA 2F2XA 4M7DD 2ZPGB 4M7AG 3QO3A 1VQMQ 4JS4A 1VYUA 3CC7T 2J6OA 2FRYA 3G6EQ 4M7AF 2NUZA 1RACB 2RJEA 1Q7YC 1LJOA 3QXEB 5DY9A 2E70A 2E65A 5LJ5f 5CKFA 4C92C 1K8AR 2QK0A 5GAMj 3E1SA 2VUBA 3JB9G 3S3OA 1ABOA 1OV3A 2DIGA 4V2SA 1IGUA 1G3YA 1KQ1A 3M4GA 3JB9F 1WHKA 1KD1C 1W70A 1I5OB 4QQDA 1M8VA 2JM8A 2V8JA 2ROTA 3CD6T 4HVUA 4BD3A 2L89A 3VS2A 2DETA 2FPDA 1QVFS 2K79A 2RNAA 4AFZC 1JO8A 1VQ5T 4FCYA 4E2FB 3L42A 3URGA 4WF2A 4HT8A 4M7AB 3CCET 3OW2S 1CKBA 1X6BA 2JOYA 2JMCA 5CQYA 3CCVQ 3NTKA 2COWA 1BIBA 3LH5A 2H3EB 4MZMA 3JCMX 1RAHB 1VQLT 4XU1A 5CKBA 3V7RA 2OTLA 3M0UA 3I56Q 3FJPA 1EIFA 2AKKA 1VQ6A 4FSSA 2M16A 5A0GA 3MJXA 2DKGA 2DD5A 2J6KA 4A4HA 4GY5A 2KR3A 1QP2A 1Q81R 3QDRB 2OI3A 3JCMf 1AWXA 1PG5B 3H9NA 4II1A 1E7OA 2FPFA 1VQKA 3EHRA 5I22A 2CSIA 3PE0A 4HCCA 4ZGEB 2EQIA 5ECAA 3DB4A 2ED0A 3CCLQ 1BU1A 2YUOA 2D6FA 1G83A 2L8DA 4HVWA 3PTAA 1SF9A 4BE0A 1K76A 3JB9J 1VYVA 2PUOB 4F7UE 1M4ZA 2LCSA 3NFCA 2XI9A 1BIAA 1NG2A 2CKKA 1BI0A 2W10A 2QEXA 1M9SA 2MOXA 3QZ9B 4VUBA 2KRMA 2B86A 3QIIA 2ROLA 3JCMe 1VQ4A 1MHNA 1JJ2S 3H8ZA 2LJ3A 2DZ9A 3FIFA 2VGNA 3RMQA 1NM7A 2KI7A 2JTMA 3VS7A 1UB4A 5A2QE 4FYWB 1QP3A 1TU0B 2FB7A 2X9HA 4KT0E 2DL8A 2IIMA 2K3BA 2PTKA 3RIRA 4CC2A 1N9RA 1Y96A 1VQ6T 1HD3A 1VQ7Q 2KT1A 1WGSA 3O5ZA 4LUDA 4JJNK 1KC8U 1MMDA 2WACA 3QHSA 4LDXA 1KQ2A 2DE0X 4J6YA 1RADB 2DXCA 1QKXA 4M7DE 1KQSA 2EYQA 1M3CA 1O9SA 1G3WA 4RTUA 2MAMA 4PFPA 2RHUA 3I55T 2A3LA 3CXCP 4M7DA 4PJJA 2QQSA 2F69A 3OMGA 2QAZA 3VJPA 4AMCA 1WXTA 2VC8A 1HK9A 1GL5A 1NYGA 3NPFA 1YJWA 2KXDA 4XTXA 5HK0A 1WJQA 3FC3A 1WIEA 1Q7YR 3MP1A 2MYSA 1UGQB 2KK4A 3M56A 2QEXT 3CC4A 1TUDA 1GXIE 2OX7A 3JCMQ 3H0HA 2M0OA 2F2WA 3MP8A 5J3BA 2XDPA 4OP0A 1VQ4T 2C0TA 2RM4A 5GAN6 1UTIA 2ZAEA 3LWIA 1XOVA 3X25B 1KD1R 2CT4A 1SHFA 2EVRA 5HKCA 1FMKA 3A1PA 1Y0MA 4OMLA 2RQWA 1BI1A 1D0YA 1SSHA 3S6WA 1MMAA 2HQXA 3SWNA 5GAOr 3V7CA 5L8RE 1XQHA 1PCXA 1YNZA 4M7DG 1KIKA 4C8QD 3KBGA 4KGXB 3L2ZA 2JW4A 4DEYA 2J7IA 2MCNA 2AZSA 2K7AA 1X2QA 4A63B 4PNOA 1Z9ZA 1S72T 4X9CA 1RAGB 2HL5C 5GJVB 3WXMB 3VS4A 2DZCA 1Y07A 2LQNA 4KH1B 1Y96B 2DM1A 1YJWT 2DTOA 1RL2A 2Y90A 1QCNA 1AEYA 3JCMP 1I1JA 3JRZA 1YP5A 1RAIB 4OVAA 2M1HA 2QDYB 2XG8D 5L23A 3SWNC 3CC4T 3LX7A 2JS2A 3CCSQ 4XU0A 3X28B 1W2BS 1M90C 2BE9B 3LW5E 1UGSB 4B9XA 1XNIA 4QKUA 5DLQE 3O8VA 3CCUA 4BI4A 1TG0A 4D6WA 4M7DB 1FYNA 4XU2A 4Y28E 3OS1A 4ZTJA 5FU6B 3OS2A 5GAOl 2DXBA 4JJDA 1IGQA 3THKA 4M78E 3A8HB 2GTJA 2X4XA 4PJOE 2FZKB 2K3XA 1MV0B 3H0FA 1YCYA 1YHQQ 2OAWA 1KC8C 2CUDA 2AHJB 4X1VA 1SPKA 4JZ4A 2O01E 1ZBJA 1QVFP 3TCJA 2CGHA 2EKHA 2QG9B 3SHWA 5CCAA 1OQKA 2H3JA 4KGZB 4OGEA 1M1GA 3OW2P 1NYFA 1MV3A 1EFNA 1PD0A 3SWNB 4GBQA 4BE2A 4XAXB 1AWJA 4R0KA 2JTEA 4HA8A 1AZGB 1MMNA 4M78C 4J6WA 4PJOC 5C6SA 2ECZA 1ZA2B 2EJFA 3CCUT 3J80E 4J9EA 4JZ3A 2ZPHB 2DXUA 5GAMh 3AHUA 1OPKA 3GNFB 2X3XD 2BZ8A 4C0DB 4N4IA 4CRIA 3ZEHA 3L2VA 1K9AA 1RAEB 1UUEA 2K4YA 3M54A 2CH4A 1Q86C 1WX6A 2K5IA 3J81E 2VXEA 5GANd 2FG0A 3OBWA 4J9GA 2RO0A 5I2MA 2RQVA 2JN0A 3A98A 1X6GA 1H92A 1ABQA 1VQPT 1VYTA 3J7AF 3VU3C 2QA4T 4PFZA 4OB0B 4E6RA 1H641 1OYXA 5GANh 3HP9A 4M75D 1IB8A 4OB2B 2HNIA 4M77E 4CI0C 3VRZA 2LX7A 5IHKA 4E7LA 1JJ2P 3CCQA 4C8QE 2V26A 5CQXA 2PUKB 5HY6A 5GAOm 2PVDB 4XQ3A 2L3SA 4C8QA 1W1FA 2A7YA 2YDLA 5LJ3d 2D0NA 2RB6A 2DEQA 3X26B 4BB7A 1OEBA 3META 4RTTA 3CC7Q 2D1XA 4O5VA 3OYLA 3MHXA 2LZ6B 2HZYA 5FRNA 5LJ3h 3VYHB 2OAUA 4B6MA 3P8HA 4E7KA 1S1NA 4HXJA 5GJWB 3EG1A 1SRMA 3HPWA 3NGPA 4X34A 5GMKl 2YLBA 3U23A 2EQJA 2EQUA 2LQKA 1YJNA 2CP7A 1MNEA 5GAN7 2XD0A 4ME7A 4L6V5 1M90R 2LTOA 3EHQA 4M77C 2RI2A 3RERA 2HBPA 2A0FB 1KQSS 3CD6Q 4BDYA 3OYHA 1BKBA 1VQ9Q 2CZ7B 4L59A 4M7AE 3NTIA 3PVQA 5FRMA 1VQ5Q 4RUGA 1WHJA 1GBQA 1Q82U 4Z88A 2KVQG 2L3QA 2C06A 3CCEQ 4C8QG 2KDSA 3MP6A 5GAOn 3M0TA 1UJYA 1VQLQ 1G2BA 3H0IA 3C95A 1KC8R 3X24B 1ZSZA 3G4ST 4OB3B 3OSVA 2E6ZA 2LT4A 1WXBA 2RJFA 2EJ9A 2H8HA 1JXMA 1AT1B 2K3YA 2MWPA 2LMJA 2WSCE 3PFSA 2PVOB 2RI5A 3A8GB 4BACA 4M7AC 3HSBA 2E12A 1YJNT 4EIKA 3EH1A 1KG1A 4FT2A 4P5NA 4LXCA 3MPUB 3OYKA 1M8MA 4J8OA 3BFMA 4C8QB 3JAME 3EG2A 1KSWA 3M57A 4EMHA 1VQOA 5KYWA 2RQTA 1TUGB 3CCRT 2CS7A 2HL3A 3I9QA 1QCOA 5IT9E 1E6HA 4IUPA 4N0AA 2QXFA 2R5AA 3QJ6A 1X01A 4JRPA 2FL7A 2JMAA 4AFSC 1Z9QA 2K5FA 1W2BP 3SB2A 8ATCB 2DL4A 4J9CA 1KFZA 2E3IA 5CKDA 2XK0A 2QI2A 3UPUA 1W6XA 1YJ9A 4D8DA 4KULA 5GMKm 1Q86R 2BZXA 4L5GA 1I4K1 1YIJA 1VQ6Q 1JU5C 1AVZC 3G71T 3OYJA 1VUBA 2P0PA 3PT9A 3UATA 2ED1A 4JRKA 1H3ZA 1NJIU 1PNJA 5GMKh 5IAYA 1IRXA 1I8FA 2XICA 4ZN1A 3Q1JA 4JPBW 1YITQ 4ZGDB 2DL3A 4OF1A 4J6XA 1K0XA 2KE9A 1VOMA 2LJ0A 5AT1B 1M30A 2O31A 2V8KA 3V7SA 4C92F 5FLXE 2KRSA 3G6EA 4OMNA 4Y91A 3I55Q 2VVKA 3HL8A 5HK3A 4LD9K 1ZSZB 1M5Q1 2NYSA 4C0FA 1JRIA 1H8KA 5GANg 2GFAA 3QWXX 1OULA 2HMAA 3OYFA 4ZTFA 3MO8A 3VS1A 2GF7A 1VQOT 3C0CA 4OMFB 2O9SA 3OYEA 2DXTA 3CPWA 4IKFA 4RTXA 2HKQB 4ELYC 3M5AA 1TWBA 3LWHA 2RK1A 4B9WA 3VS6A 3OYIA 3ZBDA 4QVDA 2QGFB 1YCSB 3C94A 1JBMA 1QQJA 3MEUA 2DRKA 4EMGA 5LJ3g 4M75G 2EW3A 3VV0A 5I2SA 2FRWA 3EG9A 4QVZA 3V8KA 1D1BA 5KYWB 2NLUA 4M75F 2EYWA 1GFDA 4HCBA 5FWBA 2ENMA 3I56A 2DVJA 4J7FA 4NL2A 3JCMV 3VKIA 1GBRA 2M51A 5KYUA 2VGMA 1OOTA 3JB9I 1X69A 1WZOA 3FJ5A 1KJWA 2CP3A 3CCMA 5GAOq 3G6ET 1YI2Q 1S72Q 3E2UA 1WPYA 2GTOA 4JUVA 3LYIA 1D1AA 3OYAA 1TTHB 3TVTA 1N8RU 1U06A 2QYZA 3TSZA 2X35A 4IUQA 2V8IA 2L3PA 4Z02A 1QLYA 1TUCA 3VUZA 5GAN2 1PKSA 1M1KU 1VQKT 4IUUA 3EFSA 3OMCA
chains in the Genus database with same CATH topology
3CCSQ 3CCLQ 1VQ8Q 1W2BP 1K8AR 3CCEQ 1K73R 3CCJQ 1VQOQ 1NJIR 1VQ4Q 3CCUQ 3CCQQ 3CXCP 3OW2P 1YJ9Q 3CC7Q 1YJWQ 1M90R 1N8RR 1KQSP 3CCRQ 1YITQ 1VQ7Q 3CMEQ 1VQMQ 1K9MR 1QVGP 1VQLQ 1YIJQ 3CCMQ 1JJ2P 3CCVQ 1YHQQ 3CD6Q 3G4SQ 3CMAQ 1Q81R 1KC8R 1VQKQ 3G71Q 1Q86R 3G6EQ 1YJNQ 1VQ9Q 1VQPQ 1KD1R 2OTLQ 3CC2Q 3CC4Q 1Q7YR 1VQNQ 1QVFP 2QA4Q 2QEXQ 1M1KR 1VQ5Q 1YI2Q 1VQ6Q 1S72Q 3CPWP 3I55Q 1Q82R 2OTJQ 3I56Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS Q;  3CCL Q;  1VQ8 Q;  1W2B P;  1K8A R;  3CCE Q;  1K73 R;  3CCJ Q;  1VQO Q;  1NJI R;  1VQ4 Q;  3CCU Q;  3CCQ Q;  3CXC P;  3OW2 P;  1YJ9 Q;  3CC7 Q;  1YJW Q;  1M90 R;  1N8R R;  1KQS P;  3CCR Q;  1YIT Q;  1VQ7 Q;  3CME Q;  1VQM Q;  1K9M R;  1QVG P;  1VQL Q;  1YIJ Q;  3CCM Q;  1JJ2 P;  3CCV Q;  1YHQ Q;  3CD6 Q;  3G4S Q;  3CMA Q;  1Q81 R;  1KC8 R;  1VQK Q;  3G71 Q;  1Q86 R;  3G6E Q;  1YJN Q;  1VQ9 Q;  1VQP Q;  1KD1 R;  2OTL Q;  3CC2 Q;  3CC4 Q;  1Q7Y R;  1VQN Q;  1QVF P;  2QA4 Q;  2QEX Q;  1M1K R;  1VQ5 Q;  1YI2 Q;  1VQ6 Q;  1S72 Q;  3CPW P;  3I55 Q;  1Q82 R;  2OTJ Q;  3I56 Q; 
#chains in the Genus database with same CATH topology
 1SSF A;  2EGE A;  5IH2 A;  3QUI A;  2AIR B;  2O9V A;  3SFM A;  1LCK A;  1BB9 A;  1Y71 A;  4MDX A;  4MMK A;  1VQ8 A;  1M1F A;  1OU8 A;  3CBM A;  2ZCF B;  1B3Q A;  1QCF A;  3LH0 A;  5GAN f;  1BI3 A;  2QDL A;  2EBP A;  2PQW A;  3VRY A;  3CC2 Q;  5GAN 4;  4RKU E;  3S3N A;  4XTY A;  2DA9 A;  5GAM e;  2RD1 A;  1LNX A;  1JQQ A;  2GQI A;  2VAS A;  4C0Z A;  1SHG A;  3PMT A;  4HT9 A;  2DVE A;  2WSF E;  1K9M U;  1KQS P;  1ZHI A;  2QQB A;  1TSF A;  2J6F A;  4PK4 A;  3SEM A;  3VS5 A;  2MIO A;  2E1H A;  2YRC A;  2PZ1 A;  5HCK A;  3JSC A;  3JB9 H;  3CCM T;  2VB6 A;  3QYH B;  1WHM A;  5LJ3 f;  2JVV A;  5EG2 A;  2L2P A;  4M7D C;  3EG9 B;  3I5S A;  2QGG A;  5FU6 C;  2O88 A;  3UA7 A;  4A4E A;  2JNG A;  4LE9 A;  3R6O A;  1PKT A;  5GAN e;  1MGQ A;  1OPL A;  1T0J A;  4TVR A;  4FU6 A;  4D8K A;  2SEM A;  1UGV A;  2JT4 A;  3UF4 A;  5KYU B;  5CIU A;  4C5G A;  5LJ5 d;  2DBM A;  1UG1 A;  1K8A U;  2X3W D;  5FU7 C;  3L2W A;  3QDF A;  1K73 U;  2AT1 B;  3CCU Q;  4RTZ A;  1VQ8 T;  3TEE A;  5LJ5 h;  2MK5 A;  3RDV A;  9ATC B;  2GGR A;  2HCK A;  3FLG A;  2E3H A;  1CSK A;  2D8J A;  2YUP A;  5LJ3 e;  1X75 C;  2YHT A;  2RA2 A;  4XTZ A;  3C4S A;  2CP0 A;  2LRQ A;  2COZ A;  3KUF A;  2G6F X;  1FMV A;  3A8O B;  4FW1 A;  4QVC A;  3P8D A;  3M4Y A;  4FYX B;  1U1S A;  3VS0 A;  3CMA Q;  1V1C A;  4YTL A;  1VQP Q;  5GAN 5;  1W4S A;  1WNL A;  5DM7 R;  1ARK A;  2QA4 Q;  2RQU A;  2OTL T;  2ZPE B;  2YLC A;  3M0S A;  1WDX A;  1ZA1 B;  2VWF A;  1RLQ C;  3PVL A;  2KXC A;  4ESR A;  2DRM A;  2RHI A;  3E9G A;  2LQ8 A;  7AT1 B;  1JXO A;  2IVW A;  2ZPI B;  5AYF A;  1VA7 A;  2O2O A;  3H6Z A;  4C0D C;  4QQ6 A;  2CP6 A;  1Q81 U;  3INZ A;  1X43 A;  4E7H A;  1EX4 A;  1LOJ A;  1PM3 A;  5FU7 B;  1M1K C;  4DBF A;  4E7Z A;  2CUB A;  3EG0 A;  3JCM b;  2P4R A;  2OTJ Q;  1UEB A;  2R57 A;  4IIM A;  3JCM h;  4C0G A;  3ER0 A;  4HCK A;  3JCM c;  1K4U S;  4ZN3 A;  5KE3 A;  3HFO A;  3LGF A;  3CCS A;  3OB9 A;  1T0H A;  3V8J A;  1D3B A;  4LDV A;  5KCH A;  2QTV A;  2RQR A;  1WI7 A;  2K5L A;  3TSW A;  2F1L A;  1U1T A;  1HYO A;  4C92 D;  2KGT A;  4C5I A;  3EFO A;  5GAM d;  1A0N B;  3CQT A;  1IHV A;  1NPR A;  2DFU A;  4PL6 A;  2KAF A;  3SD4 A;  3OYY A;  1YHQ A;  2DAQ A;  1XTD A;  4C5H A;  1B34 A;  1UFF A;  1Y7X A;  2DO3 A;  5LL6 S;  4ATO A;  1C0M A;  1FWZ A;  4ZGJ B;  3CPW S;  1PHT A;  2DK3 A;  2XU8 A;  2KEA A;  1QMC A;  2HD0 A;  2BZY A;  1NLP C;  1WLP B;  5KYX A;  3G4S Q;  2LCC A;  1ZSG A;  2E4H A;  1PRM C;  2B8A A;  4AG2 C;  4ORZ A;  4LDY A;  4A4F A;  1K73 C;  2F2V A;  1QVG A;  2YUQ A;  4PJO F;  2R5M A;  1P92 A;  2FZG B;  3JCM J;  3CCS T;  1RUW A;  4BUG A;  2MI6 A;  3BW1 A;  1AD5 A;  5GMK e;  2DJQ A;  1H3H A;  3EGD A;  3FEO A;  2FO0 A;  2KYB A;  5IXB A;  4DA4 A;  3V8L A;  3M0Q A;  1YJN Q;  4JS5 A;  3CME A;  1Q7Y U;  3HTR A;  2RHY A;  3EG3 A;  3RMS A;  1PSE A;  1X2K A;  1HSQ A;  5KYY A;  1YWP A;  1ZQ1 A;  1R77 A;  2CT3 A;  1U3O A;  1V29 B;  3PNW C;  5J39 A;  4OGC A;  1UDL A;  2CH4 W;  3CCR Q;  3AT1 B;  2D8H A;  2DER A;  2M0Y A;  2O4X A;  2CYZ B;  3RKY A;  1KD1 U;  2FZC B;  4J9D A;  2YSQ A;  3GF5 A;  4DOV A;  4LDU A;  3E19 A;  4J9I A;  1D3B B;  3TRE A;  2GBQ A;  2VYT A;  3NTH A;  2LX9 A;  3D7S B;  4XTU A;  2RJD A;  4LD6 A;  3HRT A;  3OS5 A;  1BI2 A;  4J7I A;  3G71 Q;  1GCQ A;  3EFO B;  4C8Q C;  3S3M A;  4AFQ C;  1I5L A;  1SEM A;  4LDW A;  3GIB A;  3WVD B;  4IIO A;  1PWT A;  1QVP A;  2AK5 A;  1HXD A;  3HRS A;  1E6G A;  3REB B;  1ZUK A;  4C5E A;  1R0B G;  1X6O A;  1N6A A;  2Y4X A;  2CP5 A;  1B34 B;  2JZ2 A;  3OYD A;  4Q5W A;  2VKN A;  2X51 A;  1M2V A;  4Z8A A;  3CCQ T;  4RTV A;  3CEY A;  2DTI A;  3CME T;  2DYI A;  4J83 A;  2XDB A;  2FPE A;  2GFU A;  1M1K R;  5KYX B;  2NUP A;  4QT7 A;  3F70 A;  1T3S A;  2K2V A;  5GAO p;  2DTH A;  4NS5 A;  2BUD A;  4F14 A;  1AWW A;  2JXB A;  4M77 F;  4NOY A;  4PJL A;  3OQ5 A;  2ZPF B;  3OYM A;  1TH7 A;  3L2U A;  2QTX A;  1WHG A;  2E10 A;  2P0Q A;  1VQ9 A;  3EGD B;  1BBZ A;  5FW9 A;  5KH6 A;  3EFR A;  1VQN A;  1RLP C;  4RCB A;  4C92 A;  5D6Y A;  3PIO A;  2YUN A;  1O75 A;  3UA6 A;  1G3T A;  3OSS C;  3CCE A;  5KYY B;  2HQH A;  4CC3 A;  4UC4 A;  2I0N A;  1ZSZ C;  5KE2 A;  3CCJ A;  1ZBX A;  2RF0 A;  4F17 A;  2FEI A;  2M02 A;  3BDU A;  2CZ6 B;  5CKE A;  1GRI A;  2DX1 A;  2O4X B;  1TS9 A;  3NHN A;  4AFU C;  4HCZ A;  5GAN 8;  2G3R A;  3QBY A;  4MDW A;  2E64 A;  2L3R A;  4XU3 A;  4MZT A;  1JB0 E;  5J26 A;  3ULR B;  4RTY A;  2CZ1 B;  1RAB B;  3QKJ A;  1JEG A;  4OMP A;  3EGX A;  1MUZ A;  1RAA B;  1WHH A;  2OTL Q;  3L2R A;  3M55 A;  5GAM g;  4MZP A;  1WA7 A;  1ZUU A;  4FYY B;  1TXQ A;  4XTW A;  1YFN A;  4M75 E;  4PKC C;  1OZ3 A;  2LC4 A;  1K73 R;  4WTO B;  1R0C B;  1U8R A;  4M75 A;  1NBE B;  4JJC A;  2KMT A;  4C92 G;  1MMG A;  2LVM A;  1VQK Q;  2JM9 A;  4N0A C;  3OYN A;  2QQR A;  5CVI A;  1VQM A;  4FL6 A;  1G8X A;  2XKO C;  1VQ9 T;  1M2V B;  2DIQ A;  1VQN T;  3ASK A;  2XID A;  3UDC A;  2VXF A;  1SG5 A;  2L0A A;  1DJ7 B;  4A53 A;  1ZLM A;  2NUP B;  1WJS A;  2E6N A;  3MCA B;  4LNP A;  5GAN j;  3CCJ T;  5I11 A;  1EZZ B;  3G1J A;  5LJ5 e;  2QEX Q;  4M4Z A;  1KHI A;  4LUE A;  1B07 A;  1Q82 C;  1AHJ B;  2LT1 A;  5D7U A;  4M75 C;  4E47 A;  2P4T A;  2HQE A;  1SRL A;  2DL5 A;  1VQ4 Q;  2QAS A;  2EQK A;  4PJN A;  1QKW A;  4BY6 C;  4OMQ A;  2X4J A;  1M2O A;  1UEC A;  3CCM Q;  3ZFJ A;  1YJ9 T;  2A28 A;  2YRV A;  3A5Z B;  4C92 B;  2EGC A;  1YIT A;  1NEB A;  2EIF A;  2GNC A;  2JJ9 A;  5LJ3 j;  3X20 B;  1YIJ T;  3CCV A;  2EQM A;  1I07 A;  2RN8 A;  3CPW P;  1PRL C;  2DPP B;  2JUF A;  3BDL A;  3MKD A;  1QW1 A;  3I55 A;  3EAE A;  3VUB A;  2VV5 A;  1N27 A;  4K11 A;  4FM4 B;  3OS0 A;  3L1A A;  1FX7 A;  2RPN A;  3M0R A;  2KBT A;  1NLO C;  1VQM T;  4GLK A;  4Z89 A;  5GAN 3;  2NUT A;  4F7U A;  4OB1 B;  1VQ8 Q;  3HRU A;  3EGX B;  4WCI A;  3M53 A;  2RH2 A;  3RR6 A;  1M90 U;  4KBM B;  5GAM f;  2RK2 A;  1MND A;  1YJW Q;  2DIL A;  4M78 D;  3CCL A;  1G3S A;  4PJO D;  4PFO A;  1V76 A;  1QVG S;  4CC7 A;  3QWY A;  2KYM A;  4KUI A;  4M75 B;  2DEU A;  3CC4 Q;  3MEW A;  5I21 A;  4IUV A;  1NE8 A;  1WJR A;  3QZ5 B;  5IN1 A;  3CXC A;  4BY6 B;  3KFV A;  4BE1 A;  2LNV A;  2EKO A;  2X4Y A;  2K57 A;  2SRC A;  3HKS A;  1J3T A;  3FRN A;  1IZ6 A;  3OYB A;  4RTW A;  2CRE A;  2LDM A;  2KRN A;  4PLL A;  1LVK A;  3A8L B;  1YIT T;  4EDU A;  3DLL A;  3MEA A;  2EWN A;  4BI3 A;  4E7S A;  3RNJ A;  3RKW A;  3CCV T;  2YT6 A;  5IXF A;  3QPH A;  3I5R A;  2EYY A;  4X9D A;  4F04 B;  5IHN A;  4HVV A;  1YI2 A;  1S72 A;  2RHX A;  1NJI C;  4F7U G;  5CO7 A;  3M0P A;  3I56 T;  3QJY A;  3REA B;  3FB9 A;  2FYK A;  1ZX6 A;  4AG1 C;  3GOX A;  2MF2 A;  5GMK i;  2NWM A;  3N5B B;  4F7U F;  1WFW A;  3QG1 A;  1VQ7 A;  4R55 A;  1RAF B;  5CKH A;  4FW2 A;  3VS3 A;  2AKL A;  3OYG A;  4J9F A;  2P0K A;  4J9H A;  3PIP A;  1YWO A;  2W0Z A;  4E7J A;  3CCL T;  1BCM A;  2I2L A;  2V1Q A;  3VYG A;  4Y92 A;  1XJW B;  1T3L A;  1KK7 A;  4A54 A;  5DLO A;  2C0O A;  2ESW A;  1IO6 A;  1N5Z A;  2LNH B;  5M9O A;  4RMO A;  4R56 A;  4JLG A;  5IHI A;  2YXY A;  3CC2 A;  2V1R A;  2KT8 A;  1WYX A;  2HSP A;  2EFI A;  2MMP A;  2NUT B;  4F7U B;  2D9T A;  2BKD N;  2CSQ A;  4GLM A;  1UE9 A;  3CBO A;  5GMK j;  5CR2 A;  4M77 D;  1Q86 U;  1FXX A;  4EMK A;  3MEV A;  4F16 A;  3I35 A;  3E9F A;  3OY9 A;  3DB3 A;  4M7D F;  2KQW A;  1Q82 R;  5KYN A;  1YI2 T;  2HSE B;  2PNI A;  2BTT A;  5FRO A;  4ZNX A;  1TOV A;  3TU4 K;  1OI1 A;  2WSE E;  2DNU A;  1NEG A;  1VQ7 T;  2HDA A;  2HAX A;  3G7Z A;  3M9Q A;  2DJZ A;  1AOJ A;  3BE3 A;  4FIB A;  2EGA A;  3GNG A;  4N4H A;  3JCM W;  3T9N A;  1N8R C;  1Q95 G;  4J9B A;  4EMK C;  1UGP B;  3GBQ A;  4A4K A;  3TQ7 P;  1QVF A;  5CK9 A;  3JCM d;  2EPD A;  4DOW A;  2EYX A;  2DF6 A;  2DD4 A;  3BY7 A;  4M7A D;  2P84 A;  3CC2 T;  3OW2 A;  2E41 A;  2CDT A;  4JJB A;  2RJC A;  3WVE B;  4DBR A;  4LN2 A;  3EH2 A;  4M78 A;  4PJO A;  3PMI A;  2FHD A;  2RHZ A;  4RG8 A;  3ME9 A;  2HEQ A;  5FWC A;  2ABL A;  3JB9 D;  3QSU A;  4FSX A;  1RI9 A;  1X27 A;  3CMA A;  2CZ0 B;  2LCL A;  1VQP A;  4PJM A;  1I0C A;  3OBY A;  3M58 A;  4RCC A;  2D0Q B;  4IUR A;  2QA4 A;  3CPF A;  2QQA A;  1GFC A;  4JDS A;  1G5V A;  1D09 B;  4DBH A;  1LPL A;  1K9M C;  4IUT A;  5CAI A;  4XK8 E;  4DBQ A;  4DEX A;  4KH0 B;  2E5K A;  3RKX A;  2FVU A;  3HHT B;  1NZ9 A;  2A37 A;  1UHF A;  2C0I A;  3RBB B;  3CBP A;  2EAY A;  3QYG B;  4N4G A;  2LP5 A;  3R6N A;  4EMK B;  4RG2 A;  2Y4Y A;  1SKU B;  4JLI A;  3P8B B;  1C1A A;  3PGG A;  2IPO B;  1D1C A;  2MPX C;  2XHC A;  2DL7 A;  4AT1 B;  4NL3 A;  3CCQ Q;  1NJI R;  2A08 A;  2OTJ A;  2PVG B;  5C0M A;  3LLR A;  3CME Q;  5A0L A;  1UHC A;  2XMF A;  4BDZ A;  2HBW A;  4M78 G;  1KHC A;  1M3B A;  1YBY A;  2BE7 D;  4PJO G;  4KRT A;  3LGL A;  1K8A C;  1WXU A;  1RI0 A;  3GLX A;  4M78 F;  2F5K A;  4ELZ C;  1JJ2 A;  1F1B B;  1UGR B;  4MML A;  2YRD A;  4KGV B;  1IHW A;  1C6V X;  2K6D A;  1D0Z A;  1AZE A;  1M3A A;  2KSS A;  3CMA T;  4J5Y A;  2EYZ A;  1NPP A;  1OU9 A;  5A0D A;  1GCP A;  2K9G A;  1QWE A;  3UT1 A;  5KCO A;  1QVG P;  3L2Q A;  2XDD A;  4A4G A;  1WHL A;  2QQ9 A;  3GP8 A;  3DLM A;  2RMO A;  3H41 A;  4M77 A;  3OYC A;  2R58 A;  1ZUY A;  2LJ1 A;  2X4W A;  3KXT A;  1YHQ T;  2YWW A;  4M78 B;  3G4S A;  3FDR A;  3ZL7 C;  4PJO B;  3JV3 A;  3C12 A;  2M9U A;  1PC0 A;  4CC4 B;  3IQL A;  4FT4 A;  2COY A;  5D6W A;  2OJ2 A;  1U5S A;  2HKN A;  2OTJ T;  3M59 A;  1B7T A;  1FMW A;  1PSF A;  2F5T X;  3CXC S;  5LJ5 g;  1Q81 C;  2KNB B;  1BYM A;  5LJ5 j;  4JRI A;  2KY9 A;  2ZGW A;  1WQW A;  4HKE A;  1IRE B;  2A36 A;  2DMO A;  1R8O B;  1OZ2 A;  1PD1 A;  1ACM B;  1HJD A;  2ZZD A;  4EPC A;  4E7I A;  2J06 A;  1BK2 A;  2Z0W A;  1N8R R;  4QQG A;  2ZPB B;  2PU9 B;  4QW2 A;  1K1Z A;  3EGU A;  1D0X A;  3CC7 A;  3CCR A;  2GQV A;  2GCX A;  3OA6 A;  2IG0 A;  1VQN Q;  2K2M A;  2RI3 A;  1OX9 A;  4M77 G;  4M7A A;  2BIV A;  4XTV A;  3CCJ Q;  1Y57 A;  1VQO Q;  1GCQ C;  2J05 A;  2EJG A;  1M27 C;  4O6J A;  4C8Q F;  4PLI A;  6AT1 B;  2ATC B;  2E5Q A;  2CP2 A;  4FYV B;  3DKM A;  1N9S A;  1VIF A;  3UWN A;  2LQW A;  3CD6 A;  3GPL A;  3G71 A;  4KUD K;  3SDZ A;  1AWO A;  2KRO A;  4C92 E;  2AZV A;  1VIE A;  3A8M B;  1VQ5 A;  3JCM g;  1YJ9 Q;  4JRQ A;  1YN8 A;  1K9M R;  1BCO A;  2DBK A;  2DLP A;  3HFN A;  4ANJ A;  1YIJ Q;  1WQ7 A;  2JTF A;  1QWF A;  2MWO A;  5EC7 A;  4BI8 B;  1CKA A;  3RUX A;  1K0S A;  1VQL A;  1I81 A;  1W2B A;  2L5Q A;  2JS0 A;  4DQ2 A;  3RES A;  1UJ0 A;  4OMO A;  8AT1 B;  4M77 B;  4OMM A;  3NMZ C;  1IXD A;  1OX8 A;  2DYB A;  5D6X A;  2F2X A;  4M7D D;  2ZPG B;  4M7A G;  3QO3 A;  1VQM Q;  4JS4 A;  1VYU A;  3CC7 T;  2J6O A;  2FRY A;  3G6E Q;  4M7A F;  2NUZ A;  1RAC B;  2RJE A;  1Q7Y C;  1LJO A;  3QXE B;  5DY9 A;  2E70 A;  2E65 A;  5LJ5 f;  5CKF A;  4C92 C;  1K8A R;  2QK0 A;  5GAM j;  3E1S A;  2VUB A;  3JB9 G;  3S3O A;  1ABO A;  1OV3 A;  2DIG A;  4V2S A;  1IGU A;  1G3Y A;  1KQ1 A;  3M4G A;  3JB9 F;  1WHK A;  1KD1 C;  1W70 A;  1I5O B;  4QQD A;  1M8V A;  2JM8 A;  2V8J A;  2ROT A;  3CD6 T;  4HVU A;  4BD3 A;  2L89 A;  3VS2 A;  2DET A;  2FPD A;  1QVF S;  2K79 A;  2RNA A;  4AFZ C;  1JO8 A;  1VQ5 T;  4FCY A;  4E2F B;  3L42 A;  3URG A;  4WF2 A;  4HT8 A;  4M7A B;  3CCE T;  3OW2 S;  1CKB A;  1X6B A;  2JOY A;  2JMC A;  5CQY A;  3CCV Q;  3NTK A;  2COW A;  1BIB A;  3LH5 A;  2H3E B;  4MZM A;  3JCM X;  1RAH B;  1VQL T;  4XU1 A;  5CKB A;  3V7R A;  2OTL A;  3M0U A;  3I56 Q;  3FJP A;  1EIF A;  2AKK A;  1VQ6 A;  4FSS A;  2M16 A;  5A0G A;  3MJX A;  2DKG A;  2DD5 A;  2J6K A;  4A4H A;  4GY5 A;  2KR3 A;  1QP2 A;  1Q81 R;  3QDR B;  2OI3 A;  3JCM f;  1AWX A;  1PG5 B;  3H9N A;  4II1 A;  1E7O A;  2FPF A;  1VQK A;  3EHR A;  5I22 A;  2CSI A;  3PE0 A;  4HCC A;  4ZGE B;  2EQI A;  5ECA A;  3DB4 A;  2ED0 A;  3CCL Q;  1BU1 A;  2YUO A;  2D6F A;  1G83 A;  2L8D A;  4HVW A;  3PTA A;  1SF9 A;  4BE0 A;  1K76 A;  3JB9 J;  1VYV A;  2PUO B;  4F7U E;  1M4Z A;  2LCS A;  3NFC A;  2XI9 A;  1BIA A;  1NG2 A;  2CKK A;  1BI0 A;  2W10 A;  2QEX A;  1M9S A;  2MOX A;  3QZ9 B;  4VUB A;  2KRM A;  2B86 A;  3QII A;  2ROL A;  3JCM e;  1VQ4 A;  1MHN A;  1JJ2 S;  3H8Z A;  2LJ3 A;  2DZ9 A;  3FIF A;  2VGN A;  3RMQ A;  1NM7 A;  2KI7 A;  2JTM A;  3VS7 A;  1UB4 A;  5A2Q E;  4FYW B;  1QP3 A;  1TU0 B;  2FB7 A;  2X9H A;  4KT0 E;  2DL8 A;  2IIM A;  2K3B A;  2PTK A;  3RIR A;  4CC2 A;  1N9R A;  1Y96 A;  1VQ6 T;  1HD3 A;  1VQ7 Q;  2KT1 A;  1WGS A;  3O5Z A;  4LUD A;  4JJN K;  1KC8 U;  1MMD A;  2WAC A;  3QHS A;  4LDX A;  1KQ2 A;  2DE0 X;  4J6Y A;  1RAD B;  2DXC A;  1QKX A;  4M7D E;  1KQS A;  2EYQ A;  1M3C A;  1O9S A;  1G3W A;  4RTU A;  2MAM A;  4PFP A;  2RHU A;  3I55 T;  2A3L A;  3CXC P;  4M7D A;  4PJJ A;  2QQS A;  2F69 A;  3OMG A;  2QAZ A;  3VJP A;  4AMC A;  1WXT A;  2VC8 A;  1HK9 A;  1GL5 A;  1NYG A;  3NPF A;  1YJW A;  2KXD A;  4XTX A;  5HK0 A;  1WJQ A;  3FC3 A;  1WIE A;  1Q7Y R;  3MP1 A;  2MYS A;  1UGQ B;  2KK4 A;  3M56 A;  2QEX T;  3CC4 A;  1TUD A;  1GXI E;  2OX7 A;  3JCM Q;  3H0H A;  2M0O A;  2F2W A;  3MP8 A;  5J3B A;  2XDP A;  4OP0 A;  1VQ4 T;  2C0T A;  2RM4 A;  5GAN 6;  1UTI A;  2ZAE A;  3LWI A;  1XOV A;  3X25 B;  1KD1 R;  2CT4 A;  1SHF A;  2EVR A;  5HKC A;  1FMK A;  3A1P A;  1Y0M A;  4OML A;  2RQW A;  1BI1 A;  1D0Y A;  1SSH A;  3S6W A;  1MMA A;  2HQX A;  3SWN A;  5GAO r;  3V7C A;  5L8R E;  1XQH A;  1PCX A;  1YNZ A;  4M7D G;  1KIK A;  4C8Q D;  3KBG A;  4KGX B;  3L2Z A;  2JW4 A;  4DEY A;  2J7I A;  2MCN A;  2AZS A;  2K7A A;  1X2Q A;  4A63 B;  4PNO A;  1Z9Z A;  1S72 T;  4X9C A;  1RAG B;  2HL5 C;  5GJV B;  3WXM B;  3VS4 A;  2DZC A;  1Y07 A;  2LQN A;  4KH1 B;  1Y96 B;  2DM1 A;  1YJW T;  2DTO A;  1RL2 A;  2Y90 A;  1QCN A;  1AEY A;  3JCM P;  1I1J A;  3JRZ A;  1YP5 A;  1RAI B;  4OVA A;  2M1H A;  2QDY B;  2XG8 D;  5L23 A;  3SWN C;  3CC4 T;  3LX7 A;  2JS2 A;  3CCS Q;  4XU0 A;  3X28 B;  1W2B S;  1M90 C;  2BE9 B;  3LW5 E;  1UGS B;  4B9X A;  1XNI A;  4QKU A;  5DLQ E;  3O8V A;  3CCU A;  4BI4 A;  1TG0 A;  4D6W A;  4M7D B;  1FYN A;  4XU2 A;  4Y28 E;  3OS1 A;  4ZTJ A;  5FU6 B;  3OS2 A;  5GAO l;  2DXB A;  4JJD A;  1IGQ A;  3THK A;  4M78 E;  3A8H B;  2GTJ A;  2X4X A;  4PJO E;  2FZK B;  2K3X A;  1MV0 B;  3H0F A;  1YCY A;  1YHQ Q;  2OAW A;  1KC8 C;  2CUD A;  2AHJ B;  4X1V A;  1SPK A;  4JZ4 A;  2O01 E;  1ZBJ A;  1QVF P;  3TCJ A;  2CGH A;  2EKH A;  2QG9 B;  3SHW A;  5CCA A;  1OQK A;  2H3J A;  4KGZ B;  4OGE A;  1M1G A;  3OW2 P;  1NYF A;  1MV3 A;  1EFN A;  1PD0 A;  3SWN B;  4GBQ A;  4BE2 A;  4XAX B;  1AWJ A;  4R0K A;  2JTE A;  4HA8 A;  1AZG B;  1MMN A;  4M78 C;  4J6W A;  4PJO C;  5C6S A;  2ECZ A;  1ZA2 B;  2EJF A;  3CCU T;  3J80 E;  4J9E A;  4JZ3 A;  2ZPH B;  2DXU A;  5GAM h;  3AHU A;  1OPK A;  3GNF B;  2X3X D;  2BZ8 A;  4C0D B;  4N4I A;  4CRI A;  3ZEH A;  3L2V A;  1K9A A;  1RAE B;  1UUE A;  2K4Y A;  3M54 A;  2CH4 A;  1Q86 C;  1WX6 A;  2K5I A;  3J81 E;  2VXE A;  5GAN d;  2FG0 A;  3OBW A;  4J9G A;  2RO0 A;  5I2M A;  2RQV A;  2JN0 A;  3A98 A;  1X6G A;  1H92 A;  1ABQ A;  1VQP T;  1VYT A;  3J7A F;  3VU3 C;  2QA4 T;  4PFZ A;  4OB0 B;  4E6R A;  1H64 1;  1OYX A;  5GAN h;  3HP9 A;  4M75 D;  1IB8 A;  4OB2 B;  2HNI A;  4M77 E;  4CI0 C;  3VRZ A;  2LX7 A;  5IHK A;  4E7L A;  1JJ2 P;  3CCQ A;  4C8Q E;  2V26 A;  5CQX A;  2PUK B;  5HY6 A;  5GAO m;  2PVD B;  4XQ3 A;  2L3S A;  4C8Q A;  1W1F A;  2A7Y A;  2YDL A;  5LJ3 d;  2D0N A;  2RB6 A;  2DEQ A;  3X26 B;  4BB7 A;  1OEB A;  3MET A;  4RTT A;  3CC7 Q;  2D1X A;  4O5V A;  3OYL A;  3MHX A;  2LZ6 B;  2HZY A;  5FRN A;  5LJ3 h;  3VYH B;  2OAU A;  4B6M A;  3P8H A;  4E7K A;  1S1N A;  4HXJ A;  5GJW B;  3EG1 A;  1SRM A;  3HPW A;  3NGP A;  4X34 A;  5GMK l;  2YLB A;  3U23 A;  2EQJ A;  2EQU A;  2LQK A;  1YJN A;  2CP7 A;  1MNE A;  5GAN 7;  2XD0 A;  4ME7 A;  4L6V 5;  1M90 R;  2LTO A;  3EHQ A;  4M77 C;  2RI2 A;  3RER A;  2HBP A;  2A0F B;  1KQS S;  3CD6 Q;  4BDY A;  3OYH A;  1BKB A;  1VQ9 Q;  2CZ7 B;  4L59 A;  4M7A E;  3NTI A;  3PVQ A;  5FRM A;  1VQ5 Q;  4RUG A;  1WHJ A;  1GBQ A;  1Q82 U;  4Z88 A;  2KVQ G;  2L3Q A;  2C06 A;  3CCE Q;  4C8Q G;  2KDS A;  3MP6 A;  5GAO n;  3M0T A;  1UJY A;  1VQL Q;  1G2B A;  3H0I A;  3C95 A;  1KC8 R;  3X24 B;  1ZSZ A;  3G4S T;  4OB3 B;  3OSV A;  2E6Z A;  2LT4 A;  1WXB A;  2RJF A;  2EJ9 A;  2H8H A;  1JXM A;  1AT1 B;  2K3Y A;  2MWP A;  2LMJ A;  2WSC E;  3PFS A;  2PVO B;  2RI5 A;  3A8G B;  4BAC A;  4M7A C;  3HSB A;  2E12 A;  1YJN T;  4EIK A;  3EH1 A;  1KG1 A;  4FT2 A;  4P5N A;  4LXC A;  3MPU B;  3OYK A;  1M8M A;  4J8O A;  3BFM A;  4C8Q B;  3JAM E;  3EG2 A;  1KSW A;  3M57 A;  4EMH A;  1VQO A;  5KYW A;  2RQT A;  1TUG B;  3CCR T;  2CS7 A;  2HL3 A;  3I9Q A;  1QCO A;  5IT9 E;  1E6H A;  4IUP A;  4N0A A;  2QXF A;  2R5A A;  3QJ6 A;  1X01 A;  4JRP A;  2FL7 A;  2JMA A;  4AFS C;  1Z9Q A;  2K5F A;  1W2B P;  3SB2 A;  8ATC B;  2DL4 A;  4J9C A;  1KFZ A;  2E3I A;  5CKD A;  2XK0 A;  2QI2 A;  3UPU A;  1W6X A;  1YJ9 A;  4D8D A;  4KUL A;  5GMK m;  1Q86 R;  2BZX A;  4L5G A;  1I4K 1;  1YIJ A;  1VQ6 Q;  1JU5 C;  1AVZ C;  3G71 T;  3OYJ A;  1VUB A;  2P0P A;  3PT9 A;  3UAT A;  2ED1 A;  4JRK A;  1H3Z A;  1NJI U;  1PNJ A;  5GMK h;  5IAY A;  1IRX A;  1I8F A;  2XIC A;  4ZN1 A;  3Q1J A;  4JPB W;  1YIT Q;  4ZGD B;  2DL3 A;  4OF1 A;  4J6X A;  1K0X A;  2KE9 A;  1VOM A;  2LJ0 A;  5AT1 B;  1M30 A;  2O31 A;  2V8K A;  3V7S A;  4C92 F;  5FLX E;  2KRS A;  3G6E A;  4OMN A;  4Y91 A;  3I55 Q;  2VVK A;  3HL8 A;  5HK3 A;  4LD9 K;  1ZSZ B;  1M5Q 1;  2NYS A;  4C0F A;  1JRI A;  1H8K A;  5GAN g;  2GFA A;  3QWX X;  1OUL A;  2HMA A;  3OYF A;  4ZTF A;  3MO8 A;  3VS1 A;  2GF7 A;  1VQO T;  3C0C A;  4OMF B;  2O9S A;  3OYE A;  2DXT A;  3CPW A;  4IKF A;  4RTX A;  2HKQ B;  4ELY C;  3M5A A;  1TWB A;  3LWH A;  2RK1 A;  4B9W A;  3VS6 A;  3OYI A;  3ZBD A;  4QVD A;  2QGF B;  1YCS B;  3C94 A;  1JBM A;  1QQJ A;  3MEU A;  2DRK A;  4EMG A;  5LJ3 g;  4M75 G;  2EW3 A;  3VV0 A;  5I2S A;  2FRW A;  3EG9 A;  4QVZ A;  3V8K A;  1D1B A;  5KYW B;  2NLU A;  4M75 F;  2EYW A;  1GFD A;  4HCB A;  5FWB A;  2ENM A;  3I56 A;  2DVJ A;  4J7F A;  4NL2 A;  3JCM V;  3VKI A;  1GBR A;  2M51 A;  5KYU A;  2VGM A;  1OOT A;  3JB9 I;  1X69 A;  1WZO A;  3FJ5 A;  1KJW A;  2CP3 A;  3CCM A;  5GAO q;  3G6E T;  1YI2 Q;  1S72 Q;  3E2U A;  1WPY A;  2GTO A;  4JUV A;  3LYI A;  1D1A A;  3OYA A;  1TTH B;  3TVT A;  1N8R U;  1U06 A;  2QYZ A;  3TSZ A;  2X35 A;  4IUQ A;  2V8I A;  2L3P A;  4Z02 A;  1QLY A;  1TUC A;  3VUZ A;  5GAN 2;  1PKS A;  1M1K U;  1VQK T;  4IUU A;  3EFS A;  3OMC A; 
#chains in the Genus database with same CATH homology
 3CCS Q;  3CCL Q;  1VQ8 Q;  1W2B P;  1K8A R;  3CCE Q;  1K73 R;  3CCJ Q;  1VQO Q;  1NJI R;  1VQ4 Q;  3CCU Q;  3CCQ Q;  3CXC P;  3OW2 P;  1YJ9 Q;  3CC7 Q;  1YJW Q;  1M90 R;  1N8R R;  1KQS P;  3CCR Q;  1YIT Q;  1VQ7 Q;  3CME Q;  1VQM Q;  1K9M R;  1QVG P;  1VQL Q;  1YIJ Q;  3CCM Q;  1JJ2 P;  3CCV Q;  1YHQ Q;  3CD6 Q;  3G4S Q;  3CMA Q;  1Q81 R;  1KC8 R;  1VQK Q;  3G71 Q;  1Q86 R;  3G6E Q;  1YJN Q;  1VQ9 Q;  1VQP Q;  1KD1 R;  2OTL Q;  3CC2 Q;  3CC4 Q;  1Q7Y R;  1VQN Q;  1QVF P;  2QA4 Q;  2QEX Q;  1M1K R;  1VQ5 Q;  1YI2 Q;  1VQ6 Q;  1S72 Q;  3CPW P;  3I55 Q;  1Q82 R;  2OTJ Q;  3I56 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...