1K8CA

Crystal structure of dimeric xylose reductase in complex with nadp(h)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
319
structure length
317
Chain Sequence
b'SIPDIKLSSGHLMPSIGFGCWKLANATAGEQVYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDEGLVKREEIFLTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPIAFKFVPIEEKYPPGFYCGDGNNFVYEDVPILETWKALEKLVAAGKIKSIGVSNFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSFGPQSFVNQGRALNTPTLFAHDTIKAIAAKYNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDIGLRFNDPWDWDNIPIFV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xylose reductase
molecule tags Oxidoreductase
source organism Candida tenuis
publication title The structure of apo and holo forms of xylose reductase, a dimeric aldo-keto reductase from Candida tenuis.
pubmed doi rcsb
total genus 108
structure length 317
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.307: D-xylose reductase.
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1k8cA00
3R94A 3UZZA 1AH4A 2BP1A 2PDXA 2PD9A 3GHUA 4WDTA 4H8NA 4PR4A 1HQTA 1PWMA 1IEIA 2PDGA 1EKOA 3LBOA 4DZ5A 4Q3MA 3VXGA 1MRQA 3EAUA 3GHSA 2BGQA 3RX4A 4FA3A 4IJRA 2AGTA 2DUXA 3UP8A 3ONBA 3T42A 3LZ3A 3UZXA 2FZDA 4XVEA 4YU1A 2PDPA 2INZA 3LD5A 4Q7BA 1EXBA 2INEA 3LQGA 3BV7A 4L1XA 4OTKA 1YNQA 4JQ3A 4PUUA 1C9WA 2ACRA 4HMNA 4PRTA 3M64A 2R9RA 5LIXX 2NVCA 4F40A 1PZ0A 2IPFA 2DUZA 1MZRA 4JTCA 4GIEA 4IGSA 2PF8A 2PDIA 1X96A 4MHBA 4WGHA 1AFSA 2IS7A 2QXWA 3R8HA 1LQAA 1VP5A 1S2AA 5DANA 1X97A 3WBXA 2PDQA 4WDUA 4XZNX 1HW6A 2CLPA 1M9HA 3LQLA 3G5EA 4JQ4A 1J96A 1RALA 1ZGDA 4L1WA 4LBRA 4NKCA 1S1RA 3S3GA 3UYIA 2ACQA 1XJBA 5HNUA 4IJCA 4QX4A 4YVPA 4FZIA 2HV5A 4QXIA 3EB4A 1AZ1A 2PDUA 3GHRA 3GUGA 4PUWA 1Q13A 2BGSA 3WBWA 3D3FA 3RX3A 1VBJA 3V35A 4QBXA 1EL3A 4JTDA 2IKIA 3Q67A 1X98A 3R7MA 3Q65A 4PRRA 2PDMA 2FZBA 2IQ0A 2PDFA 4QR6A 4JQ1A 4JTAA 4YVVA 1YE6A 3R58A 2P5NA 4H7CA 1FRBA 1IHIA 3N6QA 2ALRA 1AH3A 5AZ1A 4GA8A 1AH0A 5C7HA 4XVDA 2WZTA 4EXBA 2ACUA 2DV0A 4ZFCA 3V0UA 2PDYA 3WCZA 3UZWA 3CMFA 4XK2A 4JIRA 1QWKA 3H7RA 2IKGA 3FJNA 2PDJA 4PMJA 3F7JA 3O3RA 1S2CA 3UFYA 4XO7A 2HVOA 1XGDA 2PD5A 2HDJA 3R8GA 3ONCA 2ACSA 1RY8A 2WZMA 1MI3A 1XF0A 3NTYA 2PDNA 4JTRA 5LIKX 3P2VA 2VDGA 2PDCA 4XZHA 3LUTA 3BCJA 3DN5A 1ADSA 4JQ2A 3BUVA 2IKJA 4XZIA 3LENA 5LIWX 1ZSXA 5M2FX 4LAZA 4GCAA 4FAMA 1S1PA 3U2CA 2FZ8A 2FZ9A 5AZ0A 3O0KA 1Z9AA 4GABA 4LB3A 3G1RA 3LN3A 2HE8A 1ZQ5A 4JQAA 2IPWA 3CASA 4WEVX 2ISFA 4XO6A 2PFHA 3WBYA 2HE5A 4EXAA 3MC5A 4I5XA 4YVXA 2I17A 3FX4A 1T40A 3CAVA 4YS1A 1RY0A 5HA7A 2PDLA 4XZMX 1A80A 4WDXA 2F38A 1Q5MA 2FGBA 3RX2A 4LBSA 3UGRA 1YE4A 2IKHA 4DBUA 1PZ1A 3R6IA 4ICCX 3V0SA 2PDWA 3EB3A 1AZ2A 3UG8A 1EF3A 4JIHA 4G5DA 3CV7A 3N2TA 1ZUAX 1Z8AA 3LNMA 2I16A 2PZNA 3UWEA 1Z3NA 2C91A 3R43A 2PDHA 3LEPA 3B3DA 1T41A 3GHTA 3KRBA 4FALA 5HNTA 2HEJA 1JEZA 4ASTA 4JTQA 4GQ0A 4WDWA 1US0A 5JH2A 5LIYX 2IQDA 4GQGA 4GACA 2HVNA 4DBSA 2NVDA 3QKZA 1OG6A 5LIUX 1Z89A 4JIIX 3WG6A 3H4GA 4HBKA 1PWLA 3LZ5A 4LB4A 1QRQA 2A79A 3M0IA 2PEVA 1YNPA 4RPQA 1K8CA 3BURA 1PYFA 2IPGA 3CAQA 3MB9A 3ERPA 5KETA 3DOPA 4AUBA 3UZYA 3V0TA 3M4HA 3H7UA 2R24A 2J8TA 4R9OA 4LAUA 1SM9A 3V36A 1R38A 4WRHA 5JH1A 3COTA 2IPJA 2F2KA 1GVEA 3CV6A 2FVLA 2PDKA 4DBWA 3C3UA 1UR3M 2PDBA 1LWIA 4XZLX 4XAPA
chains in the Genus database with same CATH superfamily
3WD3A 1XISA 5AC5A 2XFWA 6TIMA 2DEPA 3QV9A 2Y63A 3A5FA 2VEGA 4XISA 2PLCA 3UA4A 1GVYA 4CU8A 2Z28A 1F4HA 2CLLA 3N11A 2OO0A 5KSWA 1VFSA 3EAUA 4IIBA 4IJRA 2AGTA 5CGTA 1UD8A 2QV5A 3BSGA 4NSBA 1MEIA 1XKJA 3W1RA 2IUZA 4QLLA 4C6LA 1XRVA 6TAAA 3BOLA 5CG0A 3PZMA 1SO6A 1J11A 2BZNA 2P8BA 1ZJHA 3V1HA 4L1XA 1JAKA 1KM0A 4HNNA 3QFEA 2DPEA 3UESA 1E1CA 4RNIA 1SSGA 2QDEA 3MZNA 5CCZA 1AJZA 3R13A 1BPLB 2F6UA 2IPFA 4POCA 3QMTA 2VR4A 3CV1A 3M6DA 4XWUA 2R1MA 3KOFA 2AAAA 3D3AA 4MDPA 3HOJA 3GLCA 1GWJA 2ZX7A 4QQUA 3H2AA 4WGHA 2VDHA 4GYKA 5FD0A 3DFQA 3MJMA 3F1QA 4TO8A 3TFCA 1AL8A 1W1YA 3QRHA 2YR1A 1DVJA 3QV7A 4O54A 4HNCA 1ZGDA 5FSEC 4JN8A 4MWAA 1ZBCA 3BJTA 5DMMA 4UNLA 4KCTA 2FJUB 3A13A 3WLOA 2YBUA 1EJWC 4UTMA 2DIJA 1JIBA 3JZUA 4P7NA 4PUWA 1R7OA 3K30A 3D3FA 4YHEA 1VLIA 4E4FA 4ACZB 1CGTA 2J4GA 3SFWA 1P1MA 2Z25A 4UOZA 2DJLA 2IKIA 2H9AB 3BL3A 2UBPC 1X98A 3VIHA 3R7MA 5C8BB 1PEZA 3H2MA 2YCJA 1V79A 2IQ0A 3TZFA 1KBBA 2CXEA 2WHLA 4ERIA 4YXGA 3ZJKA 5E6YA 3LCIA 1D9EA 1U22A 3DIPA 1V3KA 5AZ1A 4GA8A 3MI3A 3R5EA 1F6PA 2C14A 4WOQA 1F3EA 4LANA 1TMLA 2ACUA 4IF2A 2BVWA 4JIPA 4EPEC 4B5UA 3V0UA 4LXFA 1QASA 1YXDA 2BBFA 3TTEA 5HPOA 3L0GA 4QM1A 3GD6A 1SZFA 3W7PA 3CEPA 1UKQA 2QULA 3W01A 2ATSA 3FKKA 1H3GA 3MHFA 4H7VA 1UG6A 1X38A 2FTPA 1FXQA 4R85A 2W27A 4M1BA 3CPRA 3SCSA 1QPRA 1ZFJA 1CYGA 4BQ5A 1ODZA 3LBMA 1BVZA 4PMXA 3H2CA 3S9IA 3DDMA 1DBTA 3M0VA 4I7WA 4MWAC 4CKQA 2VDGA 3WD1A 1OX6A 3VD9A 1GQJA 3JVAA 5A6AA 3VNJA 5A95A 4R88A 1W1VA 1ZAHA 2KX9A 4AHQA 1DE6A 3PY2A 1TX2A 1TE1A 3W26A 1AQFA 1OFBA 3ARRA 4H6KA 2FZ9A 2V68A 3W83A 4LTSA 4LS0A 2C1GA 1N7KA 3B9OA 5DBTA 1OZMA 3NZPA 4KRUA 3SCNA 2OPJA 1G1YA 4S3BA 4YCPA 1LT7A 2V5KA 1VHCA 4MWAD 3WBYA 2FFCA 1E9IA 7TAAA 2DVUA 3GNDA 3T1GA 1AW2A 2WWDA 1TZZA 3E5BA 1V7AA 5JU6A 1KQYA 3B40A 4Y6GA 4O1CA 3PBYA 4NF7A 4Q4RA 2ZWZA 1T96A 5AC8A 5G5IA 4IUGA 3UGRA 3A64A 2ZDSA 1MRAA 3DKLA 3KTCA 1XSJA 4O4VA 3IJ9A 4S39A 4MPKA 3VGBA 3AS0A 5BOOA 1LT8A 1QNPA 1RXOB 4N6EA 1BXBA 1EYEA 3F4NA 1C3FA 2O92A 4QDPA 2RKXA 4EX4A 1XRFA 1L8PA 2DH3A 2FHCA 4GFSA 4FNPA 4IFKB 4CD7A 2UWFA 1US0A 4ZVJA 4CD5A 3PR2A 4DBSA 1AMKA 4M6UA 4GUHA 2NVDA 3W7LA 5REQB 1OFDA 1RA5A 1MDRA 2WO5A 5F4WA 3S0CA 3N25A 3RLGA 4J4KA 3PSWA 1UUOA 4AIOA 4AD3A 2BXYA 3KVJA 3LYEA 1G4TA 3BMXA 4QEHA 3IUIA 4FP1A 4LAMA 3CHVA 5AHMA 1VBGA 5M1TA 4V28A 1R3TA 1VQTA 1Q2SA 3M0IA 2C15A 4RPQA 1L2UA 4UR7A 4IMAA 3WD4A 1QHOA 4MNMA 3MV01 4KFNA 4W4QA 3HPAA 4KW2A 4WXZA 1O60A 3BAYA 2XHYA 3M0MA 2EJ1A 2F6XA 3KBNA 4BQ4A 3T4CA 5LXXA 1FBAA 1B3ZA 1R38A 3ITXA 4DZHA 1TTJA 4AZGA 1JL8A 3B04A 1J8VA 2DSZA 4IUOA 1XD0A 1GVEA 1G4SA 1HNYA 2V2CA 2ZTKA 3DG6A 3CC1A 3GO2A 1MYRA 5HR7A 1N8FA 3LK6A 3P61A 4PCTA 3VDGA 3EBVA 1PTAA 4WK9A 5I79A 3C0JA 2PDXA 3TWAA 3GHUA 3LHUA 3TTYA 1HP5A 1XLKA 2XH7A 1OFQA 3R89A 1W1B1 4C5ZA 1PAMA 4KEZA 1YTDA 5C9ZA 4F3HA 3C0QA 4YTTA 3CUGA 2ISSA 3PTMA 5GJNA 3WLKX 4KBXA 2QIIA 3BAWA 3MS8A 4P2VA 2INEA 4KRZA 1F4AA 4UTHA 3M6YA 1W1ZA 2TYSA 1IGSA 1P0BA 2V3EA 1CLKA 1R2RA 1CGVA 1DJIA 1EJSC 1UWTA 1LG2A 1P4CA 3IJ6A 1HGWA 2WAGA 3GXFA 5FJPA 1EBHA 1Z41A 4OZOA 4E8DA 3G1HA 1DTNA 4RXFA 4UTJA 4JTCA 4GIEA 2CC0A 2Q3OA 3ARYA 3WUBA 1C8YA 2AMXA 3EX2A 3IS4A 3TFXA 4ML4A 1KM3A 1ZP3A 4OVXA 4W85A 4RV8A 4FIRA 2BODX 3WQEA 5HULA 2CU0A 3R8HA 3BAXA 4LUJA 2FGLA 2RHGA 2CCRA 3WK3A 2Q01A 3AMDA 2A3EA 1M5WA 1HN1A 3N3TA 5GQBA 1VLWA 2CBIA 5MKGA 2FYMA 1OGGA 2P76A 2ZXQA 5CQ1A 3VA8A 2D22A 4CD4A 4PTWA 3S5ZA 3VD3A 3ORWA 1PHQA 3W4RA 4U5IA 3S2JA 3REQB 4HSHA 2OGJA 1SR0A 3GIYA 3UD6A 1JG9A 3QM3A 3IIXA 4ERGA 5GNZA 3PANA 4DNHA 3HG3A 1BRLA 3RG6A 4RNFA 3Q37A 1VFLA 4A3YA 1BQGA 4UMCA 3WFZA 1SMDA 4ZOCA 4RDZA 3CQIA 3GXMA 2WMIA 3LS9A 1W9DM 2PDFA 2CKRA 4IIGA 1QBBA 4BQ3A 4DJFA 3GKAA 4JN7A 1DHKA 2ZYFA 2IXUA 1Q8JA 1W56A 3CJPA 3N6QA 2VWSA 4ZOAA 2WNNA 3UPMA 4PCPA 1CBGA 1EZ2A 4I6VA 2J7BA 1TUXA 2XH4A 2P53A 4LUTA 4NYUA 4CN1A 1TKKA 2A4AA 1H51A 4IIDA 2A7RA 4WKHA 4HGXA 1BG4A 3CLWA 3GDRA 4AVNA 2J79A 3XINA 4DVOA 1QW8A 2Z1KA 1REQA 2X40A 1M03A 1RP9A 5HMEA 4C1KA 3SRHA 4K7VA 1TCDA 1JZ7A 1KFJA 2YFOA 3T0AA 1C7TA 2J75A 3AQUA 3S9ZA 3W7HA 7REQB 1MXDA 3CWHA 3WLNA 1W54A 4ZA0A 2O9PA 3AIEA 1JCXA 4CQCA 3MBDA 5CAKA 5KZMA 3G6LA 2C0AA 1B3OA 3VUPA 2OMAA 1UH4A 5DELA 4C1NA 3OG2A 4ZO8A 1I8JA 3LNPA 4OECA 1CB7B 1W1PA 1VBUA 2JFEX 4TIMA 1S5MA 3B0YA 2VCAA 4DXXA 3PZQA 2PLKA 1B5TA 2NQJA 2R6OA 3KOYA 2Z00A 4GIYA 4QNEA 2Y8VA 1B54A 3NOEA 3UCDA 2FVMA 3GM8A 1IXOA 3ARPA 3FX4A 4HQVA 4IPJA 2V5DA 1GKQA 1F2JA 1BFNA 1XLBA 2HZGA 4KT2A 1UMYA 2G96A 4EP8C 3CS2A 1W3KA 1H61A 2C71A 3NPXA 4LPCA 1QW9A 1NARA 2NT0A 3L23A 3NDOA 3AS1A 3W07A 1JI2A 3JRKA 3LCFA 4D6JA 4G5DA 3CV7A 3GNOA 3F5JA 2C16A 1E6ZA 3G1AA 3NGJA 4PMZA 2WQPA 1UD2A 1DIKA 1GOXA 1QVBA 4JTIA 3AIUA 1EP1A 4H8UA 3PWIA 1ZENA 3GHTA 1Y7VA 4KERA 4KWOA 3V16A 3A22A 3GDMA 4TVCA 4UB9A 3IJIA 4D1IA 3ZR5A 1GZJA 1A5NC 3MP3A 1E3ZA 5D02A 4ZOBA 3O6DA 5FJIA 2POZA 3U2ZA 3NEHA 4O14A 3KVLA 1RCQA 3GYEA 4H6RA 2A2IA 3OVGA 3OHIA 4BJHA 3QYSA 1PHWA 1MQRA 1Y65A 3V5FA 3VIOA 3OOQA 5SWUA 4O8RA 3BW4A 2FPVA 3QR3A 1FWAC 2A3BA 3T0TA 1F76A 5DMLA 1WV2A 5MKGB 1OADA 2J9XA 1KM5A 3BSHA 3WQFA 2V9DA 2OZTA 3NIYA 4DIAA 5C9RA 3TYUA 4M7SA 4A8LA 1UA7A 1XC4A 4HOWA 4K1GA 1GW1A 1W3HA 3H2EA 2TAAA 2OGYA 4R7OA 3S9YA 1CECA 1XYZA 5BOFA 5CXPA 1ZJBA 2OJPA 3KL5A 3QFWA 3SIZA 3M1ZA 4JKKA 3RM8A 4JIEA 1W0MA 1YBQA 3SRKA 2VL4A 2XM2A 3O0FA 3W38A 4M3PA 3ITOA 3EPMA 1HKWA 3VNKA 3BMWA 4OOZA 3N4AA 4ECLA 4BI6A 5A8MA 4FXJA 2QT3A 1PWMA 4CLMA 3CUJA 3PPFA 3LPPA 2DUXA 3O16A 1PTGA 3ONBA 2YCLB 1UIOA 1XLEA 3WQDA 5A1AA 2A7NA 1Q8AA 3A3HA 4PUJA 4HN4A 3QMRA 5REQA 5M17A 1WUFA 4NUWA 3W7JA 3M07A 1Q65A 3VX0A 1NFGA 3IPWA 4HTBA 3KBJA 4I8YA 2NWSA 3E96A 4Q4OA 3VDHA 4WY0F 3R11A 2NVCA 3TTQA 4Y9NA 2PWVA 4HOXA 2XVKA 4MLRA 1Z7AA 2VFEA 3AHTA 4B5XA 4IGSA 2REQB 1QCWA 4RZ6A 4DM1A 3RU6A 1DOSA 1G4EA 1C93A 1HKJA 1ISYA 4E2VA 6REQA 1AUSL 1H09A 4JNYA 1ZPTA 2O9RA 4EACA 5A94A 2VXNA 3UWQA 3P5ZA 3WMBA 2P8CA 4JQ4A 1J96A 3NQFA 3MP4A 4R34A 2EBNA 5BMWA 3S8HA 2HRWA 2PLJA 2OOGA 4NKCA 2E68A 3Q58A 1R7AA 4Q4KA 4UOQA 4E0CA 4IXXA 3NQBA 4IJCA 2UY5A 1P1XA 5T9BG 3LBCA 3L5MA 1SQ7A 3QZAA 3LCHA 4GPNA 4WF7A 1W3LA 3I6EA 3FEMA 5EGRA 1B2YA 2W0UA 3W86A 1FH7A 4FIQA 4L6DA 4D2JA 3WNLA 4AHPA 4JIQA 2V69A 4Q8PA 3L0NA 1OFEA 6CGTA 4INFA 3MO7A 1WP6A 2PC4A 4JQ1A 1RPXA 4JTAA 1H11A 1H1NA 4DJED 1P6BA 4FLSA 3HG5A 4A8RA 4ZQRA 5C55A 4AF0A 4J3XA 3OHMB 4FS9A 3BGAA 2JEPA 2RDTA 1CX9A 5DRIA 1EA9C 1J01A 4FX7A 3W7EA 5D30A 3MMTA 2VZUA 3W70A 3K4WA 2PWFA 5LA2A 4JTUA 2BHZA 5IHSA 2FH6A 3M47A 5DMYA 3VE7A 5HJLA 1TPUA 4HTYA 2NUYA 3WQWA 1BSIA 1SO3A 3PUGA 3URQA 3DAQA 4WGXA 4ZR8A 1TJ0A 3A4XA 1UWRA 3UPBA 1FTXA 3VINA 1E56A 3BOXA 1OYCA 4LUSB 4O10A 3NZQA 4RXGA 3S6DA 3HPSA 4H04A 4JXCA 2VI0A 3UG3A 2GQAA 3KWSA 4L4OA 4AIBA 1W3IA 3IK2A 3NXLA 4QG8A 4BZYA 4RE3A 5JIWA 5CSYA 4DO6A 1LBLA 2WJEA 2FB2A 3K4AA 1ADSA 3UY8A 5E1QA 2XYLA 2JF7A 8A3HA 1VS1A 3NL5A 3GTNA 1PCWA 1FCQA 1VJSA 4HPHA 2XIBA 1G69A 3BANA 3CYVA 1OT1A 4HCLA 4J3ZA 1ZQ5A 5EMMA 3RIKA 2XN0A 2UZ9A 4OQVA 1H1YA 1J5TA 4M82A 1XWYA 1GGOA 3MC5A 1C7SA 3M0LA 3GNNA 1FWFC 3GXPA 2ZRZA 4TX8A 4K2SA 4HN8A 3U2OA 1IZCA 2PDLA 3H2FA 3EWYA 3U7VA 4JDYA 2F38A 2DVXA 2EG8A 2PS2A 3IV8A 3TYEA 1JULA 4O1BA 2IKHA 2DFAA 1REQB 1ALDA 4LY8A 1OT2A 1XLAA 1SR9A 4G6CA 4HK5A 1JQXA 4KCUA 2AGKA 3GXIA 1CGUA 3NPVA 4XTDA 2PODA 3GNXA 2VX4A 3OJGA 1KRMA 1EJVC 4YLWA 3C56A 1E15A 1D2KA 3M16A 2Z7KA 2GGIA 3H21A 1PXGA 3LG3A 3LHTA 2WZHA 1GG0A 2VENA 4CU6A 3DG7A 1JEZA 3DXIA 4PBGA 3W0KA 4W87A 2ZZ3A 2OOFA 1XHGA 4S1FA 2C79A 1NWSA 5FSDC 1I9CB 3GAYA 5CC5A 4Z17A 1KLYA 3QKZA 3P0WA 2QJIA 4W7WA 1I2RA 1E6XM 2GPTA 4DEFA 2CITA 3H23A 1JCYA 1EBGA 3VZXA 2XSXA 5EB8A 3THCA 3ID7A 4D6FA 2C19A 2OG9A 1QRQA 3E2VA 3LLDA 1K4GA 4RR4A 3GDLA 3I10A 2B7OA 4KCWA 1K8CA 3WH8A 1BKHA 3F03K 4DO5A 1G4PA 4KRTA 1UD3A 4K8GA 5F4SA 4OE7A 1NF0A 3MUCA 5H8UA 5KETA 1S5NA 3E38A 5HJYA 3ME3A 1JCMP 2OLHA 2XG9A 4IGHA 4DJEC 4UFMA 3TVAA 3UR7A 3WDJA 3NUKA 1J10A 1V6UA 1F3XA 1DIDA 2NLYA 4QE4A 2F2KA 2YB4A 1W5NA 2WVVA 4WJXA 4PZVA 4PMOA 1NEYA 1W3JA 2EKCA 5AHFA 4XBKA 2VO5A 8TIMA 3WFLA 4DZIA 3UWVA 1HL8A 1WPCA 3WNMA 1AH4A 2JK2A 2BP1A 5M5DA 1RD5A 4RE2A 1KB3A 4WDTA 1W3NA 3IIZA 4I7VA 1WX0A 3AJ7A 4N9CA 4EVZA 3KS5A 3DECA 3M0KA 3KHJA 4QG6A 3P62A 1GOMA 3GU9A 4GXWA 4XVEA 1OCBA 3TN4A 2QMKA 1B57A 1F61A 3AAMA 1OCQA 2OSWA 3GG0A 4PH6A 4G8TA 4S3KA 1RP8A 3B8SA 2ZUSA 4J1OA 4Q8NA 3SCVA 3KBWA 3I4KA 4R53A 1TELA 4ZQCA 1JXKA 4LFYA 3AI0A 3LXCA 2Q09A 5F2LA 3SB0A 4NJKA 3HQPA 4GUIA 4OT7A 1SO5A 2PDIA 4A21A 3OLIA 1M65A 4ORIA 4HMCA 4US5D 3T6CA 1W9UA 2J7CA 4GISA 1X97A 2EPNA 4WDUA 3E12A 3JZEA 1OYAA 3EXSA 4C6BA 1JNDA 1XBXA 2OYMA 4HMEA 1A5CA 2H6RA 4P7LA 3RAOA 2CHNA 1WKEA 3VYLA 3DENA 4LBRA 4OBRA 4JZ5A 3AYRA 4MUZA 4ZENA 2ACQA 4DYEA 4HP5A 1XJBA 3CUXA 1V3MA 2VT0A 4EAYA 2NX1A 4S38A 1OX5A 3T55A 3A4AA 3GHRA 1EGZA 1VFTA 2YJQA 9XIMA 4P7RA 1NF7A 3WNNA 1NDYA 3RX3A 5IFPA 1EOMA 1VFMA 3ALGA 3PUOA 1R2SA 4LCRA 2G37A 2E8YA 2YCLA 1R9ZA 4P8UA 4AFYA 1OX4A 1XSIA 5DF0A 5A8GA 3GYCA 3ZLFA 4ACZA 1FDJA 4A22A 1XYLA 1VEOA 2EXOA 3EWDA 4LUYA 3IJLA 3RCYA 2Z1BA 2ISDA 4GINA 4E38A 1XIHA 1SJBA 2EEXA 3SCPA 4IISA 3ANYA 5JBEA 3EWWA 4RW3A 4GIAA 4NT0A 1UOKA 4KFOA 4OV4A 4F9DA 5LHEA 1Q85A 3OP2A 3UR2A 2XFRA 1GOWA 1KTCA 4DQWA 1MFUA 4DUVA 3GIPA 1QK2A 3KAOA 4GYJA 4HU8A 5ECUA 5LA1A 3LPGA 4HA3A 4LS1A 3TXVA 2A7PA 3IGUA 3BH4A 1E6RA 1V5XA 3C8FA 5JVLA 3QGAC 5H2ZA 1CI1A 3DGRA 1O5QA 1U5VA 4ZXOA 4PULA 1XGDA 4IOTA 3V3WA 1OCNA 3W82A 2VC5A 3BGJA 3ONCA 1RA0A 5BWFA 3P74A 2OYLA 3HPFA 1FVPA 2E6YA 1XR2A 2WZMA 1RJRA 4ZB2A 4XKYA 5GPRA 4Q7NA 1VYRA 5DX7A 1E51A 2OWWA 3AYTA 3DUGA 1NP2A 3PZGA 2OKTA 3TXZA 1T8QA 4XZHA 4ADTA 4IQEA 3RILA 1G6CA 1OGSA 5C9UA 3AJXA 1DEDA 2QPUA 4MAZA 5I3HA 4DB7A 4NAEA 1GYLA 3P7YA 5C0QA 4FR1A 3WNOA 4F4RA 3TJLA 3N2BA 3MUY1 1DXFA 5U7SA 2P1FA 4HA0A 3GU2A 4FX6M 3OIXA 1IWPA 3G1RA 1A0EA 1E5NA 3ZOAA 4LYPA 3DYOA 2IPWA 5I6SA 1VZWA 3MY9A 2OYKA 3FGCB 2Z1XA 4BA0A 3NGFA 5H91A 1W2PA 3NQMA 1ICSA 2EG7A 4MZ8A 2FMNA 5T8GA 2FGBA 3H4XA 1HL2A 5HXMA 5E0FA 1JZ5A 4U31A 4ERAA 2FVKA 2GSEA 1Z44A 2DT1A 1FHDA 3AMKA 1YDOA 2CLEA 2DZWA 3RR1A 1YMYA 4I8DA 1VCVA 5EMKA 4LAKA 3O6CA 4PUNA 3B0PA 3NPWA 2E7FA 1BF2A 4L4PA 3EDKA 3MP5A 4O13A 1QK0A 2Q6ZA 1OHLA 1T41A 1R30A 1GVOA 5G4EA 2HEJA 3O6AA 4FXRA 3TKFA 4NG3A 4DAFA 4D8AA 3LI0A 1TPFA 4DJFD 1K03A 4HZ6A 1WKDA 3KCJA 2OKOA 1XIFA 3W37A 1XDJA 2PAJA 3PZVA 2C1IA 1KWGA 3A5VA 3KOZA 2PU0A 3SJ3A 3PF3A 4H6EA 1YDVA 4GNVA 3B9DA 3THQA 1G7VA 5CZSA 3TW7A 4GZ7A 3GXNA 3T40A 4WD0A 1ZP4A 2WSYA 3G1XA 4NZ3A 3AXMA 1Z48A 4HZ8A 1CT5A 3N4EA 4GBDA 4US5A 4EANA 1VYSX 1H7OA 4LF2A 1SW7A 1RCOB 4UTTC 2WV8A 2VGBA 2RGLA 4DWDA 3P81A 5KZDA 4MFDA 1JFXA 3UNDA 3GW3A 1DIOA 3M4HA 2R24A 3LXAA 1ISZA 2QPXA 2I5GA 3NQAA 3SUUA 4WRHA 2C3ZA 3LCXA 4KGLA 2OTDA 2OQYA 3UVIA 2BVYA 1RBLA 3KCOA 3QOMA 1KGWA 2ZUWA 1S5WA 1TPEA 2J62A 2XDFA 4PTXA 4WOZA 1VC4A 2A3LA 4XZWA 1J2WA 5BMXA 5AYIA 3GC5A 4NZ5A 2RDXA 1XIBA 4JTHA 3WJZA 4QE1A 1IEIA 4JEJA 4DZ5A 2VYOA 1WKYA 3ITLA 4H2CA 3VXGA 4HT3A 2BGQA 4DJDD 3RX4A 3T7VA 1FCVA 1O12A 1TYGA 3WNKA 3UP8A 1UJQA 2BVDA 2GDVA 2J74A 1BYDA 4E4UA 3LV6A 3D0CA 3IIPA 5D33A 5D2XA 3R1ZA 3OZPA 3W29A 4JTTA 3W6LA 1MMFA 1WDDA 3CV2A 4JN6A 3U6WA 3ABXA 1UH3A 1YQ2A 3UY7A 3M44A 2ZA1A 5HATA 2GJLA 4HCHA 4NXSA 2E8ZA 3L9CA 4CVWA 4NX0A 1LUCA 3AWNA 2HXTA 4OBTA 4AWTA 4J40A 3MUZ1 1R3SA 1W8GA 1DTUA 3RLHA 5CSUA 1G94A 4ZE5A 2GWGA 3HIJA 3HMCA 1NU5A 1MSSA 3L4UA 5DANA 1LRNA 3ZQ9A 2WKGA 3BAJA 1FDYA 1I4NA 5D9MA 3PJUA 3C52A 2VEKA 3VIKA 4JKLA 4XAZA 2UY4A 3CMJA 3U57A 1ZHAA 3BVJA 3NR0A 3STGA 5DCEA 1XCFA 2HS8A 4LEFA 3CLMA 5JXQA 1M6JA 3S3GA 3G0SA 2WCGA 1QI3A 4HMDA 3FS2A 4Y8EA 3W2JA 3PBGA 3VIFA 3I7QA 4TMCA 5BRQA 1SZRA 1GONA 1JJKA 4ZBCA 1JCJA 2X7WA 1NOUA 4YIWA 5A6BA 1OJXA 2CBJA 1W2VA 1QDSA 2ZA3A 4OFCA 4W89A 4AZIA 2GUBA 3ZYZA 2EPLX 4CNNA 3SECA 1HJUA 5HANA 1PE1A 1BYCA 1V02A 1X6NA 1KBIA 3W1TA 2BS9A 1HKKA 1KA9F 3RM4A 1FRBA 5D9OA 3SADA 1VHNA 1LBMA 1EWDA 2D1ZA 2GOUA 3T81A 2X0HA 1H60A 4LH8A 3ZIZA 3NL6A 4QP0A 1DQUA 2WLYA 3NFUA 1PX3A 3CQHA 1ML1A 1FH9A 4UXDA 3UR8A 3HJZA 3WUGA 3DFSA 3QPZA 1NM9A 1N8WA 3H7RA 1EH9A 3SUVA 5D04C 4HPGA 1U83A 1LDCA 4B4HA 4PSPA 1OY0A 3O3RA 3A3XA 4AMCA 3QHMA 3ARTA 4GH1A 4TX6A 4A8NA 2HDJA 1CXEA 4RL3A 3PB2A 5AECA 1FHVA 3S1UA 2XIIA 2VRQA 1JCLA 3BLKA 4JTRA 3RO6A 4DYJA 1V4YA 3QV8A 3BJSA 3WDHA 3QMSA 1GOQA 1KO0A 4P7OA 3ARVA 3MTWA 1JUKA 1RLDA 2Y1HA 2XIQA 4KS0A 2GQ9A 4J3SA 3J7HA 3TQKA 3S46A 1E1EA 4BKNA 1W9XA 1EQPA 3LPOA 5BZAA 1XDMA 2JF6A 4CCDA 3QBUA 4H83A 3W22A 3MCNA 2IQTA 3EEZA 5CLTA 1K70A 2NZLA 1Z9AA 5J8LA 2H3DA 4JTJA 5I07A 4C90A 4UZUA 3UJEA 1TWIA 1T5AA 2OX1A 1ENUA 4HKPA 1E6PA 2CLIA 1JDCA 5DY2A 3EMCA 1IYXA 4UFIA 3TQPA 2PP1A 1DWHM 3AISA 3TYZA 4P61A 3VOIA 1TV5A 2OX4A 4HSNA 1PVNA 2QW5A 1AMYA 3RYSA 1DV7A 2QCHA 4O53A 1UYQA 1EIBA 1E6QM 1KGUA 3VKJA 1UPMB 4FF7A 5FAGA 3PB0A 3QSRA 5G4WA 1NDVA 3D46A 3UG8A 3FY1A 3SRDA 3BK0A 3APTA 5F2GA 4RZ5A 1YLVA 4LJ3A 2QUMA 3L68A 3MO4A 5E6ZA 2V8ZA 1XINA 1ZCCA 3W6YA 1A3HA 5A69A 3WH6A 3AU6A 3CHCA 1VJIA 3EA1A 3VNMA 4QAIA 2OLSA 5LHFA 2VVSA 1MW2A 1EA0A 1IT8A 3I65A 3WMLA 1GORA 4AY1A 1UD5A 1O66A 4W7UA 5CAHA 1FWCC 1OG6A 4C7DA 5IDZA 2TPSA 1EHAA 3CAWA 4IL0A 3TOYA 5E70A 4XQ6A 3BGGA 3RJYA 1YEYA 4HBKA 3URAA 1S46A 3ZM8A 1VGAA 3N18A 4LUSA 1V77A 4JFTA 3W3OA 3HF3A 2OELA 1RV8A 2BFGA 5T26A 1C29A 4E4PA 3FEQA 4CQ8A 1ONRA 5HWNA 3B8TA 4FNSA 3RFAA 7ODCA 1MUMA 3MYOA 2Y85A 4GMEA 3GE7A 3TP4A 2E67A 3W7RA 4DJDA 3DCPA 3W1AA 1ISWA 4Z0SA 1M53A 3BICA 1EGVA 2R91A 3VFCA 1A0CA 5KTLA 3PBUA 5I24A 4A2RA 3VNLA 3LOTA 3PHAA 4AC7C 4JNMA 2NX9A 5A6BD 3ARWA 2Z6JA 1UR3M 4XZLX 4CEUC 2BXVA 4E8GA 3P14A 3RXZA 1NSJA 3R25A 4Z0JA 4H8NA 4XAFA 2FPTA 5AY7A 4DJDC 5HK4A 4UWMA 4MMWA 3AROA 4B9ZA 3K8LA 5DEZA 3VZYA 3VKAA 5K2ZA 5AC4A 1F6KA 5CPQA 3UT0A 3HB9A 1QTWA 1KNWA 1NAL1 3K13A 4YU1A 4GUJA 1I2QA 1LJYA 3EOOA 4JCMA 3LQGA 2Y62A 4UTIA 2WHMA 3PM6A 1Z6KA 4MPQA 1EO5A 3EWZA 2E1DA 4X0NA 4ZQOA 3DFNA 4M80A 2VRJA 4QISA 1ZAIA 2CZ5A 2VZSA 5E9XA 2ZQ0A 2P88A 4HVXA 4Y96A 1IR1A 1VD6A 1ECEA 4L5ZA 5GVJA 3HTWA 3S5SA 4MHBA 1Q2RA 1JPKA 4LAOA 1PO9A 1I1WA 4KKXA 1VP5A 1X6UA 1F8MA 4GYFA 4ZQPA 2DDXA 5HQLA 3AHVA 1AQHA 5AVNA 1CZ1A 1R3WA 1TTIA 2I5QA 2PGRA 1PKMA 4Z2LA 2OWXA 2AMGA 1QNQA 3C86A 3C0SA 3ZSTA 2ANUA 2Z4GA 4IX2A 1MWOA 2BWGA 4IT1A 3I68A 1FQ0A 1M7JA 1ZL1A 1AZ1A 3GUGA 2GDUA 3FN9A 3AUOA 4JFSA 4PA8A 4LQ1A 3V35A 2EPHA 4QBXA 1XC6A 3SGGA 3W84A 1VPXA 3SUSA 4JHZA 4RDVA 5A2CA 2WMFA 3R58A 4UMBA 4D6CA 3RPTA 3IIOA 1WB0A 1O68A 1V6WA 3PWAA 2FLIA 1V3IA 3AXHA 1CGYA 3C2RA 2BY0A 1Y8BA 1HL9A 1HO1A 4EE9A 4Z08A 1A5UA 5HNRA 4RK8A 3TAOA 3SY1A 4PRWA 2PTWA 3FJNA 4MJMA 3PZTA 3EDDA 3CO8A 1IIHA 1N55A 3KP0A 3S2NA 4EXQA 3BWWA 3KCLA 3SW6A 4TMBA 1UR4A 4BF5A 4QITA 3OA3A 1OF8A 2PWHA 1MI3A 1TV4A 3GIQA 3UWUA 1FWJC 1G01A 4IGNA 1JZ6A 3JR2A 3MSRA 4QHRA 5FF4A 3QKEA 3SCQA 3PAJA 3SN1A 4LVGA 1QNOA 4JX6A 4CN6A 3FOKA 3G8RA 4ATLA 5F2MA 1CGXA 5LIWX 3EB2A 4O15A 3V7PA 4H1ZA 1XIIA 4GXPA 2VP8A 1UC5A 3Q45A 2X1RA 5D05A 1UWSA 1JAEA 3APGA 1EJRC 2RJHA 2A85A 2QCGA 3BTNA 3MWCA 1FH8A 3TV8A 4Y9AA 4JY9A 4G56A 4EXAA 3BLOA 1LTDA 2ZC1A 3DYPA 1PS9A 4M81A 1XSKA 1QATA 3QZ6A 2OWCA 1HJVA 1VF8A 5A8QA 4HYRA 5DT5A 3CQJA 2X0SA 3H70A 4HZMA 2XM1A 4NVTA 1KQZA 1SSDA 2NT1A 4PMYA 4YHGA 3AU2A 4QDWA 4WHBA 5G1YA 3P80A 3WYZA 2WNZA 3FAXA 2PGFA 3PPCA 4W84A 4DNMA 5HDRA 2PZNA 1MW0A 2R1NA 2D69A 3BW2A 1XD1A 3HFTA 3BQ5A 3E2RA 5HR6A 3SY8A 4H8HA 2O9OA 5FJUA 1B0IA 3WMCA 2ABBA 1UASA 3AYSA 3WDIA 3VK5A 3GR8A 3WKZA 1R9XA 2ZXDA 1XLFA 2IQDA 3G1FA 6XIMA 2Y7EA 4W5ZA 1PB0A 3W2KA 3W2NA 5BOEA 1XCWA 2J78A 1XH1A 3WQVA 5F1VA 3N6JA 3CUFA 1UKOA 1E9LA 2CLHA 4LVFA 4DF1A 2AL2A 1YHTA 4Y8FA 1NOWA 2QJHA 3FHQA 1IXNA 1ELSA 4GG9A 3LGDA 3BURA 3WLTA 1SZNA 4N0RA 3SURA 2JQXA 1E0UA 1Y5WA 3UJ2A 1XGZA 3RO8A 3DFHA 4E3TA 2YZRA 2Y5SA 1JYVA 4R9OA 1SM9A 4D6IA 4LU0A 5TD4A 3OZOA 2Y7FA 3ZS4A 3ZR4A 1V3LA 1TX0A 1KR1A 4DUXA 3PUEA 3CV6A 3BZGA 4MY8A 2WMHA 2ZUVA 1JDEA 3N2CA 1KRCC 1KTBA 3I3DA 1XIMA 4XAPA 4XG1A 1Z32X 1XV8A 4Q8VA 4ONVA 1B1YA 1GCYA 3ECQA 3OGRA 3DBNA 1WDPA 3FSTA 4WQ6A 3SM0A 4RZ4A 4MKSA 3C8NA 1R5YA 4AXKA 2A1YA 3LV5A 4UR9A 4AD2A 3AZSA 4PB5A 3CUZA 1V0MA 2W62A 2EPKX 4O0KA 5CJ5A 1HJSA 1TV3A 4R7WA 3ITTA 1NWRA 1Q7ZA 2VC7A 4LEQA 4ADSA 1JUEA 4O1FA 1RHCA 4WCJA 4QTGA 1JDDA 1YPXA 1GYMA 1GQKA 2J7EA 1C9WA 3KDOA 3Q2DA 3TSDA 3USBA 1SFSA 1MQPA 1DWAM 3HPXA 4ZFMA 1D7KA 3B4UA 2QJNA 1H50A 2ONEA 3QR1A 3L65A 3G3MA 3FK4A 4NZJA 3WJSA 3GH7A 3W7MA 3GNRA 1OINA 4YCOA 1L9WA 3BE7A 3VGEA 3SO7A 1XI3A 4GK8A 4DI9A 2ZX6A 3TNOA 5D32A 3KLLA 2OB3A 3KM8A 3LLFA 3W1NA 2ISVA 3GTXA 1M9HA 4XX6A 4U3CA 3LQLA 1HUVA 3G77A 4OUEA 3AO0A 3TA9A 5JBFA 3DHPA 4KH2A 2ZZ6A 3KFTA 3JU2A 4NJIA 2ZX9A 1UB3A 1R86A 1S1RA 3K5XA 3TYCA 3KTXA 4IWWA 4FNTA 3ZFHA 5F2IA 2DH2A 5JQ9A 2PDUA 1FHLA 1OFRA 1WXZA 3O63A 3WQGA 2W66A 1H49A 1VR6A 3QQWA 1A5KC 1VBJA 2EPOA 2VCCA 1G7UA 3HMJG 1KCLA 3Q67A 2P50A 4M24A 2XU2A 4TU1A 2CHOA 1MNSA 4QR6A 3I3BA 3S5NA 3W53A 3GZ3A 1BSLA 1P5BA 3U4AA 1TPH1 3GDBA 3PG8A 4ROQA 3WQPA 1XUUA 3V5OA 3WDRA 4JHMA 4BEUA 1PIGA 3UJFA 4NY2A 1FWDC 1OFAA 3NL3A 1M7XA 4H7CA 1Z69A 5F7UA 4J27A 3BQ6A 4GVHA 1GHSA 5I3FA 1UHVA 2HBXA 1TWDA 2E9BA 1KC7A 2A3HA 1I2PA 2WC7A 5EA9A 1WDQA 1RBOB 1OVDA 1X7FA 3CMFA 5BNKA 2WZIA 1E40A 1UKSA 1XFBA 3VIJA 4FOKA 3CZEA 4WUIA 5EBUA 1S2WA 2GVJA 4GJJA 4GLEA 1W8SA 1S2CA 2X1TA 4JKMA 3H4WA 4P8WA 4CQ9A 1CW2A 2X1UA 1KM4A 3ES7A 3PC0A 1QOPA 4D6DA 1JYNA 4GFIA 4TTGA 1U33A 1BWKA 2E1WA 2B81A 3ZSSA 2Y61A 3KL3A 1EDGA 1PYMA 2PDCA 3TQVA 3A3WA 1ICQA 5D9NA 4R33A 4K37A 1N2VA 2I7GA 1XS2A 2DZVA 4GCAA 5C2GA 4NAEB 4F0MA 3TLLA 3CIXA 4GNKB 4EF9A 2HE8A 1MEHA 1LG1A 1ZBWA 1DE5A 3NSXA 1QUMA 5A8NA 2D0HA 4TV5A 2I5IA 1SFTA 3PFRA 1H7XA 3OVQA 3TW6A 1S5VA 4CNUA 5CZKA 5HA7A 3TTOA 1MO0A 4AYSA 1B3YA 4O1EA 4O57A 2ZZ2A 1GPWA 4G2DA 4HSOA 1XX1A 4DBUA 3TMQA 4XD6A 3CUHA 3ISIX 4Q6XA 3TE9A 2GK1A 1B3XA 2F8QA 2XZ9A 1NP0A 1QNSA 4Z1BA 1PTDA 2Z24A 1W1IE 1Z8AA 3LNMA 1EJXC 4C6IA 2OQHA 1DJGA 3V5CA 1H5YA 1I2NA 5DY3A 2NXIA 3ZT7A 4B5WA 2YW3A 3Q4DA 5FCZA 1E4MM 1RQBA 1WDRA 4BHYA 3VKCA 5FF3A 4Y90A 4LCSA 5K4XA 2GYIA 3B3DA 1FWRA 3JUGA 2XSBA 3THAA 3ZXWA 2VEPA 2HVMA 4X61A 5HNTA 3KHDA 4ASTA 4JTQA 4H01A 1DXEA 5BU9A 3WQCA 2FKPA 1EEXA 4ICMA 4EAMA 3LHVA 2CNCA 3W7QA 2ABAA 1POKA 4B5NA 4EWND 4Z1DA 5FESA 1IEQA 3MT1A 3QHOA 2HK1A 2KAUC 3IARA 5DXYA 3I4EA 2HJPA 1IEXA 1PWLA 4KESA 4M29A 5I2UA 2ZICA 4QLKA 2O4MA 5FF2A 7ENLA 3VKKA 3CQKA 1YNPA 2VR5A 5XINA 3I6RA 1PYFA 2IPGA 3MB9A 3N9SA 3NWRA 1O5KA 3W7IA 1DQXA 4WSJA 3GS6A 4JCLA 3ZVHB 2VELA 4MVAA 3MDWA 4CVUA 3UGVA 2C1HA 3TOPA 1P0NA 2VMFA 3G24A 4L6OA 1XIDA 1DORA 3W9ZA 5JH1A 2LLEA 2IPJA 3ZJ8A 4UQAA 3F2CA 3DEQA 3CM4A 3XISA 3MJYA 2WSKA 3CWNA 1LF1A 4DBWA 1QI5A 4IX0A 5AN7A 4BCEA 5L9FA 3E74A 4HCDA 2XGIA 2CYGA 4XD4A 1BGAA 3PBVA 2GJNA 4OU1A 2ZIDA 3L4YA 3N29A 5IBXC 1ONXA 1ZBVA 1HQTA 1G67A 1PSCA 3VAVA 3TC3A 4HNUA 1VPYA 3RLVA 5CPNA 3WLPA 5FJTA 4R5EA 3K8MA 1MRQA 1E70M 3PPGA 3O2LA 1EOKA 3VTRA 4WY0B 1VFUA 2AL2B 1GW9A 3RDKA 1PZ2A 4ZSUA 2ALDA 2W6RA 3ENLA 3FCPA 3ZR6A 4RX0A 3IJ8A 2FIQA 5C7VA 1XPGA 4JTFA 5AC7A 3HV9A 2PA6A 4GX9A 1QI0A 4L6HA 1LOLA 4JQ3A 1PDZA 1ITXA 3H54A 4GO9A 5JMUA 4TXEA 3GB6A 1XLJA 3QPEA 5I3IA 2R9RA 1XCXA 3ZO9A 4OGZA 5AHLA 5K4ZA 2YW4A 3ARZA 3F4WA 4KWSA 3I6TA 4QS6A 2JGQA 1U2YA 1TO3A 1I2OA 1Q6CA 3GFYA 3PTKA 2ATMA 2WMJA 3PN8A 2V2DA 3S2MA 4FOJA 2J13A 3W72A 1RPKA 3PTDA 5HMSA 4FNQA 4X22A 5CC3A 3ZVIA 3U8GA 4LUTB 1LRQA 4MF4A 4XZNX 3N9RA 4HA4A 4W8LA 1O5RA 1DJQA 3TIMA 3V1PA 4L1WA 2TSYA 4DWSA 2VC9A 4DX3A 2JGYA 4IIEA 2OO6A 1AODA 1P6WA 5CSSA 5G1MA 3MI2A 4C60A 4P8XA 1DJXA 4QX4A 1F07A 4MADA 1DJWA 3C2VA 2HMCA 3MUXA 3W25A 1UP0A 4UZSA 3B8DA 3ARXA 3VCRA 1U1JA 1ADOA 1DJNA 1UIPA 3E0LA 4S3EA 4L65A 4F48A 1EGMA 1TWWA 2G0WA 1E55A 3PWGA 4UTWC 4QIUA 4GZIA 2DSWA 3LTPA 1LCOA 5A6MA 1RJPA 3IUDA 2Y24A 1AQMA 1JPMA 2P0OA 2D24A 1B9BA 1E6NA 1UA3A 4JS3A 3P6LA 4B3LA 4F0LA 6REQB 1J0HA 1AH0A 4Q4MA 3WUFA 1W9PA 1OZQA 3B9EA 3HV8A 4IHCA 3T2PA 4H41A 4C7GA 1UJPA 1KV8A 2QCDB 3RPDA 4JTKA 2PRLA 3WH9A 1FWNA 2ZUTA 1EJTC 1CLVA 3TC7A 4YTUA 4ZMGA 4BF7A 2CKSA 1M41A 1V7YA 3IVUA 2V0TA 2QCLA 4PEKA 2WK2A 3U7BA 2XVGA 1ME8A 3F7JA 3HQOA 3NDYA 3W76A 4PUMA 3KVKA 2GGGA 1TVPA 3WL1A 3VOFA 1KTNA 5FA5A 4DYKA 2CZFA 3VDAA 4HNTA 2AQWA 3SQLA 5HBFA 2PDNA 3USZA 1SGJA 5FKYA 5LIKX 4PL2A 3L7RA 4AY7A 3GTFA 4A8IA 1RBAA 2RFGA 3PSVA 4GIRA 3H8AA 4REQB 3OPSA 4DAIA 3GXTA 3W02A 3G3DA 4UOJA 3WLSA 1XBZA 1UBSA 2XTKA 4Q4SA 1FUYA 5EMUA 3B8UA 5I5RA 4AIEA 5M2FX 4IPIA 3MMWA 1H1ZA 4DM2A 3HU7A 4IFOA 4LYKA 3VOGA 2D23A 3INPA 3BAIA 3UXDA 1H41A 4XO6A 3HG4A 2G3NA 3ITGA 1RCXB 5GJPA 3DHFA 1H63A 3QLLA 3CAVA 3VC6A 1MDLA 2W61A 1I6NA 5BYWA 2BG5A 3PZNA 2UY2A 4TVDA 1PDYA 2GZXA 4G7EA 2GGHA 3W85A 1POJA 2Z7GA 1UR2A 5D9PA 2WC4A 1VENA 4GY0A 1DIEA 3R6IA 2JIEA 3ZZ1A 1JPDX 4F0KA 3NXFA 1XPYA 3W7GA 1GEQA 2P3EA 5DCBA 3FVMA 1Y5VA 3LSCA 4GI6A 3SZ8A 1PV8A 4IMDA 2C91A 1SMAA 1XLLA 2PSNA 3U2EA 3WJXA 1OEPA 4RZBA 2PCEA 3IGSA 2ZRWA 5B80A 4MLJA 5BRBA 1E0WA 3NQ7A 4M6QA 5JUVA 4PE8A 1EC7A 2NUXA 4CGTA 2Z2UA 3HJEA 3VNDA 2X0YA 3EWCA 3KOXA 4FOUA 4W8AA 1WYIA 4NP7A 3G22A 3MZ2A 1KD0A 1P0EA 1XYFA 1EX5A 3SCRA 3S1GA 4DWSC 1VAHA 4QROA 6A3HA 2BVTA 3EZ4A 2YIHA 4E3VA 1TB3A 4NNAA 2WJFA 4BK9A 2FHFA 3NYDA 5I3JA 3SGUA 2Z1VA 4RLIA 3MSYA 1OCJA 1VRDA 3TEVA 1XGEA 1A3WA 3A21A 1LP6A 2BV9A 2HBVA 4GQRA 3FLUA 2OR2A 3SIMA 4JDBA 1AD4A 4EPBC 2F2HA 4DBEA 3V36A 1PJ9A 3FV9A 3VVGA 3SCTA 3TONA 5CPTA 3BZJA 4J2MA 4WSHA 3OLGA 2FZNA 2Y7DA 3H22A 2I57A 1V0KA 3L2IA 3UQNA 2EKGA 1RK5A 3C3UA 4WR3A 2VFHA 2A6LA 2O0TA 4PFHA 4YPJA 2GJPA 1I60A 4MKNA 1JYXA 9XIAA 3CK5A 1CNVA 4PR4A 2NX3A 4M56A 1XM3A 3QJAA 4C6DA 2V2HA 4I7UA 1GJUA 2E09A 4JTGA 1Q6RA 4ICNA 1B30A 3UZXA 1ISXA 2FZDA 3M5YA 4PC8A 4K7YA 2INZA 3IVTA 1TSIA 2W67A 4I9MA 1BKSA 3AS2A 2FHBA 2DSKA 1EB3A 2G3MA 4Z2KA 1WAWA 4ZXLA 1YDYA 5GNXA 2VGFA 1ECQA 1R3VA 3E9AA 4FK9A 2NQ5A 4UIOA 3FYYA 2B0MA 4LNYA 1LZOA 3HGOA 1Q6DA 4B3KA 1MZRA 2AOSA 3PS7A 3GZAA 4J3UA 5A6TC 4A3UA 2PF8A 5XIAA 2QCEA 3ZVHA 1EQCA 3RRAA 4FSAA 1AFSA 1U1UA 3GW0A 1LQAA 1D3CA 4NIRA 3MVIA 2C8NA 2RDWA 2E6DA 4UQ9A 2V82A 2V30A 1X39A 4HJFA 1U1HA 4AZ6A 2E6AA 3OLEA 2Q8XA 3N12A 1OIMA 5GNYA 2O55A 3UYIA 3CXOA 3WDPP 2PTZA 3P0XA 4ZTYA 1CCWB 1XYAA 5M03A 3FXYA 2PCQA 2ZX5A 2WVVB 4W9TA 2F7FA 1V02E 2VNCA 2ZCGA 3QZEA 3WBWA 4PMVA 1QT1A 2VZVA 2ZADA 2XSAA 3QC0A 4LRSA 4IPPA 2OCZA 1XKYA 4KCVA 3SSJA 3R8RA 3NOYA 4WKAA 5FEXA 1L8NA 4CD8A 2WBGA 4I9TA 3OBEA 4NJJA 3TYAA 1JD9A 4DELA 3GTHA 1PIFA 2FDSA 3B9AA 4NU7A 3O8AA 4WKFA 1HGYA 2G50A 1L6WA 5TQLA 2W4XA 1AH3A 1M04A 1XP3A 1BWVA 4M19A 2VWTA 1TREA 5LNUA 1KGXA 3UWYA 2CETA 4EXBA 1IEVA 1SPQA 1XLDA 1FFQA 2P3ZA 3CAKA 5AKQA 1QPOA 1XH2A 2V3DA 2R82A 3CT2A 3WEZA 3NQ6A 4BWLA 2WANA 4HB7A 4I6KA 3H6OA 3HFYA 4GI9A 2DVTA 7TIMA 4XO7A 4B90A 2FGZA 1PBGA 2DP3A 4Q6JA 3TJ4A 1IZKA 2QJMA 3VZZA 4I5UA 1A3XA 3M5XA 5C6MA 1RY8A 1TMQA 2CZVA 2NWRA 1JZ2A 2REQA 3NTYA 1CIUA 1O1ZA 1DPMA 3NQCA 2ZRXA 3EXTA 3BLIA 3P2VA 4IH3A 1KW1A 3IANA 1XQKA 2PI6A 1JNEA 4HHHA 4X2PA 3BCJA 1V3HA 1Q66A 5T91A 3H26A 4Q7IA 2DSVA 1UQYA 1WO2A 2YDSA 1LQ0A 5DXXA 1E0VA 3EX3A 2H8XA 1YPIA 4L4MA 2YPIA 2FZ8A 4L80A 1AJ2A 3O0KA 3DI0A 2Z1WA 3LN3A 3NQGA 3FSUA 4KWVA 3NM1A 2OZ0A 2AQOA 1IIGA 2QCCA 2WKLA 3QQ1A 3TLQA 3NVTA 2EG6A 1XLCA 1ISVA 1SU5A 1YTKA 3K1GA 1R3QA 1WCGA 2A3AA 3POHA 5E0CA 3CNYA 2ZX8A 5E0KA 1Q6QA 3G18A 4L1GA 3NDZA 2OZ8A 5CPSA 3LU2A 2JKPA 3IGXA 1I1XA 3E2QA 3FNDA 5HJXA 5GJMA 3NAVA 4J9JA 4MFEA 4OOUA 3EB3A 2XISA 4ATWA 5ABFA 1JVNA 1KXVA 1ZUAX 2YX0A 1TG7A 4C6EA 2QF7A 3OBAA 2VGGA 5D2YA 3MCOA 1PIIA 2PDHA 3I3EA 2VZTA 3DYMA 3LEPA 4GH3A 4LOCA 1KFBA 3HA1A 3PJWA 4J7RA 3II1A 3FJ4A 2Y2WA 3K1DA 3O9NA 1TIMA 3SY5A 5BXTA 4WDWA 2GL5A 1J0KA 1BXCA 4HIBA 1L6SA 3LRKA 1NDWA 3DESA 1UZ1A 4PUEA 1H62A 3IGHX 3OBKA 1FY6A 3HURA 3OVPA 2WYSA 1KXTA 2DU2A 2ZE0A 4MB5A 4O8AA 1C9DA 3A12A 4REQA 2CZEA 3QGKC 4HD5A 1NWTA 1DQWA 1QXLA 4K3ZA 2QCNA 5KMYA 1JFHA 1TA3A 1D8CA 5C71A 2X2GA 4Z2IA 4GJIA 2E5DA 4G7EB 4WVXA 3BG5A 3W74A 5FF7A 3RPMA 1PL9A 3ERPA 4Z1CA 1P7TA 3KX6A 4K39A 3UZYA 1WAUA 3VIGA 1NDZA 3S1XA 5J5RA 3LLXA 4FXFA 3GR7A 4XD3A 1GJPA 2JALA 3IIVA 4H9ZA 1LUCB 1UH2A 2E5BA 2PDKA 3MU7A 4JYFA 4Z2HA 3R94A 2X05A 2WMIB 2ZZ4A 3THUA 4IL2A 4S3GA 3OQ8A 3TK7A 3EWXA 5D38A 3DERA 3QSTA 3W7NA 4H9XA 4G9PA 4RNJA 4GC3A 3DC0A 4S23A 4V1YA 1F7BA 4JYEA 3UYCA 3P93A 4XAYA 4FEZA 4UTWA 1TVLA 1L0PA 2ZE3A 3VGGA 1X1OA 1GOOA 4BI5A 3EOLA 2CPUA 3S6TA 3HM7A 2YXOA 4DXVA 2B7NA 1DHPA 2WPBA 3BSMA 3NL2A 3TR2A 1W5MA 4HZ7A 3SCUA 3PNZA 3UU0A 2ACRA 3N2XA 1A4MA 5LIXX 1K7EA 1D8WA 3PZIA 4A6GA 2YSWA 1QO2A 2IXVA 5BXRA 4ZO9A 4S2BA 3HQ1A 3STPA 1QU4A 4YWIA 5TNVA 4BFAA 3RR4A 3OZMA 3S83A 1OWQA 3GFXA 3VMOA 2IS7A 4Q8OA 5FF0A 1V6TA 1ZALA 2PZ0A 3TDFA 4ZOEA 5IDIA 5A6SA 1Q6GA 2VQUA 4GD0A 5A5WA 3LX9A 1LROA 4XBJA 1WKFA 3E2SA 3AMLA 3CWOX 2VHLA 3S1VA 4M7TA 4PMUA 4EF8A 3ANVA 3IUHA 3GVGA 3VOJA 1BAGA 4V27A 3WY1A 2HPMA 4PMNA 3EB4A 2WXDM 3QR0A 3QH2A 3F5LA 3NCOA 1P0KA 3T0CA 2BHYA 3M9YA 4L9ZA 3SDOA 3RMJA 3WNPA 3EYPA 4KF1A 3OLDA 4UQBA 4PUKA 3W1UA 4YVVA 1AVAA 2J47A 2QIWA 1IHIA 3VIIA 1PCKA 3RHGA 2DZSA 8CGTA 3FDKA 4DLFA 2YGYA 5EMLA 1PKNA 3ZWSA 4HYVA 1K7XA 1KKOA 1S2VA 3S42A 3W87A 5H8MA 3T8QA 3HGSA 1ME9A 3NURA 4DWSD 4M5PA 1EJUC 3U4FA 1EPXA 3FGCA 1JDAA 3AICA 4HK7A 4BQ2A 1ITUA 4UQDA 5I06A 1GVQA 2FB3A 1ZAJA 1B4EA 3BLEA 1C92A 2YLAA 2HVOA 2HPIA 4NNCA 1B90A 2ACSA 5C5YA 3L2LA 3R10A 4NL1A 3L4ZA 2VQTA 3GX9A 1PX8A 5AYZA 3G1YA 4PFMA 4IP4A 4UMAA 4ZO6A 1ITQA 2A21A 4A29A 5TBOA 1YPFA 2PLMA 4TUFA 3GNPA 4GKTA 4S3DA 5BXPA 5BRPA 3L2MA 4LUIA 4N4PA 3L5LA 4XUGA 3BPWA 3VIPA 5D09A 2VGIA 3VFLA 3AIVA 2ZKMX 3GH4A 2QDGA 4UC5A 4D71A 2D73A 4HHPA 4F2TA 1ZCOA 3WQ6A 1R3RA 5K9CA 3EX4A 4MWAB 2ZVIA 1E73M 3OYXA 2JBMA 4JQAA 4E6MA 1KLZA 3UEQA 1OFPA 1A5BA 1V8EA 1GVRA 4LGXA 3WF4A 2ZZ7A 4U5KA 4I5RA 1FKWA 1GPFA 3VCCA 3VKBA 4CEXC 4H3DA 1ZU8A 2UY3A 3LA4A 2MUCA 1TV2A 5AHEA 1TZ7A 4LBSA 1BWLA 1ZJIA 3IRSA 1G9HA 2VUNA 3VU2A 5FIPA 4DXKA 2Y8UA 2DQXA 4ICCX 3HPZA 2WSQA 2VVNA 4IP7A 4RCXA 5EPDA 1JYWA 3L4XA 3STCA 4Q8QA 2DJXA 4MNLA 4JTLA 4HA1A 3S1WA 2R14A 2QR6A 3S2LA 4GWEA 3S5OA 3GDKA 4XD5A 3T4WA 4MB4A 4GRSA 1RK6A 3GQYA 3CH9A 4ATDA 2X42A 3KUMA 2O7SA 2G5WA 2X41A 5LIYX 2DZBA 1EP3A 1JI1A 3VX1A 2Z6IA 3IAPA 4GO8A 2DZPA 4X2RA 2L5HA 1OD8A 4DUOA 7XIMA 3WG6A 4JL2A 1KM1A 3K4DA 4ZGYA 1XLMA 1LYXA 2Q3RA 4D8ZA 1R9YA 1C8QA 3GBEA 1JPIA 1CEOA 3QYQA 4PMQA 1TZ9A 5FL1A 4NI3A 1LL6A 4O0QA 2EGZA 4GI8A 4EKJA 3RGTA 2PEVA 3AXXA 2DZUA 4JEQA 2NQLA 2ZOXA 4YNGA 4HK6A 1Q4NX 2E40A 3W1PA 1DJYA 4C7FA 2WWCA 4O11A 2YOCA 4RJEA 3SQSA 3VD4A 1NQKA 4BS0A 2PU1A 2BHUA 4GHRA 4E2OA 4B16A 3SGZA 2OQLA 1EJ7L 3M5ZA 2W92A 4QJ1A 4B9YA 3BC9A 3SUWA 2XVNA 3LTYA 4A35A 5K7JA 1FWHC 2VX5A 3L4VA 3CIVA 2E9MA 2WM0A 2XH0A 5I09A 4MKVA 3V75A 1YADA 4QLJA 3WBEA 4Z1AA 1GOIA 1W5PA 3VE9A 5F1UA 4IXHA 4Z1YA 4YTSA 5BCAA 1JXJA 4DPPA 4C6JA 4Y9OA 3MQTA 1YNYA 2QUTA 2I9UA 3LGGA 1VEMA 4N4QA 4Z2GA 4O1AA 3UR5A 4D8LA 1JF6A 4Q3MA 1J6PA 2CXGA 4QG9A 3L0KA 4DI8A 3GRIA 5BU6A 4JL1A 1GOKA 1ZLPA 4Q32A 4Z2JA 5D8WA 3TC6A 1IR2A 1ZBKA 4DZAA 3VNYA 3MDUA 3C2FA 1TPDA 3LM7A 5I7GA 6ENLA 2CLFA 4V1XA 4A3HA 3VKDA 4NQ1A 3N15A 4PRTA 1LRTA 5EMJA 3NJ3A 1K8YA 4QCFA 1TWSA 1EC8A 4NI8A 1ONEA 2DUZA 5DMNA 3DFTA 1IWBA 2VFGA 4PN2A 2YL8A 1XH0A 5LNVA 5FAJA 3W1LA 1RAKA 3NZ1A 3AIWA 2D3NA 2VZOA 3MPGA 3B03A 4YMZA 4RPPA 1I75A 3TZNA 5EMYA 2ZRYA 4BY3A 1XW8A 2YBTA 2YDAA 4IG2A 3MYPA 3THDA 2ZRVA 1W5QA 4M6VA 3N19B 3P60A 1XXXA 3N2MA 2DT2A 3F4DA 5D2TA 3OG3A 3G5EA 3QF0A 1TMHA 4O12A 5CKSA 1A0DA 2AQVA 2R1PA 2GSHA 1K7FA 2OODA 5CPLA 4MJ4A 3KBVA 3QY6A 3T09A 7PTDA 1EHNA 2EHHA 1UQZA 4J35A 2J8FA 5LSMA 1HKIA 4KGJA 3EOSA 1KFCA 3EDEA 3IWPA 1W3TA 2FTYA 3EKGA 3KTSA 5DO8A 2YA1A 2P10A 3IRDA 1JUBA 1TPVA 4ROPA 3L66A 4B15A 4AY8A 4OHQA 3ITVA 3BOFA 4GQBA 2HK0A 1DWIM 4NAFB 1BRLB 3KLKA 3PG9A 5AFDA 1MUWA 4A4AA 3LRMA 2BOFX 4QJ3B 4AD1A 4KEVA 3RU8X 3T2QA 2ZVRA 4IMEA 4K38A 4IICA 1JD7A 3LY0A 1VCGA 5C7HA 1NIUA 1YW1A 1GVFA 2J9YA 3CHEA 1BEUA 2PWDA 3URNA 1LWHA 3FJLA 1M3UA 4JBRA 4XK2A 4O50A 1TTQA 3DG3A 3H2OA 1GKRA 4Q8WA 2XUCA 1XLHA 2WNQA 2ZFAA 1DKWA 3MMUA 3L4TA 1OG0A 3UFYA 4M6PA 1HJXA 4UTLA 3P5YA 1UWAA 2BSLA 5J5DA 4MJZA 1E43A 6ALDA 1Q6EA 2V5JA 1OX4B 1NTHA 1AK5A 2G41A 2J27A 2WVSA 3KOWA 4X9YA 3DN5A 5EFDA 4TV6A 3BUVA 3T8LA 1E4LA 3VNIA 1HT6A 8XIMA 5LA0A 3P8IA 1MQQA 3EMQA 4PYSA 4MAVA 1S1PA 2GVEA 1FKXA 2W5FA 3QOKA 2GFTA 4DWSB 1J2BA 3EX6A 4WEVX 3TAKA 2ISFA 5DRCA 4C1NB 3ELFA 1M01A 1RSCA 2PFHA 4D1JA 4CQAA 3SEPA 3EEGA 4YVXA 3AMCA 4GE8A 2I17A 1T40A 4DHGA 4YS1A 3W7DA 4C6KA 1I0DA 4IP5A 3MW7A 1CPUA 3SSZA 2PTYA 4PBEA 3MKVA 3IJQA 1V93A 4KFPA 1O94A 4H9MA 5LKYA 1A4LA 1GQIA 2PB1A 3NEVA 3BLLA 3TA6A 4GUGA 4DJEA 1EYWA 1RLCL 1W17A 3E3HA 2G4FA 2ZWYA 4ZL1A 2PF0A 1IWAA 2G3FA 3OU8A 2E6FA 2EPMX 1KRBC 3B8IA 5CG7A 1K6AA 3OZYA 3AIRA 3R0KA 1FA2A 4U2YA 1KCZA 3A47A 3VUSA 4O0ZA 1SUXA 5AHIA 2J9ZA 3KRBA 1OK4A 4FALA 1R3YA 1FWWA 1RH9A 3T0BA 1D3HA 2Y5JA 4C6MA 3BG9A 2QUNA 1FOBA 3PJTA 2YLLA 4GACA 2FTWA 1F3WA 2V81A 1XICA 1QW7A 3CL8A 5LGZA 3U48A 1GT8A 4JIIX 2ZRUA 1J0IA 3AIBA 1GUVA 2OFJA 3LHYA 3H12A 3TROA 3GU1A 5AOUA 4YWSA 2QQ6A 1BD0A 1MNZA 2GWNA 1MW1A 4Q4PA 2XFFA 3LCGA 3DHDA 1K9FA 5IOBA 5L6UA 4DUWA 3H53A 1LWJA 3EWBX 4AZ5A 5ABGA 1FWGC 5HWMA 1UCWA 4E8CA 3ABSA 2JKAA 1R0MA 4NJHA 3I7RA 5AYYA 4Q33A 3BW3A 1P48A 1IT7A 1E71M 5IFTA 2J8TA 2NQHA 2PBOA 3WIJA 4AEOA 4AU0A 1UPPA 2PWEA 2XZ7A 1RD6A 5HINA 3WN6A 4FF5A 2YYTA 3GVWA 2MNRA 3N1AA 4QCEA 5D37A 3FA3A 4IFKA 4XZBA 1U5HA 4ALDA 2CIPA 1QI2A 2D2JA 1XIGA 3GK0A 4N7QA 5DLCA 2YXXA 2QS8A 4MJ2A 4MUPA 3TQ0A 3T78A 5J04A 4BEQA 3QV6A 4OKDA 2CHRA 1G0CA 2NV9A 3W1MA 4TTUA 1XLIA 1VIWA 5C70A 3EKZA 4R27A 1C90A 4LS2A 2PDGA 2G95A 3GG7A 2YDRA 3F2BA 4FLRA 4QS5A 1TA3B 3GHSA 3FYOA 2DIEA 2BTMA 4C65A 2I1OA 1BVNP 4RE4A 4LV4A 2GJRA 3GVVA 2WHJA 3LD5A 5ECVA 2B7PA 2PTDA 4KEMA 4O1DA 5CPMA 1UP3A 1J5SA 3S4TA 3W27A 1JZ4A 3TCEA 4C6NA 6XIAA 1OC5A 3LHWA 2R8WA 3MHGA 5HQEA 3GC2A 4ZE4A 1EUAA 3TH6A 2ON3A 2V6AA 4X60A 2PP3A 4XKYB 3OA5A 1Q6LA 4RNHA 1F73A 2O4QA 7REQA 2ZC8A 2YXGA 1X96A 4US6A 2QUVA 5A6KA 2QXWA 4W5UA 2FZMA 5BW6A 2EO7A 2VDIA 1CGWA 1H0IA 4ZQMA 4NNBA 4GC4A 4AMAA 1HW6A 4MTVA 2JEQA 3HN3A 5FJRA 1RALA 3TJXA 1KRAC 2PP0A 2WSPA 2X1IA 4H00A 3PFMA 3N04A 1NJJA 1XBVA 2WVUA 1J9YA 3YPIA 4KETA 4GQQA 4ZEPA 2AKZA 3T08A 3WX7A 3N34A 4LC8A 4X9SA 3QQ0A 5A3HA 1UC4A 4RV3A 4M8UA 2BGSA 3FA4A 3MUIA 4D72A 4TX9A 4DN1A 4XV0A 3STFA 2ZDRA 1A5LC 3UXIA 4AH7A 1A53A 2QPSA 4JY8A 3Q65A 4C91A 4PRRA 4NILA 1Y0EA 3P67A 1OD0A 2ISWA 3OGVA 3NG3A 4ACYA 1RUSA 1YE6A 4NZFA 2P5NA 2HTMA 1K77A 4MM1A 1F5ZA 1OC6A 4D6EA 5CZTA 2Z29A 1V6XA 2HCVA 3KL0A 1E3XA 1US3A 2VFIA 3EOEA 3WH5A 3MMDA 1OF6A 4ZFCA 3R12A 3WCZA 3UZWA 2QDHA 3DFPA 4ENLA 2QNEA 2IKGA 4HNOA 4CNOA 3DU0A 3W2UA 3C5QA 1H7WA 1AW1A 4PMJA 2Z27A 2WZEA 3MUAA 3E02A 3AS3A 4Q4QA 3N6HA 3R8GA 3BDKA 4N02A 1JZ8A 3JS3A 4QDMA 2DZTA 2B7QA 3N17A 4K8EA 4F2BA 1F3TA 5H1WA 2VD8A 1FXPA 3E0WA 3M43A 1V0NA 1OGBA 3A6OA 1UKTA 4GY1A 1W9BM 1LLOA 3JW7A 3QW3A 2POTA 2WB5A 1PKLA 3B05A 2BGNE 1WNOA 2XIMA 2QHAA 3V18A 3CZ8A 4FLQA 3U2CA 3O06A 4JGDA 1BXNA 3B8VA 2E9LA 3QC3A 1Q6OA 1BYAA 4GGHA 4LY4A 5AB3A 4G1KA 1TWZA 4MWAE 3WH7A 1VFOA 5CSRA 2ZUNA 1QPQA 2RH9A 1SW0A 1RY0A 3UERA 1EP2A 2E5CA 4UTKA 4UQEA 1J79A 1JPHA 3W28A 3VOHA 4W7VA 3GVQA 2GGJA 4F79A 4ZO7A 2VURA 2XH2A 1ZY9A 1EO7A 2I14A 4HHMA 1HZYA 4EOUA 4LSBA 1PZ1A 1S38A 3F4VA 4L9XA 3RITA 1X1ZA 4AZCB 5HQMA 4M0XA 3AUJA 3A23A 4JIHA 2G8ZA 2CWXA 2C0HA 1GQLA 1KXHA 1W31A 3SQMA 5I3DA 3KE0A 5HPCA 1TPWA 3G1SA 2Q02A 3MANA 3C2YA 4J5NA 1N8IA 4CUCA 3M0ZA 4N6FA 3U9IA 1Z3NA 4NX5A 4TVUA 1FWBC 1R6WA 2BOGX 1WBHA 3P3BA 4HU0A 3Q94A 1L6YA 3HBLA 2J7GA 2PMQA 5LXEA 2CFFA 1JDFA 3AXKA 3RN6A 2YB1A 1E9ZB 3AOFA 4PMDA 1NELA 3FVDA 5LNWA 5CC7A 4AW7A 1CENA 4R3UA 4K68A 1Z89A 2X30A 1EUNA 4XBSA 1TIWA 3DC8A 1I0BA 2VRKA 2YA2A 3ATZA 3VD5A 3W7OA 4AC1X 4QJ4B 3ARUA 1IV8A 4XTIA 1VH7A 2VR2A 1NH6A 2FDMA 3CT7A 6PTDA 3IV3A 2V5BA 1EFZA 3ICJA 4PEEA 4W88A 1QPKA 1XYCA 4DJFC 2FJKA 4GGBA 5ABTA 2VEFA 4IIHA 3WD2A 4L56A 1GZGA 4JR5A 1U30A 4L4LA 4QSHA 4DPQA 4K6AA 4ZCWA 3G1DA 3H7UA 1KFLA 5CC6A 2WKJA 4LAUA 3VDCA 1ITCA 1SZEA 4H9VA 3VGDA 3REQA 3WLJA 3OODA 1DWFM 3H55A 5DN1A 3PULA 3B0VC 1AJ0A 3NYZA 3EOUA 4OUIA 2ESCA 2PDBA 3M46A 4FMVA 4U10A 1U5JA 5I00A 1WOBA 1KFWA 2A3CA 1V6YA 4I3GA 3IJDA 2XGBA 1MZHA 1IE7C 1UZDA 3UXKA 2PD9A 4GVGA 3N9KA 3XIMA 4MDOA 4MZ1A 4GZEA 1W5OA 3M7WA 4AD0A 3O05A 2OU4A 1X8FA 4PB3A 4AD4A 4NHVA 3NQDA 1L6GA 4GI4A 4K8HA 5CJNA 4FA3A 3VMNA 1OIFA 1SYTA 4L7ZA 3WF0A 5BXSA 2J25A 1M1BA 3LZ3A 3KP1A 4AZ7A 5D03A 1R2TA 5PTDA 3W1QA 1YRRA 4XSMA 1EC9A 3G1VA 3CYJA 1GTHA 3WF2A 3PNUA 1EX1A 4O19A 2VM8A 2BNJA 3CEUA 3TYBA 3WL0A 4BR1A 3BMVA 3CQ0A 4AIUA 2VUYA 2X1SA 4X3ZA 2J7HA 1K8XA 3G8EA 2PC8A 3WF1A 3PVFA 1KFEA 4JFUA 2H9AA 2Q71A 3BLPX 1UMLA 4O18A 2DZAA 1MXSA 1YBQB 1DYSA 3UJRA 3SAZA 5A2AA 4PMRA 1A5AA 4IQLA 4P8VA 2DT0A 4NZCA 2VX6A 1KV5A 3CHDA 5HOSA 1EIXA 2CLPA 1V08A 4J3VA 1R85A 3M0YA 3GAKA 3LCLA 1FFRA 4N2YA 3SN4A 5HNNA 1KFKA 5C54A 1H2JA 3DZ1A 5K9DA 3EX1A 4AISA 2WBKA 1OC7A 2ZXAA 4DY1A 3NZRA 4QAWA 3N2OA 2WJDA 3KXQA 4QXIA 3RRXA 3WEOA 4B5SA 5CGMA 1S5TA 4RUBA 5CLWA 1LLZA 4PTVA 4D6GA 1UR9A 1YIXA 4Q8TA 8RUCA 1SFLA 4AVFA 1JGIA 4H19A 1MW3A 3N4FA 1QNVA 1KCXA 3WO8A 2WMGA 5AYBA 4WZHA 1XFCA 4PCSA 4LW7A 1D7FA 3OO2A 1JCNA 2E3ZA 4AEEA 2D0FA 4HPXA 5TF0A 3LB0A 1XIJA 3UG4A 3SR7A 1OM0A 3NSMA 4XVDA 4XKMA 4LC6A 1CLXA 5H6HA 3IEBA 4GXMA 1YX1A 1C8VA 4K36A 4MY1A 2OT0A 5I78A 2OSYA 2PDYA 3M7SA 2HXUA 1M7OA 3UWWA 1ZJAA 1QWKA 2BX7A 4LVAA 4H9TA 4JX5A 3QY7A 1V6VA 2W63A 3L21A 2QJGA 3B9NA 1UP2A 2H8ZA 3HZ3A 2PRHA 3KEHA 2XN2A 1T99A 3N3MA 3RUBL 4LVBA 3B4YA 2ZTJA 1H7RA 2J66A 2YL6A 4YTQA 1CXLA 3CTLA 4U28A 3BLDA 1YKWA 2Z1SA 3POCA 3K8KA 4IGMA 3RF9A 3L67A 5M3WA 5EL1A 5DQPA 5ABHA 2HWGA 4HNVA 3S6OA 4NAFA 4WJEA 4PGLA 2VFDA 3AHXA 2BASA 2CERA 2V67A 3GC4A 1P7TB 4C6FA 4YTRA 1SVDA 2GQ8A 1VFHA 4H2HA 3W71A 1TUFA 4F0SA 4GKLA 3GTIA 3AWOA 4MB1A 4KQNA 2X16A 5AZ0A 2DGAA 2ODOA 4H9UA 3TN3A 2ZZ5A 2D20A 1UD4A 1WZAA 3F4CA 2XJ7A 1R46A 4ZB5A 5DBUA 3WEMA 2CWNA 3ARSA 1GQNA 4Y9PA 1HJWA 3W00A 2X2YA 3DFYA 1LOQA 3QY8A 1OB0A 4MYXA 4DLMA 1RVKA 4HYWA 2Y7GA 3CZJA 5TAOA 4IMCA 1Q7MA 3VI2A 3QGVA 4FR6A 1CXFA 2QYGA 3MV11 3LSBA 2PURA 2NUWA 2Y88A 3FA5A 3RCNA 4ILSA 1US2A 3WDQA 1LL7A 4PL1A 4B4FA 4QNWA 2INFA 4QE5A 1H4PA 3T0DA 4WLCA 5FOOA 5CEWA 4PCNA 2GK1B 1FP8A 1GNXA 3NQVA 2BB0A 1E0TA 1UOZA 1BQCA 1WDSA 3TYDA 1PPIA 5D8ZA 3I7SA 2PPGA 1SW3A 4D6HA 3FDGA 5E9AA 4IIFA 3WK1A 1Q45A 3CBWA 1BTMA 4U2ZA 4JFWA 3WQOA 4AG0A 1UZ4A 4DRSA 4JPGA 5KEZA 4FLOA 5LIUX 1BLIA 1TE6A 2W3ZA 2F84A 5EFFA 3KWXA 3KDNA 1HX0A 2DSUA 4NRRA 1TPB1 3H4GA 2OEJA 4UUIA 3TU9A 3B06A 3LZ5A 4TQTA 2A79A 2A0NA 1HXJA 4U4MA 1HVQA 4XSLA 1GEHA 3UA3A 1AQ0A 1F74A 1TJ2A 1Z42A 2TRSA 3DOPA 3E5PA 4MIMA 4Q8UA 3LMZA 3TTSA 2CZDA 1TJRA 3O6YX 1J4EA 3KZSA 3W75A 3CMGA 4KIEA 2WW5A 3QEZA 3LM3A 2GQ3A 3WLMA 1H0GA 5MF5A 1FP9A 2QAPA 1DJZA 2OVLA 3EMZA 2Y4SA 3WSUA 4QJ5B 1X1NA 3C6CA 5AYXA 1LLWA 3AALA 1W32A 3FXGA 2QVHA 5CJMA 3U5YA 1ZS2A 1LWIA 4AD5A 1K4HA 3TCSA 3W2MA 1QMLA 4PB4A 1K6WA 1LM1A 3NM3A 1T0OA 2F9RA 1DJHA 4F0RA 3S5YA 5G2WA 2X09A 1YXYA 4XAGA 4AF0B 3P84A 3DBPA 3KRUA 1THFD 1NOFA 2D2HA 1VFFA 1VBRA 3QN3A 4ZB0A 4M51A 1JQVA 2PRMA 2XWDA 3ES8A 1Y5XA 3T44A 2XPKA 3IACA 1TFVA 4S2CA 3FFSA 1GG1A 5CBBA 2PDPA 1HO4A 4AZHA 4YN5A 2Z2AA 5A6JA 3LRLA 2I56A 1TV7A 3TMLA 3ZLHA 4Q7BA 1RQHA 1KR0A 2F6KA 1EXBA 2PGEA 3CPGA 1FDZA 3A4JA 3RLUA 2VTFA 1LQ2A 2G4JA 4LCQA 4GUFA 5I77A 3EWUA 5IM51 4HMNA 4YYFA 1XYMA 3WD0A 1GVSA 2RGMA 3NQEA 1PZ0A 1YDNA 1XRTA 2XN1A 1K9EA 3LERA 2ZUMA 5LNRA 1FWTA 2HS6A 2CLMA 1QBAA 3R0UA 3SJNA 4ZODA 3WQ4A 5XIMA 4LV9A 1A5SA 4PSRA 3URBA 2YA0A 4RDWA 3QVQA 2Y6ZA 2WOQA 3ABZA 4IPNB 4O4WA 1Q4WA 2CESA 4HU3A 5HWJA 1T7LA 4G1NA 3WBXA 3ARQA 3FKRA 2QCDA 5LGXA 4CN4A 1VYPX 3WLRA 1OABA 2PTXA 4C6OA 2B31A 3MSGA 4IZGA 3CL7A 3MKCA 4URIA 1LOSA 1XG3A 1HF6A 2RUSA 1GHRA 1GK8A 1AD1A 1UKPA 3GVRA 4W86A 1P6CA 3KRZA 1TR1A 1NY1A 2DW7A 1EDTA 4LWWA 4YVPA 1TCMA 2GUYA 1XG4A 1BF6A 1LORA 1RJQA 1X8CA 3BAKA 4ZSTA 3PPHA 4B2DD 4BWLC 1TRDA 3OW1A 3ZJ6A 3O7UA 3TW9A 1RZMA 2QF8A 4PTMA 1KM6A 4DBDA 2FZBA 1BG9A 2J88A 1BGGA 4UNIA 4B92A 1J0ZA 1PZ3A 1XYBA 1VJZA 3WQ8A 1TV8A 3ABQA 2WMKA 4UQCA 4Y2WA 4C6CA 2NW0A 2VEMA 7A3HA 4XIMA 1F8IA 2XVLA 2E4TA 1B31A 2G3JA 4X0VA 4Q8MA 4UBPC 3S2CA 2DV0A 1DL3A 4AZCA 1JF5A 1YYAA 3PUDA 3L12A 1K02A 3GG8A 3GR4A 3G0XA 1B4KA 3MA8A 2EJAA 3NO5A 5KINA 1W91A 5HAOA 1A5OC 1WE5A 4HOZA 2WLZA 1VIZA 2QCFA 4I9AA 3H24A 1ZRQA 2PD5A 3QTGA 4JYDA 1PKYA 1IQ8A 5EKYA 3A24A 5AHNA 3MKKA 3BARA 1K1DA 4LRTA 1DP0A 4UFHA 2HQAA 2Y5EA 4LYQA 1NVMA 1XF0A 2CW6A 4A3QA 3A9BA 3PTQA 5IBXA 2HNHA 4LALA 3VABA 2GSJA 3VD7A 4QFUA 5CBIA 5K9XA 1DWJM 1CDGA 3MSDA 1SFJA 1FHUA 3ABRA 3W73A 1IZJA 3E0IA 3TSMA 4IMGA 4AHOA 1UD6A 4OIFA 2PBGA 3UBPC 5B7ZA 1ZSXA 2Z2BA 4LAZA 4CD6A 2HROA 2YDQA 4RDYA 4FAMA 4DO7A 1UBPC 4BF9A 1O7AA 2XVPA 3C4UA 5KZ6A 1IF2A 3HO8A 1OK6A 1YXCA 4C6QA 3SFKA 4HHLA 2TODA 3WZ0E 1TJPA 4PTDA 5IHRA 1XUZA 2GJXB 1ESWA 1J0JA 1EZWA 4EIVA 2AAMA 3M0HA 3GFZA 1GZ1A 3E49A 5CBJA 4WDXA 3QPYA 1Q5MA 3T07A 5D4YA 2GDQA 4L9YA 1ZZMA 4D9PA 1XLGA 1ZNNA 3OGSA 4HJWA 4F8XA 3TUUA 3DI1A 2NLIA 1K8ZA 5LNSA 1AZ2A 1EF3A 4ADUA 2V63A 3WMSA 1MVYA 1SJAA 3TJIA 1TQXA 1CXIA 1J0YA 1A49A 1VPQA 1SJDA 5G2HA 4I90A 5C2XA 1EWEA 3LTSA 3UVAA 1V51A 1J18A 4QGCA 4PBFA 4S3FA 2VEIA 2ZUUA 1IEWA 1F9CA 2PWUA 3DX5A 4CNSA 3DHUA 4JNZA 2J6XA 5D2WA 2VOMA 2OZ3A 4O17A 2O9TA 4AYGA 2I9EA 1QNRA 1TRIA 2GVLA 2DZXA 1HG3A 3TR9A 1D3GA 3U0HA 3U3HA 2ICSA 2QEZA 2QMJA 1E4NA 5G4HC 1SO4A 4WXYA 1UROA 4LB4A 4TOQA 4C5YA 1E0XA 2B4GA 3SI9A 2D2GA 1QHZA 3OYZA 5KITA 3CAQA 1WA3A 1QO5A 2WCSA 1KBJA 1ME7A 3VM5A 3GWQA 3UXAA 5A6LA 2V5LA 2EAWA 3B8WA 3VC5A 3V0TA 1HKMA 1KWKA 4F2UA 3D5HA 3EPOA 4GYPA 3UXLA 2IMRA 3PZ9A 4AX6A 3ZMRA 4K1WA 2EF9A 2GOKA 2BMBA 3GDTA 5FJOA 4JTEA 1H7PA 2AL1A 4FI4A 2FVLA 3C0LA 1M68A 3VMPA 9RUBA 3R4IA 4UNKA 3E6EA 4XZ9A 4WX2A 2SFPA 4IQJA 3RM9A 3P8JA 2DUAA 4M1RA 4V15A 1H7NA 3UZZA 1KBKA 3T2OA 2QLYA 1QI4A 4CNTA 1R47A 4QSFA 4ZQNA 1UR1A 2JE8A 2O56A 1QOXA 1L2QA 1I45A 3TX9A 4WY0A 5D2VA 1EKOA 3WJWA 3LBOA 3KRSA 1VCFA 2QKFA 1W37A 2BY1A 4EK7A 1FWIC 2AKMA 1PX4A 1A50A 3NO3A 3EGJA 4H8VA 2OEMA 3STEA 2CBUA 1A5MC 5E93A 1KBLA 2GLKA 1OQFA 3WK2A 3HQNA 5IRPA 3CH0A 3BV7A 2CLOA 4OTKA 5FACA 2YCIX 2Q8ZA 4P7QA 3CTTA 4FPSA 4PUUA 4F9JA 3IVSA 3M64A 4HPNA 3QLDA 4AVOA 4MB3A 4UR8A 2HSAA 4F40A 3WQ5A 4FO4A 3D47A 4AXNA 3UWZA 2QGHA 2WJZA 1AW5A 4JTSA 3GY1A 3ANUA 3W7KA 2NXHA 1XL9A 1JRCA 3GG1A 5LZLA 1EDQA 3E1F1 3KBSA 3LXBA 4GYPC