1K8CA

Crystal structure of dimeric xylose reductase in complex with nadp(h)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
319
structure length
317
Chain Sequence
SIPDIKLSSGHLMPSIGFGCWKLANATAGEQVYQAIKAGYRLFDGAEDYGNEKEVGDGVKRAIDEGLVKREEIFLTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPIAFKFVPIEEKYPPGFYCGDGNNFVYEDVPILETWKALEKLVAAGKIKSIGVSNFPGALLLDLLRGATIKPAVLQVEHHPYLQQPKLIEFAQKAGVTITAYSSFGPQSFVNQGRALNTPTLFAHDTIKAIAAKYNKTPAEVLLRWAAQRGIAVIPKSNLPERLVQNRSFNTFDLTKEDFEEIAKLDIGLRFNDPWDWDNIPIFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords xylose reductase
publication title The structure of apo and holo forms of xylose reductase, a dimeric aldo-keto reductase from Candida tenuis.
pubmed doi rcsb
source organism Candida tenuis
molecule tags Oxidoreductase
total genus 108
structure length 317
sequence length 319
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.307: D-xylose reductase.
pdb deposition date 2001-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 1k8cA00
2PDQA 2FVLA 2PDUA 4IGSA 2PDBA 2J8TA 3VXGA 2PDPA 3LZ5A 3UZWA 4FALA 4EXBA 4YVVA 4ASTA 1YNQA 1QWKA 2ISFA 2IPJA 1Q5MA 5HNUA 4L1XA 1UR3M 1YNPA 2BP1A 4JQ3A 3G5EA 2PDNA 1PWLA 1Z89A 3LQLA 1AH3A 4Q3MA 3CMFA 3H4GA 1AH0A 4LB4A 2BGQA 2ALRA 3UGRA 1T40A 2HE8A 3QKZA 1ZSXA 4YVXA 4I5XA 3D3FA 2PD5A 2IKJA 1GVEA 4DBUA 1JEZA 2INZA 1T41A 3GHTA 4MHBA 4OTKA 2PFHA 3BV7A 4XZMX 4L1WA 4GIEA 4FAMA 3CAVA 1QRQA 4PRRA 4XZLX 3ONBA 1US0A 1X97A 2ACRA 4GQ0A 1C9WA 1RALA 4GABA 2FZ9A 3M64A 2IKGA 4JTCA 3ONCA 2DV0A 1HQTA 4XK2A 3WBWA 3LEPA 4RPQA 2C91A 2PDWA 3GHRA 2WZMA 4GCAA 3COTA 3N2TA 3BCJA 4LAZA 4FZIA 1J96A 2PDGA 1S2CA 2PEVA 1PYFA 4WDWA 2A79A 3U2CA 1Z8AA 1PZ1A 2HDJA 4LAUA 4H7CA 3UG8A 2ACSA 4QX4A 1OG6A 3MB9A 1IHIA 3V0TA 1EXBA 4XO7A 2IS7A 2IQDA 3CASA 3UZYA 2HEJA 1RY8A 2PDMA 2PDXA 2I16A 4GA8A 3UZZA 2IKHA 3H7RA 4GQGA 5LIUX 2NVCA 2IPGA 2R9RA 4XO6A 5HNTA 5KETA 3LNMA 2F2KA 4HMNA 4PMJA 5LIXX 4WEVX 4FA3A 5M2FX 4HBKA 1RY0A 1Z9AA 4PUWA 1Q13A 3S3GA 3R58A 2FZBA 3ERPA 2HV5A 4XVEA 4LBRA 3UYIA 4ICCX 2PDJA 1AZ1A 2WZTA 3CV6A 3F7JA 3WBXA 3MC5A 1ZGDA 3CAQA 2IPWA 1HW6A 1A80A 4G5DA 4YVPA 2PDIA 3FJNA 2FZDA 3B3DA 2PDHA 3O3RA 4XZNX 1SM9A 3UZXA 2PZNA 2HVNA 4IJRA 2VDGA 1EL3A 3EB3A 1YE4A 4XVDA 2AGTA 4PR4A 2HE5A 1IEIA 4JTRA 4XZHA 4YS1A 3RX2A 2R24A 4WRHA 4PRTA 2PDLA 2DUZA 5JH1A 4H8NA 4DBSA 4GACA 3DOPA 3O0KA 2IPFA 3RX3A 3M0IA 3KRBA 5LIYX 1AH4A 3R6IA 4WDXA 1XF0A 4PUUA 3RX4A 1PZ0A 3WG6A 1EF3A 1K8CA 4WGHA 3R7MA 1AFSA 4JTAA 2NVDA 3LBOA 4ZFCA 3EAUA 4JIHA 3V36A 2IQ0A 1PWMA 4WDTA 3LN3A 5C7HA 2QXWA 4EXAA 1Z3NA 3WBYA 1LWIA 3LD5A 1XGDA 3UWEA 3T42A 1AZ2A 4JTDA 1ADSA 4LBSA 1EKOA 2PDCA 5HA7A 4JQ1A 1FRBA 4R9OA 4Q7BA 3GHUA 2I17A 1XJBA 4JTQA 3R43A 2PDFA 3CV7A 1S1RA 5LIWX 3NTYA 3R8HA 2PDKA 1VBJA 5AZ0A 2ACQA 4JIRA 4JQ2A 3V0SA 3BURA 4XZIA 3LENA 4QR6A 4AUBA 1LQAA 4JIIX 2P5NA 3EB4A 1S2AA 3BUVA 3UP8A 2PD9A 4QXIA 1M9HA 1R38A 1MRQA 3G1RA 3LQGA 1S1PA 4JQAA 3GHSA 3LUTA 4F40A 2PDYA 1MI3A 3GUGA 1VP5A 3M4HA 5LIKX 2HVOA 5JH2A 2BGSA 4DBWA 1X98A 2FZ8A 2IKIA 1MZRA 2F38A 3FX4A 1ZQ5A 4XAPA 2INEA 3P2VA 4DZ5A 3Q65A 4IJCA 3N6QA 4JQ4A 3R94A 3H7UA 4NKCA 4LB3A 1ZUAX 5DANA 1YE6A 2ACUA 3LZ3A 3V0UA 4WDUA 2DUXA 3V35A 4YU1A 3WCZA 1X96A 3Q67A 3R8GA 3DN5A 2CLPA 3C3UA 3UFYA 5AZ1A 4QBXA 2FGBA 2PF8A
chains in the Genus database with same CATH superfamily
2BHUA 3V5FA 1R86A 2Y6ZA 4DWSA 2VQTA 4IUOA 2PDBA 3AHTA 2HXTA 4JBRA 4HB7A 4ASTA 1YNQA 1K03A 1XQLA 1Q5MA 5LGXA 4BCEA 3MKKA 1YPFA 5T91A 2WZIA 5TBOA 1AH0A 1TPB1 3GFYA 3MPGA 1KFWA 1KRCC 4I7VA 4JDBA 3IUDA 4LYQA 1JPIA 2POTA 4R88A 4PN2A 4OFCA 5T9BG 4PZVA 2XM2A 4GD0A 1TWSA 2YCLB 4MHBA 2V2HA 2VDHA 4W89A 3SUWA 1UJQA 1B4KA 1P1XA 1DTNA 2GGEA 3SCVA 4EF8A 1ME9A 4X3ZA 3GXPA 1XIBA 1FFQA 3OYZA 3RITA 3H2MA 4BHYA 3R89A 3IGUA 2GWNA 5IXEA 3HMCA 2HS6A 1F76A 1WUEA 3TN4A 1NOUA 1P0DA 4LXFA 1C9WA 4IP5A 1JYWA 2Z2AA 3PSVA 3M64A 1VCVA 2DEPA 4J3TA 3RM9A 1XIGA 4IGMA 2DV0A 5TAOA 3MKCA 1CEOA 2WMFA 1ZJHA 1K6WA 1DXFA 4OBRA 3VPLA 4B16A 2PF0A 2CWNA 1CTNA 4BWLC 3ARWA 3GY1A 2AMGA 5B7ZA 4CCEA 3O6CA 5AKQA 2GGHA 5AVNA 4AVOA 1T7LA 4UBPC 2FMOA 3P84A 3MU7A 1RP8A 1EJVC 2MNRA 3ARTA 3A5VA 4AWTA 2GZXA 5H91A 5BWFA 1UZHA 1EEPA 1R47A 3UG8A 1DE6A 5E6YA 3TW6A 3GM8A 1DWIM 2P76A 5IDIA 1OQFA 1W2VA 3KTCA 4XO7A 4WY0F 1J8VA 5AYBA 1EYEA 1MQQA 3TJXA 1P7TB 3QBUA 3AWNA 3HPZA 6ENLA 1LF1A 4MB5A 3UWUA 1MXGA 3TC6A 4FEZA 2AL2A 4GY1A 3IJ7A 3M5ZA 1GONA 2IPGA 3CAKA 1XDLA 3GVQA 3WQFA 2YBVA 1EH9A 4AZ6A 4ICMA 1QTWA 3MI2A 1YDYA 3KZSA 3WQPA 3V1PA 4IICA 4V28A 5SWUA 2ZVIA 3WFZA 1A4MA 3HQNA 4HCDA 4GQBA 3SUVA 2QJGA 2H3BA 4K8EA 4HBKA 3SAZA 5FKYA 1NWTA 1RY0A 1BWKA 1ISXA 1K02A 2CESA 3IUIA 5FI8A 3WH6A 2VX5A 4YWSA 4W4QA 3FA4A 3LRLA 2ON3A 4ZODA 1C93A 4XUYA 3QC0A 2ESCA 3VIIA 4PUKA 2FZMA 2VFEA 4IPJA 2IMRA 1OCJA 4PUEA 5FJIA 1QI3A 2NLIA 3MP3A 3B4UA 1A0CA 3RCYA 4F0SA 1KM5A 1PEZA 4IJBA 4QEEA 4QLJA 5FSEC 2BB0A 1JXKA 3EDEA 1G7UA 2Z26A 1KRAC 3GVVA 3TIMA 1E5NA 3HG3A 4RX0A 4YTRA 2VR4A 2PDIA 3FJNA 1EPVA 3NZQA 2W9MA 4Z2GA 4AQLA 3M5XA 4B15A 3N4FA 3PS7A 1OX5A 3TC7A 2RDTA 4XVDA 4QP0A 2AGTA 4FB7A 1L8PA 4TVUA 3RX2A 4PH6A 1MNZA 2E0PA 3ARPA 2PDLA 3T0DA 4H8NA 4OE7A 1ICPA 3UG5A 2J6XA 4TU1A 2OEKA 4I7UA 2RH9A 4M3PA 1MW2A 4M56A 4HTBA 1CXLA 3R13A 5HUOA 3RX4A 4I9JA 3PBUA 1HT6A 5KSWA 1MUWA 2WWDA 4HN8A 5CBJA 4MYXA 3L4TA 2BMBA 4XTDA 1PL9A 1MMFA 4HYWA 2BFGA 1JZ4A 2ZQ0A 3L21A 2GVYA 3S6TA 3SSZA 1Z48A 3N11A 5LA2A 5DBUA 3UXIA 4KPLA 3VD4A 5LZLA 1XIEA 3W2MA 4UMBA 1REQB 3TMQA 1P6BA 4JX6A 2EAWA 4PMQA 3CZGA 1KGWA 3QZAA 4PFMA 1U22A 1RBOB 2DPEA 2V63A 3JS3A 4MNKA 4DJEC 1E0UA 1UIOA 1PSCA 2D24A 2OYLA 3BCFA 1FDYA 4E2DA 5C5YA 4M1BA 4PB4A 1XIDA 4Q8NA 2DZAA 1XGZA 1P0NA 4GNJA 2EJAA 3QM3A 4FHAA 1I1XA 3KLKA 5C2GA 1OC5A 4C1NB 4S39A 8TIMA 4LUIA 1H1NA 3NZGA 4PODA 3V5CA 4PTNA 3SCTA 3OZMA 3QF0A 3MSGA 1OD0A 3GD6A 2ZRVA 2PRLA 3OPSA 1G67A 1KM3A 1WDWA 2UY3A 2QVNA 2WCAA 4G8TA 5HWNA 4AU0A 3PZGA 3WQ6A 3LGGA 3WDRA 1K9TA 3PBGA 5H8UA 4FNQA 2GUBA 3O63A 3AI0A 1ML1A 4ZB5A 1FUYA 2HVOA 4ZTYA 2ADAA 5I3DA 1FH8A 1AL7A 4DBWA 1T8QA 1IT8A 1QK2A 5EYWA 3P2VA 5IFTA 2WO5A 2ISVA 3PUGA 5DMYA 4AFYA 5KEZA 4LY8A 4GHRA 3UG4A 3E0FA 4BQ2A 3NL3A 3QHOA 5F4WA 2JKPA 4J2MA 3PNZA 4YTUA 3LTYA 5CPTA 5T8GA 2AMXA 4MTVA 1A5LC 2OKTA 3VO0A 4AMAA 1VJZA 2VZSA 1ZNNA 2CLPA 3C3UA 4GOAA 3G22A 3ITYA 4IISA 4QBXA 2E9LA 4RZ5A 3S2JA 3LG3A 2WMJA 3LA4A 4O4VA 3VIJA 3HM7A 4K7YA 3AWOA 1DOSA 5EKYA 4FALA 1MEHA 3D3AA 5C70A 3N2BA 4GYPA 1EJTC 3WQDA 4IT1A 5KMYA 4G9PA 4AD3A 2G96A 5C0QA 1PUDA 3WK0A 1NU5A 5FF0A 1J0HA 1DORA 1R3QA 3CMFA 3H4GA 1QAPA 2ALRA 3M6DA 3SRHA 1SZFA 3DUGA 4EPBC 2TRSA 3W25A 1O12A 4MIMA 4BFAA 2PMQA 3OG3A 4NJKA 1H7XA 2QDHA 4IIEA 4FI4A 1HO4A 2VCCA 3I68A 1A3XA 1PX8A 1JDDA 4I5XA 5DFAA 3KVLA 1KQZA 3G8EA 3G1AA 2VGFA 2NXGA 1CXKA 3EPMA 4LUSB 3DERA 3RR1A 2XJ7A 5BU6A 2E8YA 1K4GA 1MVYA 2G3NA 4O0QA 4FIQA 4IQLA 3A47A 3PF3A 5EGRA 3BSHA 3TYCA 1TCMA 3S5SA 1RALA 3H21A 4Q8QA 1GQKA 3KLLA 3ZVIA 5D09A 4XIMA 4MNMA 1FKXA 1KM2A 2YBTA 3SGUA 3GYCA 2NX1A 3IJ9A 4L9YA 3TU9A 4IGHA 5CZTA 1EBGA 2NQLA 3OLDA 2C91A 2PDWA 2WZMA 1YQ2A 2PGWA 1LL6A 3LRKA 3BCJA 4K68A 1OGGA 1U2YA 4RZ6A 4QS5A 4HTYA 1EJRC 4OV4A 3W9ZA 4W5UA 3CPRA 3FEMA 5M3WA 1ZLPA 1YNYA 4JD4A 2YCLA 1E1CA 3MB9A 2P10A 3G3DA 4L5ZA 4UTIA 4NJHA 1EXBA 3WLTA 1MW1A 2IS7A 3I6RA 2PP1A 3KCOA 3VMNA 4ZEPA 5F7UA 3UZZA 3ARYA 4QQUA 4IIHA 1QK0A 1DQXA 3CQIA 3FVMA 4FXJA 2R9RA 4XO6A 1L6GA 1SMDA 3NSXA 3TFCA 4O54A 1KO0A 3E2SA 4DBDA 1UWIA 3QLDA 1XSJA 4RDVA 3ME3A 5DRIA 2C16A 1UWUA 4Q7IA 3IJ8A 1W31A 2WC3A 3PJTA 3RCNA 3AIRA 4NZJA 2FZBA 2AL1A 3ZLFA 4ROQA 1W6TA 1LUCB 3ISIX 2O92A 3B9AA 3BSMA 3W1MA 1TTPA 1E43A 2C1IA 2DZTA 2H8XA 2X7WA 4H1ZA 1V6WA 2HVMA 1GORA 2C0HA 3EXSA 1GJWA 2QCDB 2CLLA 1FWEC 1KBIA 3DECA 3R12A 1AJ2A 1I6NA 1D3GA 4AX7A 3BL3A 3RO6A 1HKJA 3LPFA 4MFDA 4XISA 3ARSA 1P7TA 4Z0JA 3ANUA 3MMDA 2BY1A 3VOCA 1EL3A 3KP1A 1Q8AA 7REQB 3SI9A 2HQAA 1ZAHA 3W07A 4DJED 4YCPA 1CGUA 3A64A 3U48A 4XZHA 1LOLA 5A8PA 2PC8A 2WLZA 1OFAA 3WZ0E 4UMCA 1KXQA 3R0DA 2ALDA 5H6HA 1R9YA 5LXEA 2P50A 3UJEA 2R1MA 3MV11 2P0IA 1Y0EA 2VEIA 2GWGA 9RUBA 3V16A 3W7KA 5GNZA 3RUBL 3KRSA 3CTLA 1RBLA 3QFEA 2TYSA 2V81A 4PSPA 4GZJA 2OCZA 2FZNA 1C3FA 4S3BA 1ICSA 1NJJA 4A35A 3LCGA 4HU8A 4ECLA 2R1PA 1ZFJA 1J79A 1AW1A 1W17A 2VC5A 4LNYA 2PP3A 4L80A 4D6HA 2WKGA 1FFRA 4GE8A 2HPIA 3R43A 1W3LA 2B0MA 4NYYA 1S1RA 1EC7A 1XS2A 3AJXA 4EXQA 2WMKA 1W37A 4HVXA 3MV01 4NASA 5AZ0A 1CGXA 3V0SA 1FA2A 1I45A 4IPIA 3F5JA 4QR6A 3VKJA 2P88A 3UPBA 1DJYA 1UR0A 1EOKA 4JTJA 2XU2A 1TJ2A 7A3HA 2CHRA 3BUVA 2OU4A 1HKKA 2F6KA 3PUOA 4RK8A 4AG0A 4O17A 3K1DA 2WVTA 3OIXA 3A3HA 1Z7AA 1XKYA 3LBMA 2EF9A 3V5OA 1JZ5A 3OJGA 1I2RA 2CXGA 4ZL1A 3PTDA 1AQHA 4C6EA 4HZ7A 2CCRA 1R8LA 3S9IA 2WSPA 4AD4A 2ZRWA 3ANYA 1WZMA 1REQA 4JNYA 1QPQA 2ZX8A 4H9YA 3S1XA 4F9JA 1O5RA 1ZRQA 3AAMA 3FXYA 4M81A 1H2JA 3CIVA 1JCYA 5HWJA 2BXZA 5LGZA 1GPFA 4PBEA 3CHFA 3ITGA 5AYYA 3N18A 3L2MA 1GVFA 1FWNA 3M47A 3KWXA 1OADA 3BLIA 4A2SA 4C1NA 5A2CA 4C7GA 2CZFA 4ONVA 3RPDA 1UD5A 2OXNA 1GOXA 1GVYA 1GYNA 3I3BA 3LZ5A 3GRIA 3O8AA 3PJXA 3T78A 3HURA 3TMLA 3OVRA 3S83A 3CXOA 2YDRA 2IPJA 2WV8A 4EX4A 4OQVA 2V38A 2XSAA 3B8IA 4RNHA 1ZP4A 4JQ3A 4GY0A 5JBDA 1XLFA 2C0AA 1K9EA 3W4RA 3L4VA 4N9BA 2V9DA 4XD6A 5L6UA 1CT5A 2E28A 4IOTA 4IPPA 4B2DD 5DO8A 5MKGB 2GGIA 4M6PA 2GFTA 3UESA 3SY8A 3H26A 1KFJA 1JD9A 3ZJ6A 4YIWA 4DBUA 2PURA 4AIOA 3LBCA 1IXOA 1IE7C 5FJUA 1IWAA 1UIPA 5DELA 2QMKA 4U31A 2I9EA 1IZKA 4EACA 4GIEA 3E38A 3DESA 4BF9A 1NF7A 3CB8A 4O28A 2XFFA 1ESWA 3QW4B 4A05A 4HA3A 1KXTA 3DFHA 2C1HA 2OGYA 4AX6A 5EPDA 3CIWA 4EVZA 4UCGA 4AAJA 3VD3A 2J66A 3FKRA 1XG4A 2VC9A 3R5EA 2EPHA 3C8FA 4JZ5A 1PIIA 2YKKA 1ME8A 5D02A 1KR1A 3TJ4A 4ZGYA 1TRIA 1QNSA 5DCDA 1UMLA 3L67A 3VZYA 4Q33A 2ZVRA 4R3UA 1F4AA 4UTFA 1MSSA 2KX9A 2XVPA 4C6BA 1EHAA 1V6VA 3DIPA 1CDGA 5C9WA 4LAUA 5B7YA 4PCSA 4ENLA 1V3LA 2A3BA 2JIEA 4LUSA 1OFQA 2OVLA 4MZ1A 1FWBC 3V0TA 1QNOA 2C71A 2OSXA 3WEOA 3QSTA 3WLPA 1EZWA 1JDFA 4D6EA 5I24A 1C8VA 2I16A 4GA8A 4QITA 1F2JA 2OO0A 1EJ7L 1O66A 2QKFA 5HNTA 1HN1A 4QE4A 3GW3A 3OTRA 1ZJIA 3UCCA 4CVUA 2OQHA 4ILSA 5LIXX 4GGBA 4KMQA 3MZ2A 4FLSA 5BZAA 2ZXDA 3EPNA 2AQOA 3M44A 4LSBA 3S6OA 2PB1A 3W1PA 2VC7A 2WCSA 4F48A 1LRNA 3AXXA 2DIJA 4HNTA 1Q7ZA 3BJTA 2PRMA 3ITOA 2G3MA 1HP4A 4DHGA 2ODOA 4GZEA 3KVJA 3SCQA 4NF7A 2VOMA 1JCTA 2OMAA 1IIHA 2A85A 3DCPA 3BK0A 4REQB 2NQ9A 4US5D 4O10A 1N82A 4O57A 3VDHA 1TV5A 5LHFA 3UERA 3BMWA 4F0LA 1XFBA 4C91A 4E6MA 1WXJA 3MI3A 3SUSA 3T05A 1V6UA 3BAWA 2ISSA 3PZOA 4I9AA 5JUVA 1KKRA 4U3AA 3B03A 2AGKA 3K4DA 4QLKA 2RAGA 2VI0A 4UTHA 1VYRA 2RDUA 5CH9A 4NVTA 4U2ZA 3VNKA 1XIFA 1QO5A 4IMAA 4MF4A 9XIAA 3L66A 1CGYA 1UR9A 4OBSA 3W7LA 5GQBA 1R3WA 4LAOA 3T55A 1PS9A 1THFD 2YL8A 3KRBA 4CNTA 4R33A 1RLCL 3UXLA 2CERA 1LUCA 1MW0A 4UR8A 4IMGA 4US6A 2OLHA 1Q6FA 5I09A 4L7ZA 4HZ6A 4H01A 2QCDA 1OIMA 4A3QA 1D7FA 2HK1A 2GDUA 3H4WA 1A5OC 3WBYA 1WCGA 2Y5JA 3W7CA 1NSJA 1J2WA 4IP4A 5G2WA 1XM3A 4Q7BA 3VFLA 4QRNA 3IGHX 5DY3A 1TRDA 1ZBVA 3S2NA 4DELA 7REQA 3BAYA 1TQJA 1IR1A 1I9CB 4JX5A 1XLLA 3MO7A 1TG7A 4HSHA 2RGLA 4AY7A 5TQLA 4OOUA 4W7WA 2F8QA 5D32A 1NOWA 3DHPA 4MDOA 1KB3A 1RQBA 2VM8A 4NIRA 3KL0A 5FCZA 3BW2A 1S5MA 3GNDA 4I8YA 1TWDA 2XFWA 3SR7A 3AYSA 5K4ZA 1K8XA 2CKRA 1UJPA 3M0MA 3LXCA 3NO3A 3GG1A 4XD5A 1BHGA 2Z2BA 5ABHA 1S2AA 1O4UA 3WQCA 1JAKA 3FA5A 1SJCA 3U4AA 3P8JA 1TJRA 3BJSA 3VE7A 3JU2A 1M9HA 4WSHA 1R2SA 2OLSA 2BGNE 2WMHA 1GZGA 3F4WA 2YXXA 1S1PA 1AK5A 4WGXA 4PL2A 3ALGA 2PDYA 2REQA 3BAXA 3W7NA 2XDFA 2XIQA 3Q4DA 4IQDA 1FP8A 4UQCA 3T07A 2ZXQA 1B4EA 3MMUA 4YPJA 4RUBA 2VZTA 1AQMA 2A7PA 5GJNA 3VNIA 3MUXA 3VTRA 3FX4A 1H3GA 3CNYA 1WYIA 1FWJC 3GYEA 4QNWA 3GUWA 4NKCA 4GI9A 4M51A 1Q8JA 1YXYA 3FSUA 4IMEA 3UY7A 2GJRA 1BQCA 1K1DA 3DKJA 1JZ2A 4K37A 2CBUA 2HTMA 4PMVA 2D2GA 3S5NA 2W27A 2FJUB 2G41A 3DAQA 2O4MA 4Z1AA 2BS9A 1DXEA 2WBGA 4GNKB 3VNLA 3PB2A 3MP5A 3LMYA 5TIMA 1VFUA 5LNWA 4MLJA 3ZLHA 3WNOA 4MWAE 5C6MA 4IP7A 3W6YA 3UF9A 3QY7A 4AIEA 2RGMA 3BLDA 4JNMA 2WSKA 3EWUA 1JZ6A 2J62A 4N02A 1W5OA 1TO3A 2CETA 3UVAA 4D8ZA 1XLAA 2FJKA 3P6LA 5DLCA 2PLKA 1T40A 3PULA 3HGOA 3FS2A 7ODCA 1KFEA 1SFLA 2VX4A 2ABAA 2JE8A 4XQ6A 1GJPA 2PWVA 4Z1YA 3F4DA 2WQPA 1CENA 1WNOA 3UYCA 3OBEA 1Y5WA 4JTFA 1LLOA 3NFUA 3PP7A 2AOSA 3KBMA 3CZKA 2Q02A 4I6KA 2Z25A 3A13A 5B80A 3PZTA 4L4MA 1ZBWA 3HGRA 1BVNP 2HCVA 4C60A 1R3VA 1JNEA 4JN7A 5TF0A 3T9PA 3CZJA 2Q09A 3MHUA 3RLHA 1FOBA 4R7WA 2E5DA 1LJYA 3ARUA 4GGHA 3P14A 2VCBA 4JTCA 1OEPA 1H49A 2HS8A 3VAVA 2Y4SA 4DXKA 4AIBA 4XV0A 4B9YA 3UWYA 4BEQA 1Y7VA 3ZVHB 4O1CA 2ZADA 1O1HA 3L5MA 3GK0A 1FWGC 2JKEA 3GHRA 3EWDA 3AS2A 1FWCC 1IF2A 5HDRA 4KEZA 4S3EA 2BASA 2PEVA 1OFEA 1MUMA 4DAIA 5MKGA 3TX9A 3QV9A 3QHMA 2NQJA 4Y96A 5EA9A 4LT9A 2XIIA 5HOSA 1LOQA 4ORIA 4QTGA 1VAHA 4Y9MA 2E6FA 2Z1VA 1VBGA 2ACSA 3WQGA 1OG6A 4UZUA 4CKQA 2FH6A 2QUVA 3PBYA 3U2OA 1KM6A 2V68A 4F66A 1RY8A 2PDXA 1H41A 4RR4A 1SUXA 3PZQA 3PJWA 4GI8A 3V4BA 3KOZA 1H1ZA 2XFYA 2D20A 1VBUA 2J7BA 3H7RA 3HA1A 1DQUA 4C6MA 4XUGA 8XIAA 1VF8A 3DDMA 4NJIA 2X7VA 5CPLA 1K8ZA 1JR1A 3OHMB 2YCIX 3A4JA 3VMOA 1KFLA 3I4EA 4E8GA 1IEXA 4KGLA 1GT8A 4KCWA 1Z9AA 5A69A 2DSZA 3TVAA 1H4PA 3E49A 3MS8A 3CJPA 1KC7A 4AB4A 5A8OA 1KBKA 4ICCX 3LXAA 2B31A 3HQOA 3C6CA 1PKMA 1C91A 4HA4A 5LA0A 5I77A 3FK4A 1HL8A 5BWAA 2B7NA 4H9VA 4FOJA 3HU7A 3RFAA 3MC5A 4UB9A 4MGGA 5DMLA 4RXGA 4PUDA 1CYGA 5HAOA 4F0MA 3GXFA 4JFUA 2HK0A 1TE1A 3AS1A 2BBFA 2O9PA 3QMSA 1XH2A 3W72A 2PZNA 4NXKA 1GKPA 4GI6A 1EJUC 2R94A 4J3ZA 1DBTA 1TSIA 4PR4A 3C52A 3LOTA 1GOWA 4UTWA 3B8DA 1KLZA 1TVPA 5CPQA 1KWGA 3H12A 3QGAC 3RLGA 4J1OA 3W2UA 2P1FA 1OFRA 3KHJA 2WNWA 3NJ3A 3EKZA 4I9MA 4IIBA 1TX2A 4MM1A 3TKFA 1WZAA 2WMGA 3URQA 2IUZA 4PUUA 3KHDA 1CGVA 2XIMA 4LAMA 3GVWA 5I3JA 1JCNA 1XP3A 4CNPA 1PX3A 3FLUA 2GQAA 5DXYA 1BSLA 1KQYA 4A3HA 3ITXA 1Q85A 1QHZA 3LX9A 4WUIA 5M17A 4REQA 2VRQA 2PTZA 2ZDRA 4OWGA 2QCCA 3SRKA 1Z3NA 4AHOA 3C0SA 1H7NA 4H7VA 1TWZA 3QOMA 1AZ2A 1EQPA 1TUFA 4FSAA 3VC5A 4JTDA 1KWKA 1G1YA 5HA7A 4E38A 2J78A 4U10A 4D6GA 3WQOA 5AC6A 2W4XA 2W92A 4MJZA 3FFSA 2PBGA 4IG2B 4QEHA 3MUCA 4QISA 3TAOA 1UWSA 3IVTA 4AZ7A 3UW6A 4KRZA 4JTHA 5CZKA 6TIMA 4LYKA 2W66A 2INFA 1L6YA 1XYFA 3SCWA 1EGZA 1AW5A 3G1HA 1PHQA 1W32A 4MSSA 3CS2A 4JIIX 2VEKA 2P5NA 3FEQA 2GYIA 2NX9A 3WLNA 3REQB 2BHYA 4AD1A 3K8KA 2I14A 4HNUA 1R38A 3EKGA 4PE8A 5FACA 3M0KA 3A4WA 4C7DA 2W0UA 4PFHA 4JQAA 3SURA 3W22A 4F40A 4R34A 3UGVA 4KQNA 3RRXA 5LNUA 1WDPA 3ENLA 1CW2A 2BY0A 4A21A 3HV9A 3HPFA 3LMZA 4S3CA 2RHGA 5D2XA 2YOCA 1K77A 1ITXA 1FBAA 1IEWA 2QF7A 4RNJA 2CBJA 2Q3RA 3TAKA 1G94A 3CYVA 3CO4A 3TDFA 2YDAA 3NNTA 3PR2A 3GTFA 3BAJA 4IJCA 3NPWA 5LKYA 4MNJA 3H7UA 1WO2A 4GKLA 4AMCA 1W1ZA 2PTYA 4GQRA 3V1HA 4K36A 4FLRA 3NXLA 3ZLGA 5FSDC 3WCZA 4M82A 5CLTA 2QCHA 5J5DA 1NH6A 1O6IA 4DZIA 2X1SA 3GDKA 3T7VA 4IGSA 3LI1A 4WJXA 1ME7A 2UY4A 1FXPA 3B8UA 1P0BA 3TNOA 3CHDA 3TQKA 5HNUA 1VS1A 3B97A 4BJHA 1XLCA 3G5EA 3GQYA 2FGLA 3EWXA 3TN6A 1KRMA 3LI0A 3FJ4A 4DRSA 4N7QA 1XX1A 4Z42C 4GK8A 3MZNA 1CCWB 3WDJA 2ZTJA 1SW3A 1DWAM 4C90A 4QJ3B 3D6NA 3BGGA 2FPVA 2ZUUA 4ACYA 1LT7A 2WSQA 2ONEA 4WOQA 1WQ5A 2QHAA 4XB3A 4AIUA 1UA7A 4HMDA 3T4CA 4V15A 4S38A 5CGQA 4BWLA 4UTUA 1DE5A 2JFEX 1EUNA 2CU0A 1UKSA 4B3ZA 2VURA 2PWGA 1ODZA 3WO8A 3UJ2A 1E51A 4YLWA 1HGYA 3E0VA 3MTWA 4ZO8A 5FOOA 4S2BA 3WUGA 4WD0A 3DI1A 2Z1SA 1E4LA 3S1VA 3LEPA 1P5BA 1JZ8A 4EIVA 3GFXA 3PTMA 2QJJA 1UP2A 2R8WA 4NY2A 3MY9A 1XBXA 2G3JA 2ATSA 4FO4A 3RXZA 3WBAA 2F61A 3LLFA 3W02A 4WXZA 1UG6A 4WDWA 6TAAA 2QVHA 5A6AA 3IV8A 4H2CA 3VVGA 1DQWA 3KOYA 5A6SA 1XHGA 4QX4A 3IGSA 1XI3A 2DQWA 4HNVA 1SJDA 2VFGA 3HJEA 4NZ4A 1PO9A 4KH2A 1D3HA 4RJEA 2PDMA 4N4QA 2DIKA 1W9BM 3T8LA 4IIFA 4GQGA 3ITVA 1TE6A 2DGAA 3NQMA 3WH5A 1DWHM 2D0FA 4NQ1A 4TX8A 2YL9A 1JUEA 3E9AA 1CWYA 3STEA 1BTMA 3WNMA 1EP1A 4W88A 1GOIA 2ZX7A 3ZVHA 4RPPA 1E0WA 1CXIA 2OQLA 3QOKA 1J0ZA 5CBIA 3ZO9A 3H55A 4H8HA 2XVKA 1JGMA 1LRQA 2EHHA 2DSKA 5DX7A 4J3VA 2VRJA 2X1RA 1U33A 3OBAA 3F7JA 2X0YA 2OR2A 1JFXA 4JAWA 2X42A 3QSRA 1XW8A 5JMUA 1UASA 1IEQA 1BWVA 4OT7A 1OFOA 2UY2A 4S3JA 1FQ0A 1A80A 2JF7A 3GXDA 4A8RA 4G5DA 4LAKA 4B4HA 4WKFA 3QMRA 1LLWA 3OGVA 1N2VA 1CLKA 3GR7A 1DJGA 3O1NA 3VM5A 2PCQA 4QCFA 4JCLA 1EJXC 1M41A 3VM7A 4JN6A 3BG3A 4S23A 2ZC1A 1SGJA 1GYMA 3Q58A 1BG9A 3PK7A 4RZBA 1VJSA 5FEWA 2J13A 3FW6A 3LHUA 4ALDA 3MJYA 2YR1A 5KZMA 1XF0A 1L9WA 4XZ9A 3THUA 4CD8A 4DJEA 1XPYA 4XAZA 5FJOA 1NM9A 1XINA 4HNNA 2BOFX 2VEMA 3GTHA 2QGHA 3CWNA 1MUCA 1V0KA 2FFIA 1TWWA 4NRRA 3SIMA 3G3MA 1TPUA 3A3WA 3HPXA 2NVAA 3AHYA 5LYRA 3G24A 4IF2A 3WX7A 3QKEA 4E4PA 3KTSA 2PDCA 1FRBA 1B5TA 3AZRA 3B9OA 4K39A 2I17A 2J47A 3VNDA 3AC0A 1IZCA 1TV4A 4ADUA 1KXHA 3LM3A 1RK5A 3H22A 3TYAA 3PFRA 1W3TA 4EPKA 3NQFA 1V8EA 4YYFA 1YTEA 4PCNA 3NZPA 4M19A 3OGSA 4O52A 1X8FA 3BQ5A 3CPGA 3GKAA 3UP8A 2PD9A 5A1AA 2DY3A 4TVDA 4GVFA 4LRSA 3U57A 3A24A 2QCEA 2KAUC 2CW6A 4CD6A 3GXMA 3M0ZA 2Q8ZA 4UFKA 1XYBA 1ZL1A 3VKDA 1BSIA 4ZQRA 3HF3A 3GAKA 3E2QA 4HT3A 3BW3A 4KBXA 4MB4A 2BOEX 1HO1A 3QR0A 3B9DA 1J5SA 3DEQA 4GUGA 4LYRA 5XINA 1R9ZA 2OZ0A 4TVCA 3QZEA 4NAEB 2QJIA 3CEPA 3H70A 3CL8A 4DVOA 2Q8LA 1SO5A 1RH9A 4RKAA 2R1NA 3QQ0A 2BDQA 4HU0A 4IG2A 1LROA 4LRTA 2ACUA 2Y8KA 3N25A 3IAQA 4EP8C 5FIPA 2Y88A 4RE3A 1RCXB 2DIEA 1K4HA 4L65A 4AXNA 3STCA 1BF2A 1R3TA 3O6YX 1ONXA 1ZAJA 2E9MA 3REQA 4JY9A 1N8IA 3VGEA 2A21A 3EX6A 4XTIA 1QI4A 1TZZA 2D0GA 1BVZA 4V2XA 1BYBA 4GC3A 1EFZA 1N7KA 2ZZ2A 2YA0A 1IXNA 3NVDA 3W7IA 1Q7QA 3WENA 1PXGA 2J77A 2BGQA 3B05A 1FH9A 1G5AA 5BRQA 1IQ8A 4MLRA 3SO7A 4A22A 4LTSA 1TJPA 3QKZA 4AZGA 3GX9A 3ABXA 4LS1A 1I2PA 3A6OA 4GUHA 1M1BA 2WJEA 5G4EA 5E9XA 2ZIDA 1K7XA 4OTKA 4IM4A 4DX3A 1MXDA 3DXIA 2WQDA 3FJ6A 2YSWA 3GBEA 4GWEA 1QRQA 1RD5A 3CH0A 1H60A 2ZX6A 3FCPA 4K8GA 3A23A 3L2LA 2AKMA 2CWXA 4AWEA 1E56A 3WELA 1WAWA 5IRPA 1JF5A 4DWDA 1YDNA 1X1OA 3LY0A 2E09A 4HJWA 3SRFA 4QJ4B 5CZJA 3M0LA 3QPZA 4D8LA 3H2AA 1E4IA 4QAWA 1G4TA 2NWRA 3VNMA 3TR2A 2ZTKA 3BCDA 4G1KA 4NP7A 2V8ZA 3RHGA 5J5RA 4LFYA 5HJYA 1Y5XA 4ROPA 5ECUA 4X9YA 3TTEA 1A5AA 5FF7A 3N1AA 1NVMA 1E73M 4AZBA 5CZSA 4RW3A 3HOJA 4FR1A 3SRDA 1E0VA 3HJZA 3WLRA 1GHRA 2XSBA 3VOHA 4UQBA 4F4RA 1M03A 4WXYA 3O2LA 3UZYA 4YNGA 3HQPA 1SFTA 4D6FA 5BW6A 3IARA 1V77A 1YRRA 1F3EA 3QGKC 1PVNA 4BY3A 3BPWA 4ZTXA 1HUVA 1UD3A 4NAFB 2G3FA 3NXFA 3CB3A 3WJWA 4X2PA 1TPFA 2XH2A 2ZA2A 4HYVA 1QW9A 1BYCA 3HPSA 1PB0A 1O68A 5GVJA 5A6JA 4HCLA 1GK8A 2TSYA 3G1VA 3O05A 5I7GA 2HV5A 4LVDA 1KGUA 3U8GA 3WF2A 3S1UA 4G7EB 2PDJA 4A2RA 4QFUA 2V69A 2XIOA 4LNCA 4O19A 3VU2A 3RJXA 1E9YB 2IPWA 2I1OA 3GC4A 6XIAA 3PTKA 2VX6A 3TP4A 4DWSB 2BVYA 1GYLA 1QATA 1E3XA 3SSJA 2WMIB 2Y63A 2PODA 4GZ7A 4WY0B 3SW6A 3NOYA 1UWTA 2OJPA 4PTXA 3RR4A 2HVNA 4JPGA 5BXPA 2W63A 4H9MA 2QDGA 3EB3A 2GUUA 4AEEA 3W28A 3G1FA 2XYLA 1Q7MA 2HE5A 2EPKX 3TJLA 4PSRA 4US5A 1SO4A 2R24A 1WBJA 4FXFA 1I2QA 1T99A 1XIMA 2CFFA 3E2RA 3B9EA 1TPWA 3W75A 3RMEA 4A29A 2IPFA 5BXTA 1GOQA 4CU7A 5JBFA 4MWAC 4HHLA 3WD1A 2ZRZA 5FA5A 4IQEA 1W8GA 2V3FA 3ARRA 4GVIA 2FLIA 2DJLA 1U1UA 3I10A 1WZKA 4CNOA 3BZGA 3B0XA 3F5LA 1CGTA 1HXJA 3R7MA 2WJZA 3LHWA 1R7AA 2VVSA 4B3LA 3LPGA 5D9PA 1Z42A 3CK5A 1C92A 2O9OA 1V03A 2A0NA 1DHKA 1GVRA 2DP3A 1EC9A 1XGDA 1OCBA 2A7RA 4ZBCA 4O0ZA 1W3HA 2BHZA 5DXXA 1VGAA 4MVAA 3DI0A 1ADOA 2YCJA 2X0HA 4J3WA 4CEXC 3UCQA 2X09A 1M7XA 2D23A 3QC3A 5BRPA 5HINA 3FYYA 1CIUA 4H9XA 1EJWC 3ITLA 3R8HA 4XG1A 3TONA 4GJIA 2G50A 5CSUA 1W1YA 3WYZA 3ABRA 2XVNA 3E6EA 2J74A 3WBEA 2EPLX 4F0KA 3OBKA 5HQLA 3GC5A 4OVXA 5FESA 2V5KA 1LM1A 4DPQA 4GFSA 5T9CE 4UR7A 4LV4A 1XKJA 5RUBA 4ML9A 4E4UA 3LGEA 3C86A 1HJUA 3USBA 4A8NA 3UCDA 2V2DA 1DIEA 2J25A 5ABGA 3G1RA 3LV6A 5ENLA 1H7PA 4ZXLA 3ZXWA 3RDKA 1OCNA 5D04C 2HBXA 2OSWA 2GK1B 3P82A 1C9DA 3OG2A 5KINA 3AOFA 3BOXA 3BQ6A 3FA3A 4GISA 5I3KA 4G6CA 5LIKX 1H5YA 3PFMA 4UMAA 2F6XA 1R7OA 2J79A 2R1LA 4TTUA 1MZRA 3AXKA 2ZDSA 4QG8A 3W1NA 2VX7A 4Q8TA 2Y7GA 4GKTA 4IWWA 1S2VA 4Q22A 3I7QA 4DNHA 1L8NA 2POZA 5REQB 3N15A 3E12A 3C3NA 3ZS4A 4ZO7A 1QMLA 3CZEA 4JTUA 3CM4A 4AHQA 5PTDA 3HFYA 5A8GA 1UHVA 2J24A 2JIWA 3HB9A 3ICJA 2CLOA 2HROA 1PE1A 1YXDA 5MHBA 4XBKA 1OX6A 4D6IA 3WLOA 1EA9C 2CYGA 4J2PA 3LQLA 2DUAA 3TWBA 1KV5A 2AQVA 3CEUA 4YWIA 2O4QA 4MFEA 1Q66A 5GJMA 2D2OA 1X7IA 1H11A 9XIMA 3CC1A 4H00A 3WY1A 5CC7A 2IKJA 4J4KA 3P8IA 4V1YA 5EY5A 3W7OA 1V3IA 3DG6A 1HJWA 1WKDA 2PFHA 3TXVA 1QXLA 4H2HA 4PMXA 3CAVA 4L4PA 3NEVA 4NZ5A 3SCNA 4OU1A 4J35A 1F8IA 1DJNA 2HMCA 2GQ8A 2A6NA 1NQKA 1W9XA 2OOGA 5DY2A 1PKLA 3SZ8A 3BV4A 2FZ9A 2JBMA 4HZMA 2J8GA 1CZ1A 1WDRA 4CCCA 1J0YA 4XK2A 3QYQA 4BS0A 4IPLA 4H9UA 4RPQA 4UTTC 1W1TA 4B5XA 3C2OA 2H90A 2Q01A 2ZUVA 2Q8XA 3BLEA 4A8LA 3SIZA 1OABA 3DFTA 3ZZ1A 1VCFA 1PZ2A 7TAAA 2G5WA 1E9ZB 5DCBA 4N0RA 1FDJA 5XIAA 3U2CA 3WF1A 2VFHA 3AIEA 2E9BA 4K3ZA 2LLEA 2ZWZA 5FJJA 3VGBA 3O6DA 4H7ZA 4OUIA 3RCMA 1QJWA 2Z24A 3IANA 1AQFA 3GH7A 1ZENA 4XAYA 3Q94A 2VDIA 1VLWA 1XRVA 4JKLA 3NM1A 1F3XA 4H8VA 3ORWA 1KGXA 4UNIA 2JGYA 2VGIA 2YDSA 2GJXA 3JW7A 3MI6A 1JCLA 2XGZA 5E0CA 3PHAA 4HK6A 3LM7A 4DY1A 1JFHA 3NA8A 3WLQA 3FYOA 3W23A 1TELA 5I3HA 3VKBA 1GZJA 3R58A 3PY2A 4CN4A 4XVEA 3KW3A 1UBSA 3KM8A 2YPIA 1NFBA 4FNSA 4ZO9A 5E0FA 4GYPC 4PBGA 4MWAD 2Y0FA 3UJRA 2WKJA 4GXWA 2XUCA 2OSYA 1TV7A 3W2NA 1A5UA 1BD0A 4LUYA 1GKRA 4DJFC 3K46A 4NNCA 3I65A 1OGBA 1XYCA 4P7LA 4GO9A 4WOZA 1XIJA 3TSMA 3T8QA 2I57A 1Q6RA 2O7SA 4L4OA 4UQ9A 1XLEA 1V3KA 3KOXA 2FZDA 3AHZA 4HKPA 2QPUA 4WJEA 2WHLA 4AD0A 1W5QA 5D03A 4DAFA 2WVSA 1BEUA 3GTXA 1Z69A 3PNUA 3SGZA 1MEIA 3DFOA 4NAFA 2TPSA 1AVAA 1QCWA 4IUGA 1VRXA 2Z00A 4HOXA 4I7WA 3AIUA 4ZQMA 5ABFB 3SJ3A 1GG0A 2DVUA 1Q6GA 4XIAA 3VDCA 3AMCA 3O0KA 4J3SA 3RX3A 1XLGA 5LIYX 4CCZA 2E1DA 1FP9A 1A50A 2EKCA 5A3HA 1RVGA 4ZQNA 4G7EA 2QIWA 2R6OA 1E4MM 5ECVA 3BICA 3AUJA 2ZBTA 4IFKB 1LOSA 5FF2A 1QO2A 4ZFCA 1Y5VA 3OQ8A 3B8SA 4ZFMA 1BYDA 4LEQA 1C8XA 1OF8A 5A6TC 1QOPA 2Y85A 3GIYA 2WM1A 2WMIA 3RF9A 2BG5A 3JR2A 4WY0A 3IS4A 5HULA 3UT0A 5CGMA 4K8HA 2QJNA 4LJ3A 5HR7A 5LIWX 2DZWA 4PYSA 4HMEA 1GW1A 1ONWA 1Q4NX 3GSMA 3F1QA 3M16A 1TJ1A 3UXKA 3QHNA 5CXPA 2DT2A 1G01A 3BG5A 1O5QA 1E1CB 1D7KA 3F2BA 3G6MA 2JK2A 2ZZ4A 4F2UA 1R85A 1RA5A 1QUMA 3EMZA 3TYUA 3EWCA 4DIAA 2GJNA 3T2PA 2FKPA 4F79A 3VUPA 3GC2A 4PRWA 3GHSA 3I6EA 1V6YA 4Y6GA 3SUUA 1XICA 5GJPA 4R27A 5IBXC 4UFIA 2OWCA 2X0SA 1J93A 4JNZA 1UUOA 2QULA 1DIOA 4Q6XA 3SCRA 1C29A 1JRCA 1PJ9A 1X98A 3WMSA 2QNEA 4HPGA 2DZPA 2CLFA 3HG4A 2RJHA 1LP6A 3KTXA 4PB5A 3VNJA 2YX0A 4JCMA 2NQZA 1J4EA 4CQBA 4ZQCA 4TMCA 3OA3A 4TX9A 3OZPA 3EOOA 4KWOA 1B2YA 5GNXA 3NVTA 2Z6IA 3GG8A 4QIUA 1UWQA 4F2BA 1DJHA 1V02E 2DSWA 4F3HA 3M5YA 3NEHA 2VFFA 3CMGA 4P7RA 1V6XA 2C1GA 5H1WA 1SSGA 2PF8A 5M5DA 1XLBA 3E3HA 4B5WA 5D37A 1OZMA 3L0NA 2FVLA 1KFCA 4DM2A 3G77A 2VUYA 4CNSA 3V75A 1A47A 1D9EA 3QFWA 2D2JA 4GG9A 3VKKA 3BLLA 4BQ3A 3RIKA 1GPWA 3SB0A 2P8BA 3MMTA 5AY7A 2D69A 2V0TA 4WCJA 2PDNA 3TLLA 1PWLA 1Z89A 4JIQA 4Q7NA 1AH3A 1XYZA 2W91A 1EJSC 4Q3MA 2GK1A 2FMNA 4H6RA 2Z6JA 3W1TA 3AU6A 5A2BA 4DXVA 1OGSA 1UD4A 3AMGA 1ZSXA 1FWRA 3N29A 3BJFA 3UR5A 3TQVA 2A3LA 3NQEA 1QOQA 2H6RA 2UWFA 3EEZA 4O1FA 3NQAA 4KESA 2OEMA 2GGGA 5KZ6A 3WLMA 4ZCWA 5REQA 1EC8A 3I6TA 1Y65A 2FB2A 1Q2SA 5D9NA 1FXQA 1GVQA 3QLLA 3UWZA 3W3OA 1OIFA 3KUMA 1IT0A 3VOIA 2VQUA 3EA1A 1NDWA 4S2CA 3E0IA 3UPWA 1VFMA 1OJXA 1UH2A 3WNLA 1JD7A 1BF6A 1HZYA 1M53A 4KEUA 4ERAA 5HK4A 1QNPA 1XRTA 1V0NA 1OZQA 3A5FA 1B3OA 2ZX5A 5DN1A 3U5UA 1AJZA 3APGA 5DCEA 2ZZ3A 4N42A 1LQ2A 4C5ZA 3DFYA 4O12A 4PUMA 5XIMA 1S5NA 1VYSX 3E0LA 2VWTA 3L7RA 1E6RA 3N2OA 1OT1A 3BAIA 4URIA 1XXXA 1XFCA 3A9BA 3B04A 4ZO6A 1RJRA 4QLLA 3FXGA 2CNCA 2W5FA 4DYJA 4HSOA 3KDNA 3AROA 4DF2A 3IVUA 4DJFD 2OYKA 1OCQA 5HNRA 5CJNA 4I90A 1IHIA 4KFPA 1B57A 2JEQA 3GDMA 2CLIA 2XZ7A 3OQEA 1S5WA 1CXHA 4XD3A 1EF2A 5L9FA 1VFHA 3GNOA 1XV8A 2XVLA 4EWND 1KTCA 5C9RA 2P3EA 3PBWA 1M7OA 3WQVA 1GVSA 1EOMA 4DQWA 1X6LA 4K1GA 4B92A 2QUTA 3EWZA 4PC8A 3WF0A 4BQ4A 3E2VA 3KWSA 3LXBA 3H8AA 1JPKA 2B7QA 3EX3A 1EZ2A 1FWWA 1OG0A 3W87A 4BF7A 4P7OA 2PBOA 1ZPTA 5C54A 5TD4A 4W8AA 1GNXA 4DJDC 3IACA 5A95A 1ZCCA 1DPMA 3EEGA 4PCPA 2WZTA 3FSTA 1F7BA 1ZGDA 5LHEA 1KCXA 4NT0A 2A3CA 1HW6A 5LA1A 4Y9AA 3NQCA 1VCGA 4Z2JA 5DF0A 1CECA 4Z17A 1U5HA 5AYXA 4L9XA 3CZ8A 3WQ4A 5I79A 1SZGA 1LBLA 4PUNA 1W9PA 4UQDA 2ZUNA 1XPGA 4AY8A 1KRBC 3AHXA 5BRBA 3CUIA 2OX1A 3B3DA 1I4NA 4G2DA 3LCLA 1H0GA 5FD0A 3UZXA 4AHPA 1JPHA 2VDGA 4M7SA 2DZVA 2VWSA 2DZUA 2P3ZA 2WPGA 2E40A 2FPTA 3W0KA 5EB8A 2DJXA 1AJ0A 1GTEA 1RXOB 3AYTA 1L6WA 5K9XA 5JH1A 3II1A 1QASA 1M01A 1PIGA 4A8IA 1XLDA 3TSBA 5D30A 2ZE0A 1X6NA 1KBBA 3VIMA 5CJ5A 2X2YA 3KDOA 3URNA 5FL1A 5D33A 4WHBA 2I5IA 2YLAA 2J7EA 3KVKA 3ARZA 3W70A 3A4XA 1YW1A 4ADSA 5I78A 4E8CA 3EAUA 3QQ1A 3DBPA 3N9SA 1TR9A 3OYXA 1DP0A 1TMQA 5DEZA 4H6EA 3PG9A 4EXAA 1DTUA 4C6LA 1A0DA 3AIVA 1VEPA 2V5LA 3O7UA 4HPHA 3B0PA 5E93A 3SN1A 3T2QA 4DUXA 3C0QA 3BO9A 2Z1WA 1NWUA 4DO6A 3VCCA 3EWBX 4QJ1A 1TX0A 3LPOA 3PTQA 3AMDA 1LG2A 1WKFA 3CV7A 2HRWA 4PMNA 3IJIA 1O94A 2G97A 3NTYA 1W2PA 4O11A 4NUWA 4Q8VA 2C7FA 5ABFA 2WK2A 3WLLA 2V5CA 4JIRA 1WA3A 1DXIA 1ISVA 4Z2KA 3KL3A 2E1WA 4C6CA 1J6OA 4HNLA 2X40A 2Q71A 1ALDA 3NOEA 1HKIA 3S4TA 1K7FA 1NWSA 1Z32X 3IJDA 5FEZA 4IFKA 2NT0A 3PPHA 3AUOA 2EG6A 1DV7A 3OU8A 1MRAA 2PGEA 3WEZA 5I0DA 3TSDA 1UPMB 2QZRA 5K9DA 2O55A 1BGGA 1NTHA 4RXFA 3AQUA 4JTSA 5BROA 4U33A 3ECQA 1F07A 4F0HA 3EX4A 3POCA 4CEUC 4MPKA 5C7VA 3PZ9A 2ZCGA 4Y9PA 1V3JA 3UA3A 3MUAA 2E77A 2WWCA 3H2FA 3NZRA 2YB4A 4U28A 1TVNA 2OOFA 3P62A 3PB0A 4M6QA 2XH7A 3N4EA 4PTMA 1S5TA 3AU2A 2G4FA 5CPMA 3M0XA 3R94A 2BNJA 3TYZA 2WM0A 3SQLA 1ISYA 1K6AA 1ZUAX 4RLIA 4UTJA 1G4EA 3BC9A 2PGRA 2J7GA 2TAAA 3P93A 3ZT5A 3T6CA 4QSFA 4Z0SA 1V93A 3DN5A 3W88A 4DBEA 3NQ7A 1UKQA 3E74A 3LCIA 1R3RA 5FF3A 3EMQA 2PDQA 3GBDA 3A9IA 1R3SA 1R2RA 1Q6EA 3M43A 3VXGA 3I7SA 3T40A 1XUZA 4CU8A 1EPXA 2YL6A 1E4NA 3PWIA 2QLYA 3KX6A 1EWEA 3CO8A 5D2VA 1G4SA 3NURA 4LB4A 1TA3B 4JR5A 1JAEA 1P6CA 1KTNA 3NCOA 4KW2A 3N19B 4E4FA 4TOQA 4IHCA 3VDGA 1EQCA 3JZUA 4JDYA 1LBFA 2EEXA 5G2HA 4UFJA 4HP5A 1ISZA 1H09A 4QG6A 3U6WA 3UEQA 2FTPA 2CIPA 1I2NA 5EMYA 3VIOA 5C2XA 5I06A 4JYDA 4W7UA 2CZDA 4HNOA 4FF5A 2CXEA 4GQ0A 2QAPA 3MWCA 3N2CA 3MHGA 3EXRA 3L12A 3LSBA 1KFBA 1E70M 3TH6A 1YKWA 4YTSA 1XD0A 1GQIA 4PGLA 1F74A 4GRSA 2B81A 4MB3A 3K5XA 3AXHA 3U5YA 3SY1A 4S3FA 4B5SA 2Z7GA 3COTA 1OB0A 5EFDA 1SW7A 4DYKA 1J96A 2AKZA 1JQXA 1SZRA 3LTPA 2WBKA 4GJJA 5AHIA 4DJDD 2A79A 1BLIA 1BGAA 3NPVA 1QOXA 4O1AA 3OA5A 1ELSA 2VO5A 1XISA 4GX9A 3QRHA 2F84A 4PMUA 4FMVA 3M0VA 2PLMA 2CZEA 3FJLA 3FAXA 5AC7A 1VKFA 5A8NA 1V4YA 1CB2A 3ZT6A 3SY5A 4H6QA 1EGMA 4EKJA 3MANA 5I3GA 3TYBA 4KIRA 1ITQA 2Z4GA 2IKHA 5A5WA 1BWLA 5LIUX 1LCOA 3TYEA 1TMLA 1JUBA 2REQB 2VRKA 1ADDA 1UZ4A 2BV9A 3DX5A 3QJAA 2O9TA 1NDVA 1VLIA 2EKGA 4R53A 3W85A 3WH9A 4IMFA 1NF0A 4PULA 4WKAA 2EG7A 3U7BA 3GG0A 5IOBA 4RE0A 2Y1HA 5D4YA 3W7JA 3EDDA 4DO7A 4OV9A 2H8ZA 4N9EA 2JGQA 1TCDA 1TJ0A 4HOWA 4GIRA 2QR6A 2D3NA 4PMYA 4ERGA 3E5PA 5CSYA 1PPIA 3VK5A 1GTHA 2WJFA 3UVIA 3WJXA 4W8BA 3BMXA 3CAQA 3R79A 5BYWA 5HR6A 1NDYA 2C14A 4RW5A 2DZXA 2PZ0A 3ITCA 1DWGM 1P0EA 3NQBA 1T0OA 2EO7A 4O16A 4IGNA 1CNVA 1NOFA 3VCNA 1ISWA 2Y61A 2DZSA 3NO1A 3F03K 4S1FA 1ZAIA 1OVDA 3HFTA 4TQTA 1LYXA 3WJYA 3W82A 2ASHA 1KD0A 2NV1A 4YS1A 1R6WA 2BLEA 4WRHA 2ZZ1A 1UR1A 1SW0A 2V6AA 3ELFA 4L61A 2QMJA 4GBDA 3HTWA 2TODA 3KS6A 3S0CA 3CUFA 3KVMA 1AQ0A 1VENA 4TV6A 1PTGA 3U7VA 5AHFA 1PCWA 4W5ZA 4WDXA 3HBLA 2V30A 5LNSA 4LVBA 4RV3A 5A8MA 1TIWA 1XH1A 4M24A 2PU0A 4M5PA 2FQIA 4AC1X 1YHTA 3MWAA 4B5VA 2E8ZA 3WL1A 3NYZA 2XWDA 4NHVA 3VOFA 1YEYA 3DC8A 1R9XA 1QPKA 3G0SA 1U5JA 1K3UA 1WZLA 2E6DA 2VXNA 3NQ2A 3W7MA 3ARVA 4PMRA 3GO2A 2H3DA 3WJZA 3BW4A 4J3XA 5D8ZA 4CGTA 3S47A 3R10A 1SR9A 3DYMA 3BLPX 3IEBA 5IM51 2ZZ5A 2YL5A 4XKYB 4HN4A 3RILA 1RSCA 1DJZA 2J7FA 2PDKA 4ZB0A 3KBVA 4IIDA 3FOKA 4XZIA 5EMUA 1MXSA 2F6UA 4WVXA 1JUKA 7TIMA 1RQHA 1XIIA 4LWWA 1OYBA 3PC0A 1L2UA 4L1GA 1AMYA 2YW3A 1ZJAA 4RV8A 4AD5A 1LQAA 1J10A 1VZWA 1U1JA 5EMLA 4L6HA 3L23A 4LYPA 1OFBA 2G3IA 3OOQA 4ZE4A 3W7HA 4O15A 2A7NA 5CGTA 1MFUA 4JTKA 1MRQA 4EK7A 3W7QA 2PUZA 4UIOA 3NWRA 5BOFA 1K9FA 2EJ1A 2R82A 3LQGA 6REQB 2OO6A 3ZWTA 3USZA 2V5BA 2PA6A 5FJPA 2DVTA 2XGBA 3ZFHA 3W7RA 1FY6A 5BMXA 4NI3A 4DB7A 2BGSA 3THAA 2HJPA 3WN6A 3OZYA 4PEEA 5JXQA 1WOBA 2PWHA 3N6QA 1JPDX 1EIBA 4TX6A 5CAKA 4JQ4A 2A4AA 3W29A 3W01A 3S6DA 3RU8X 2JF6A 4O8AA 1K9DA 4NX0A 1XG3A 5K4XA 4L9ZA 4S3AA 3G1XA 4AW7A 4DI9A 3U3HA 1H5VA 4MKNA 2D2HA 5FAJA 3UFYA 4X2RA 3GVGA 4EAYA 3DYPA 2PC4A 3GKFA 1PYMA 2EPMX 4JEJA 1DYSA 3CV2A 1AD1A 3UZ5A 1Q45A 4ZXOA 3UZWA 4JFVA 1Q6LA 2ISFA 1W9DM 3APYA 4GIYA 4N9DA 3S2MA 3H2CA 3K8LA 1PCKA 3CAWA 3D47A 1G0CA 4YHEA 2FDSA 5EMJA 3RO8A 2Z27A 3IJ6A 3T0AA 2YIHA 5I2UA 1B3ZA 1XLHA 1E1FA 1JEZA 3D5HA 3GHTA 1VPXA 4UOJA 4LH8A 3NZ1A 3HGSA 3CV1A 2YXGA 5T26A 4Y8FA 3WLJA 3GNNA 1KW1A 4AYSA 4S3KA 3LHVA 4ERIA 3EXTA 2DSUA 4G7FA 3O07A 2XZ9A 2IKGA 1F05A 1RQEA 3FAWA 1OM0A 2A3AA 4IL2A 2RUSA 1FHLA 1V08A 1LWHA 2GLKA 1BXBA 3SQMA 3KRUA 1F5ZA 3RGTA 4D6CA 2J9ZA 1DJXA 4QDPA 1TA3A 3ZSSA 1VFTA 3GDRA 3ABOA 1T96A 1TMHA 1XR2A 3NR0A 3GU1A 1Z8AA 3NQDA 5HJXA 1ECQA 1JI1A 1H7RA 3OVPA 3S5OA 4XSMA 1ONRA 1VHNA 3L9CA 3A21A 3IUHA 3SM0A 2GL5A 3GAYA 4YXGA 1D2KA 4YN5A 3N4AA 1G9HA 4YL2A 5FEXA 1QI5A 4WR3A 3VE9A 2HEJA 3RU6A 4CD4A 3QY8A 3TCSA 2NXHA 3PUDA 3BZJA 1RR2A 1UQYA 3IJLA 4UOZA 6CGTA 1FWFC 1NQ6A 2ZX9A 5F1VA 1LQ0A 2A2IA 2F2KA 1JZ7A 4PUJA 4BKNA 3THCA 4F2TA 4WEVX 4M1RA 2F2HA 3BANA 3IAPA 3U2EA 5HWMA 3VIFA 1B1YA 1A3HA 2OTDA 1B3VA 4FR6A 5CCZA 5AYZA 4MADA 3VIGA 3AO0A 1PHWA 4L6OA 3JRKA 3V7PA 4JTIA 4B4FA 4CQ8A 1H62A 2ZRXA 2EPNA 3VGFA 1BTCA 5A6KA 5CC6A 4GFIA 5M1TA 3R0KA 5LSMA 3DENA 2ZOXA 3EPOA 3SFWA 1U1HA 1EBHA 5F2LA 3EA2A 4JIEA 1E71M 1Q6DA 1YIXA 3P7YA 1W0MA 4TUFA 1OFPA 1WKYA 5HQEA 2I5QA 3TWAA 4PB3A 3KRZA 1Q6CA 4MWAA 4IXHA 5I00A 3QR3A 2ABBA 4FX7A 7CGTA 2NSXA 2FIQA 2XTKA 4WQ6A 3ITTA 3CUZA 1IEIA 4MB1A 2W3ZA 1LWJA 1S2TA 3NL5A 2Q3OA 1UCWA 2G0WA 4DBSA 1BFNA 2NQ5A 1YDOA 2ATMA 3ALFA 3VZZA 2OGJA 4UZSA 4MUPA 5H2ZA 4DYEA 1HKMA 3STPA 3WG6A 4EANA 2EBNA 4PCTA 4EF9A 2HZGA 1W91A 4MKSA 1GQJA 1N8WA 5EU9A 1CXFA 3LBOA 3LERA 2X1IA 4JIHA 5I3FA 4IZGA 4Q4QA 3TTOA 3W71A 5FL0A 1Q2RA 4H3DA 2BXVA 1JDAA 3WQEA 2I7GA 4OJYA 2PI6A 3UWEA 1DWFM 4BF5A 3KBSA 1XC6A 1ADSA 4OKDA 1SO3A 2PPGA 3MT1A 4CN1A 3N9RA 2PDFA 2BVDA 4A4AA 3UNTA 2XHYA 3BTNA 3MUY1 3BOFA 1HNYA 3C4UA 3DG3A 4NU7A 1VBJA 3A12A 2NW0A 1B0IA 3OLEA 3BURA 1FTXA 7PTDA 3YPIA 1UYQA 2B7OA 3LENA 3AS0A 1GHSA 1IWBA 5HPOA 3N9KA 1OY0A 1MDRA 2WVVB 1HKVA 1M7PA 4KKXA 3M1ZA 4PBFA 4A3UA 3EKLA 4JKKA 3VX0A 3OLGA 4CN6A 1PIFA 2CKSA 1A5NC 4PTVA 3AHVA 4HHMA 4KT2A 4EE9A 4N6EA 4E2OA 1E6NA 2RDWA 4QHRA 2YA1A 4QM1A 1F3WA 1W3IA 1S2WA 2X8RA 3DHUA 4P8UA 4HA1A 4GC4A 3NQVA 2RJGA 2GDQA 3DHFA 3OEXA 3H23A 3Q65A 2CHOA 1X7FA 4LU0A 4XKYA 2VZUA 1N55A 1WV2A 5A6BD 1MDLA 4GQQA 3SDOA 3T08A 3FGCB 1RPKA 4NI8A 2OFJA 1SPQA 1X96A 4E2BA 3FYPA 1QW8A 2QAFA 1CLXA 1DIKA 2FGZA 4MOZA 1LZOA 3O16A 2WKLA 3G0UA 1A5SA 1HJQA 4LC8A 4V27A 2Y89A 2ISDA 3KE0A 3GDTA 1RK6A 2QYGA 4QNEA 6REQA 4MMWA 1UR3M 2C8NA 4ATLA 4E2VA 3A4AA 4A3YA 1TV8A 1XIHA 3THDA 2OZ8A 3GW0A 2UBPC 3G6LA 1JNDA 3E02A 4HMCA 1O1ZA 3VGGA 3FDKA 3WUFA 3HN3A 2G37A 3N2MA 5A8QA 2VEGA 2WPBA 3SFKA 3PWAA 1WDDA 2H9AB 4IXXA 3T0CA 4UTTA 2XH4A 1QR7A 3VOJA 3WLSA 4UTKA 1A5BA 2OZTA 2YXOA 3GNRA 4OGZA 1QI2A 1FVPA 1OHLA 4M8UA 1TV3A 3PSWA 2NSOA 2EG8A 4DLFA 1RZMA 3C61A 2DW7A 2W79A 4F9DA 2XIJA 2BWGA 3QPYA 5BCAA 2OWXA 1XCXA 3S8HA 3LHTA 4GLEA 5E70A 4Q4PA 4Y9OA 4NYUA 1R5YA 3WDHA 5FJRA 3ZR4A 4FOUA 4B9ZA 2ANUA 1OYCA 3AJ7A 1UWAA 4H41A 3S1GA 3P61A 1UH3A 2FTYA 3V18A 4KRTA 4NL1A 5K2ZA 5CG0A 4O1DA 4HPNA 1RLDA 3LSCA 4XAFA 3T81A 4I3GA 3RM4A 5AOUA 3CQJA 5F4SA 1FCUA 4Q4RA 1EIXA 1BYAA 5EFFA 1ECEA 2RDXA 1EO5A 1OF6A 2NVCA 2XIBA 3BAKA 1J0JA 1KLYA 5CAHA 4RZ4A 1C90A 4IFRA 4KF1A 4GJ1A 3GDBA 4DJFA 2BOGX 2XN0A 3W27A 4M0XA 3S9ZA 2C13A 4AZCB 1E9IA 4Z1CA 4FA3A 2V82A 3B0UX 4PEKA 4ZB2A 1L2QA 2FFCA 2VC6A 2GVLA 3S3GA 2CBVA 1S46A 1A5CA 4OZOA 2V3DA 1A3WA 4LVGA 1RA0A 4JTTA 3U9IA 3CV6A 4QSHA 4P61A 5E9AA 3K30A 2RFGA 3M07A 4E8DA 1VQTA 1UOKA 4RL3A 4C6DA 3RJYA 3BMVA 2C3ZA 3TCEA 1G7VA 2P8CA 4YTQA 1UA3A 1M5WA 3VNZA 3TQPA 2QCLA 3R25A 4H8UA 3UETA 5A6MA 3F4CA 4LVAA 1DWJM 1M04A 2J88A 2QV5A 1UBPC 2QT3A 4Q8PA 5HMEA 4J40A 4YHGA 3NGFA 1IR2A 1LLZA 5AHNA 3W76A 2B7PA 2ICSA 2CLKA 2OELA 3LRMA 3RN6A 3J7HA 1AG1O 1UH4A 4NNAA 1H0IA 1WKEA 3K1GA 3MBDA 4ZSUA 3FVDA 2QV4A 4D71A 2BTMA 3QEZA 3W81A 4JTAA 1XL9A 3T1GA 1RHCA 1KM4A 1UWRA 3P80A 3W7GA 3LN3A 2A5HA 1E0TA 1FWDC 2VR2A 2NT1A 4H04A 3C2FA 4ZOAA 4GX8A 4CNUA 3MSDA 4DXXA 3P5ZA 4XBSA 1F4HA 3MYOA 3NPXA 2CHNA 1GOMA 4X61A 1WPCA 2WC7A 3RAOA 2XGIA 3G8RA 4CQ9A 4NRSA 1H1YA 3T4WA 4O8RA 4DF0A 3VIPA 4S3DA 2QUNA 4QE5A 2WNZA 2VHLA 1PKNA 4DN1A 1EA0A 3WKZA 1AODA 2ZUSA 3F4VA 3W6MA 3ATZA 2PWUA 3UA4A 3VC6A 4J9JA 3DZ1A 4HNCA 1PDYA 4X60A 4J3UA 5IBXA 4FOKA 4XSLA 5LNRA 2CPUA 1VHCA 4XX6A 3ZQ9A 1UROA 1B9ZA 3ZJKA 5CPNA 3PAOA 3EYPA 3FN9A 1OINA 1J0IA 2QS8A 4BI6A 2J6VA 4QXIA 5CG7A 1Z6KA 2OYMA 1XBYA 3L4XA 5HBFA 3TFXA 3PVFA 1IZJA 1XLKA 1VFSA 1EO7A 4ZVJA 1T6MA 2R91A 3PM6A 3APTA 4OECA 1W3JA 1KV8A 1RJQA 2F38A 5IDZA 3KEHA 2INEA 1U30A 2D0HA 2DSVA 1QNRA 3W7PA 1B9BA 3NL6A 4D8AA 2CBIA 4Y7EA 1E6PA 4WDUA 1TPC1 3INPA 4YU1A 1XSKA 3O9NA 2OG9A 3N34A 4D72A 2A3HA 4CQAA 2J9YA 1I60A 3O6AA 1PZ3A 2WVVA 3W84A 3H6OA 3B06A 3DGBA 5CSSA 1MO0A 1JZ3A 4CNNA 4QJ5B 3MSRA 4JIPA 3G1YA 2PDUA 3C5QA 4MZ8A 5K3VA 2J8TA 2PDPA 4U5IA 1L6FA 4EXBA 3BH4A 3EX2A 3P3BA 5CKSA 2CITA 4I5RA 4KEVA 4L1XA 2FDMA 4JFTA 1YNPA 3MSYA 4EPEC 4TMBA 1EX1A 3W00A 3A3XA 3E5BA 3CMJA 3TN5A 2VTFA 3VDAA 1WOAA 2VEPA 4YVXA 3GIPA 3VX1A 4CUCA 3D3FA 5K7JA 3WLHA 4YJ5A 1WB0A 1T41A 1GEHA 1JVNA 2YFNA 1YX1A 2PWEA 1DEDA 1F8MA 1F6PA 1RAKA 3HZ3A 4H9TA 3UR8A 2MUCA 4KEMA 3M7SA 3WDPP 3WSUA 3FGCA 1UZ1A 2BSLA 1UKPA 2WHJA 1GVIA 2WOQA 3WD0A 5FEPA 4Z1DA 2ACRA 3R1ZA 4C6FA 2WNQA 3NL2A 3RLVA 4UWMA 3QZ6A 4K7VA 2ZICA 2WJDA 3WUEA 4H83A 2EGZA 3AIQA 1HX0A 3GH5A 1TZ9A 3M6YA 3ZYZA 2IXUA 1SMAA 3ZJ8A 1KTBA 4BR1A 1KBLA 3NIYA 5C55A 3GVRA 3CQHA 1EP2A 4RE2A 3AZSA 2WXDM 4IPNB 3B9NA 1ODUA 3QTPA 2XINA 1D8CA 3HG2A 3T09A 6A3HA 3CHVA 2BZNA 1WBHA 4IH3A 3CPUA 4ZE5A 1B3WA 1PYFA 2VD8A 1OFDA 4GUFA 4EOUA 2VZOA 4ZR8A 2AAMA 5HXMA 1R3YA 4WIWA 6XIMA 4JICA 1VR6A 4FX6M 1RCOB 3W6LA 2F9RA 3QV7A 3VGHA 3QGVA 3CWHA 2H9AA 4UQEA 4IIGA 1M7JA 1BAGA 4BI7A 2B4GA 1JCJA 5I23A 8XIMA 2IQDA 3B0VC 4GXMA 3LB0A 4DJDA 3MVIA 2NWSA 4FX8A 2GJLA 1UW9A 2DT3A 3P67A 4H9ZA 4OBTA 4ZA0A 3WF4A 3W86A 3CIXA 1W9UA 4OIFA 4O18A 3RNDA 3HG5A 2UZ9A 1W1PA 1QBAA 5CQ1A 2A6LA 2OT1A 5J04A 3LHYA 4C6KA 4NSBA 3VKCA 3RK8A 3S42A 4ICNA 2VFDA 3PZNA 3DFQA 1NP2A 4LBRA 4C5YA 4C6OA 4Z2HA 1GKQA 3BDKA 3DC0A 4FK9A 4K6AA 4E3VA 2X2GA 3PWGA 3WNNA 2A3EA 4TIMA 2E68A 3WBXA 4AEOA 3ZMRA 2C79A 3M5VA 5DBTA 3TTYA 3B4YA 1KNWA 1IXPA 2D73A 3MJMA 4Z2LA 3VD7A 5D05A 3H54A 4Z08A 4LANA 4MY1A 2VENA 2OODA 1VEMA 3MDWA 3WNKA 1ITUA 4ZOBA 4ATWA 1V5XA 5AHLA 1I75A 2ZRUA 2DT0A 3QPEA 4YCOA 4O1BA 1YE4A 1H51A 2HSAA 4DM1A 4LS2A 3BVJA 2OWWA 2P53A 4F8XA 1MWOA 2PWFA 3MCNA 2W61A 1R30A 2YW4A 1Q4WA 1J0KA 1TR1A 1TWIA 1GQNA 3B8WA 3SBFA 1Q63A 4PRTA 1LG1A 1OK6A 4L56A 3C2RA 1UR2A 4AZCA 4MZYA 5A6LA 3I3EA 3TA9A 5C9UA 2VJXA 2SFPA 4JN8A 4KWWA 3GDLA 3M0IA 4HYRA 3CH9A 4GO8A 4IX2A 3ID7A 4FXSA 1OBAA 4ACZB 4FNTA 4BA0A 1HJXA 4Q6JA 1AD4A 4XWUA 5BOOA 4MG4A 3EOLA 3T0BA 3L0GA 1E72M 4AZIA 5JVLA 2WB5A 2WAGA 1XQKA 1UD8A 5C7HA 3Q37A 4LF2A 4D1JA 1RCQA 2EQDA 2V5DA 1DJQA 1VB9A 4W7VA 2ZA3A 3LCFA 1J18A 4R9OA 4PTDA 4JTQA 1XSIA 3HO8A 2OZ3A 5K9CA 4GBUA 1E1EA 1DIDA 6ALDA 4JTLA 2Y5SA 2VL4A 4HGXA 4R85A 4PMOA 4Z2IA 1CBGA 5G1TA 1OC7A 1HJSA 4IMDA 3I4KA 1F9CA 3QXBA 1G4PA 1EDGA 4WK9A 3C2EA 3PBVA 5CC5A 1QBBA 1I8JA 2YJQA 3WMLA 2QGYA 1YXCA 2HWGA 5G4WA 1KM0A 3L5AA 1XCWA 1GEQA 4HZ8A 1M3UA 3UWWA 3M41A 3KZPA 4XZWA 2Y7EA 2ZUTA 4H6KA 5JIWA 1QWGA 3K2GA 2NUYA 4B2DA 3FY1A 2JQXA 1PDZA 1SZNA 4UFLA 4JOMA 1UQZA 4AD2A 4C6JA 2GJXB 3K4WA 1KCLA 1MI3A 4MDPA 4OHQA 4GMEA 8A3HA 1FDZA 5AHEA 5I07A 3TTSA 1P48A 3SGGA 2YZRA 2WCGA 3UQNA 1YMYA 2OEJA 5GPRA 3B8TA 1VP5A 1FCBA 4O14A 4Y90A 5JH2A 1QHPA 3DG7A 3NGJA 2FZ8A 1NFPA 2L5HA 1LORA 3R4IA 3GR4A 1HL9A 4DZ5A 4J5NA 5A94A 3W38A 4M29A 3D0CA 3KL5A 4K2SA 4NZFA 1T8XA 4C6IA 2VGBA 2FHFA 2DUXA 1UC4A 2VVNA 2ZRYA 4ZSTA 2QW5A 3SUTA 2WZEA 1QU4A 2XG9A 2V5JA 4CD7A 4C6NA 3OP2A 1WAUA 4U5KA 5CC3A 1OSEA 4JL1A 2FGBA 4W86A 2WVUA 1M68A 3TK7A 3F2CA 4C7FA 1B3YA 4W84A 1A0EA 3IV3A 1TPVA 1QWKA 1WP6A 3O0FA 4O1EA 1D3CA 3R11A 1G69A 1BXCA 5D2WA 4O0KA 3BWWA 4PMZA 3UGRA 1VPYA 2XWEA 3IIXA 4LCRA 4C6PA 3JZEA 3I3DA 2V2CA 2XM1A 3N3TA 2ZE3A 3AYVA 4QQ3A 2PAJA 4DWSC 1O60A 1CGWA 2DVXA 4WX2A 4PTWA 1POKA 1SJAA 4R7JA 3URBA 1NELA 1VD6A 3GXIA 2VNCA 3TE9A 1GVEA 4UC5A 1W9VA 1P1MA 2DFAA 3GXNA 1ZALA 4I5UA 3FV9A 4XZMX 2HNHA 1BVWA 3L4YA 4FAMA 1TUXA 3L4ZA 1R87A 2QCFA 1X97A 3L2IA 5J8LA 1FCVA 1PTDA 4ZZ9A 4M7TA 1JCMP 3RPMA 4JHMA 1KFKA 2Q6ZA 2GPTA 1BXNA 5CJMA 3LU2A 1J01A 1CPUA 1FCQA 4GABA 2V3EA 3MUZ1 4LCQA 3WK1A 1W3NA 4QDMA 3MA8A 2NV2A 4O53A 4HQVA 3W1XA 3ONCA 3QN3A 4D2JA 1HQTA 3W2JA 3TZFA 5I6SA 2WC4A 1SJBA 1AW2A 2QPSA 5CBBA 1Z41A 3F5KA 3PPFA 5GNYA 2ZKMX 2X30A 1W1B1 1SYTA 1TYGA 4AWSA 5HJLA 5E6ZA 2PDGA 2GSHA 1I1WA 1HL2A 2CC0A 1A49A 3GR8A 3ZOAA 3FHAA 4U2YA 1M65A 1Q6QA 3MBFA 3N04A 4E0CA 3QQWA 1PZ1A 1KBJA 4CQCA 2OX4A 3VYLA 4DPPA 4P5UA 4B90A 3W73A 3VABA 3B40A 1S39A 3OVQA 5F1UA 4UCFA 5C9XA 3AYRA 1VJIA 1BKHA 4V33A 1BQGA 3WH7A 2VOTA 3PG8A 2GSJA 3P74A 2GQ9A 1P0KA 4I6VA 5LXXA 3EA3A 4KIEA 3VGDA 4BI5A 3LNMA 1W5PA 3JUGA 1D8WA 1H50A 1XRFA 3ZR6A 3WLKX 4B5TA 4GNVA 2BVTA 5M2FX 4L4LA 3WFLA 3IIVA 2PTDA 4QG9A 1GOOA 4PUWA 4EPDC 1Q13A 3WH8A 2OLAA 1L6SA 3L4WA 1V7AA 4HHPA 4RNIA 3POHA 5D9OA 4O13A 2V67A 3C8NA 3TJIA 3SN4A 3ZSTA 1KR0A 1AZ1A 3AXIA 4HPXA 1TKKA 3TC3A 2ZC8A 3FIGA 1UKOA 1XBZA 3CHEA 1LDCA 1T5AA 3TA6A 3ZR5A 4LQ1A 1JCXA 4RNFA 3KP0A 3PPCA 1B30A 2DH2A 4JS3A 1R2TA 3GU9A 1XUUA 4CCDA 3LDVA 3S2LA 4ZOEA 4LY4A 1ZP3A 2Z1BA 4TV5A 1SM9A 2MANA 2WZHA 5U4NA 4HOZA 3OZOA 3U0HA 3QR1A 4R7OA 5C9ZA 5G1MA 3L0KA 4AVNA 1TTQA 3N6HA 4AZ5A 3S5YA 3IK2A 3R2GA 3OHIA 4RDWA 5EL1A 4AEFA 2Z29A 1YBQB 4XKMA 1AH4A 3UPMA 4NZCA 2FH8A 2YLLA 4RDZA 5HANA 3KCLA 2O9RA 1MQPA 2CZVA 3CGTA 2Z28A 4WGHA 2QF8A 4ML4A 3LK6A 3U2ZA 3WDQA 1SR0A 1V3MA 4JL2A 4JX4A 5AC4A 1UD2A 1LBMA 3AALA 1C7SA 1QT1A 2X16A 3ABSA 1K8YA 4V1XA 3DFPA 4OUEA 4KETA 1US3A 1PAMA 3ABQA 1J11A 3GTIA 4Q4OA 1CX9A 3NAVA 4IMCA 3LCXA 1EKOA 2PGFA 4JQ1A 2ZXBA 2QIIA 4U4MA 3PZMA 1JF6A 4JTEA 1OX4B 3MVTA 4FIRA 2J75A 2YCEA 5HMSA 3B8VA 1IV8A 3BLKA 3EBVA 4XBJA 1UOZA 1A53A 1TREA 1UR4A 1XYMA 3CL6A 4DEFA 1VIZA 1YDVA 4R9XA 2D3LA 3VIKA 4N6FA 3ES7A 4QS6A 3GLCA 2NX3A 4AUBA 2YBUA 1GQLA 3EB2A 4ACZA 4HIBA 3PZIA 3TR9A 1ZTVA 3URAA 1R0MA 3V3WA 5D8WA 5BNKA 3UJFA 2BX7A 3WUBA 3C0LA 3CHCA 1GZ1A 3LUTA 2YA2A 2YGYA 3G18A 1GOKA 1JGIA 3SJNA 3FDGA 4LCSA 1TFVA 5CZ0A 4LC6A 4MJ2A 4C1KA 1UMYA 3CT2A 2VT0A 5KZEA 4KFOA 3QV8A 4GVHA 1E40A 1VRDA 1X6UA 2YCKX 2BY3A 4AH7A 2IKIA 2PWDA 3IGXA 4U3CA 3CUXA 3IRSA 4UTLA 1ZQ5A 4DWSD 1AL8A 3KBNA 3F2DA 3W53A 4LB3A 2PSNA 5DANA 5HMFA 5I5RA 1TPH1 1TQXA 3W1LA 4B5NA 5F2IA 2Y8VA 1F3TA 1VIWA 1NFGA 1Z44A 3V35A 1WXZA 2ISWA 4DLMA 4GVGA 2YZ5A 3SCUA 1W56A 3QW3A 2PTWA 5AZ1A 3OO2A 4HD5A 3RMJA 4FF7A 4AZHA 4KCTA 3I7RA 5F4XA 1H63A 2JEPA 3HGJA 3M0HA 5A6BA 3AS3A 2VEFA 4ZQPA 4YVVA 4UNKA 4NZ3A 1XWYA 5HPCA 3CUHA 3W1UA 4ZMGA 4UFHA 2CZ5A 1PTAA 3BG9A 2C18A 2VYOA 3KOFA 1GWJA 2XPKA 4MJMA 3LYEA 5D38A 3KXQA 1Q6OA 3TV8A 3HPAA 4AF0B 2HE8A 2I56A 4XZBA 1ZZMA 3MCOA 3VDBA 4B5UA 1HG3A 2BY2A 1IWPA 2INZA 3EDJA 2OQYA 1WX0A 3TLQA 4L1WA 4P8XA 1QNQA 4PRRA 1VEOA 1V51A 3ONBA 3SCSA 1JXJA 1C7TA 1XDJA 2QDEA 1E0XA 2D1ZA 1IIGA 3N3MA 3VZXA 1CI1A 1TPEA 4H19A 4QROA 1E6QM 3CT7A 4P8WA 1NDZA 1SO6A 3THQA 1HVXA 1XLJA 3ZJ7A 3H24A 4W85A 4MUZA 3DHDA 4ADTA 2HPMA 2UY5A 1QI0A 1B31A 3STGA 2XH0A 4EWJA 2PS2A 5IFPA 1B3XA 1HIZA 4LVFA 5H8MA 3W2LA 1EEXA 3CUGA 3MMWA 4J27A 1EX5A 3AZTA 2OB3A 4LW7A 3WFAA 2X05A 2GGJA 5HNNA 2IW0A 1O5XA 2O0TA 1J5TA 3PZVA 2WSRA 1V3HA 3U4FA 2HDJA 1J6PA 3QTGA 3N13A 4HCHA 1XYLA 1QFEA 2EXOA 1HJVA 2HXUA 2DORA 3CQKA 1DHPA 1X1ZA 2EPOA 2Z1KA 3NSNA 4QE1A 3SECA 4BZYA 1J12A 1IEVA 2Y7FA 2YYUA 4JHOA 3VMPA 5KETA 2QEZA 3GE7A 1Q65A 1WDSA 1VC4A 4B3KA 1LTDA 2VZVA 4HK7A 5EBUA 4KGJA 1BRLB 4UTMA 4ZOCA 3BGJA 4AYGA 3BLOA 3GFZA 2DW6A 3S2CA 3UXDA 3LLDA 1EHNA 4MPQA 1SSDA 3XINA 4UQAA 1EGVA 4UXDA 5H8PA 1QPNA 1S3HA 4S3GA 5HMDA 3G1SA 3DYOA 3FHQA 3NM3A 3NG3A 4QAIA 3DKLA 4QDWA 1V02A 4MYAA 4LF1A 4HPJA 4BEUA 4AXKA 5G4HC 1M6JA 3HV8A 2PLCA 1JQVA 3IIPA 3JVAA 5BMWA 4FNRA 4D9PA 3CQ0A 3EDFA 2HBVA 3AIBA 1FKWA 1NIUA 4XZNX 4LS0A 4IJRA 3VKAA 2GUYA 4MJ4A 1X1NA 3WLIA 1US2A 3W83A 1NY1A 3H2OA 3OIHA 1BG4A 4GI4A 3KCJA 5ABTA 3DU0A 3RG6A 4WF7A 4NX5A 3DOPA 3MHFA 1HVQA 1QPRA 3GNXA 4K1WA 1GCYA 2FB3A 2WNNA 3IPWA 3OGRA 4P8VA 1JYVA 5AHMA 4C6QA 5JQ9A 1EXPA 5EMKA 1PZ0A 3L5LA 2NZLA 4Q8OA 2QQ6A 3HIJA 4C65A 4HK5A 3WQ5A 1KM1A 1PWMA 5C2CA 1EYWA 3LS9A 3H2EA 2X1UA 1GW9A 4IX0A 3MUIA 4N9CA 3OLIA 4WLCA 2QXWA 1LWIA 3LD5A 3A22A 4GYFA 3T42A 2KZHA 1XCFA 1RJPA 2VELA 3KBWA 3AFBA 1H61A 5D2YA 3GHUA 4LV9A 1XJBA 3ZM8A 5AVHA 3TUUA 4Y8EA 1E9LA 2E3ZA 1YPXA 4W93A 3M9YA 3WD2A 3GXTA 5TNVA 1VFFA 3EMCA 3UNDA 4MY9A 4UNLA 1WUFA 3O06A 2YB1A 2ZWYA 1YBQA 3C2YA 3HQ1A 4NG3A 3CU2A 2CEQA 4WJ8A 1J2BA 1F6YA 3UWQA 1UP0A 4INFA 4F0RA 4GZIA 3RPTA 4Q32A 1LL4A 3AMLA 1JDCA 3EOEA 2TMDA 3K8MA 3ATYA 1N8FA 4JHZA 3EZ4A 1YTKA 1W5NA 3M0YA 4Z1BA 4NJGA 3VD5A 3H2NA 1SFJA 3VOGA 4Q4SA 4MAZA 1F73A 1LRTA 1GVOA 1OWQA 3M4HA 2J9XA 1MYRA 5DMMA 4CVWA 2Y70A 2GVJA 1S38A 1IGSA 3SCOA 3AXMA 3GZ3A 1V79A 4XAPA 1TZ7A 5JBEA 1JRBA 1OX4A 1X38A 2E5CA 4WSKA 3QY6A 4Q8MA 2W6RA 2C19A 2G8ZA 1F61A 5LNVA 3WIJA 1V7YA 5CPSA 1YE6A 1FWHC 3S5ZA 4DZAA 3LZ3A 3KS5A 3V0UA 2HNEA 4P7QA 3LNPA 1CB7B 2DDXA 3AMKA 3IVSA 4AVFA 3Q67A 4GINA 1F6KA 2XSXA 1EB3A 4I8DA 2YDQA 3R8RA 1ZBKA 4AISA 1EDTA 3UJSA 4DUWA 2QCGA 4M6UA