1K8FA

Crystal structure of the human c-terminal cap1-adenylyl cyclase associated protein
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
b'PAVLELEGKKWRVENQENVSNLVIEDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYLSKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADENYLYL CYCLASE-ASSOCIATED PROTEIN
publication title Crystal structure of the actin binding domain of the cyclase-associated protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 47
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 1k8fA00
2BX6A 3BH6B 1HF2A 3BH7B 4V02C 2B0RA 1K4ZA 2YUHA 1K8FA 1KQ5A
chains in the Genus database with same CATH superfamily
4OJOA 1LLWA 1EZGA 2ODLA 1WMRA 4XLFA 2XT2A 4Z06A 2BM4A 4XORA 3JURA 3B4NA 4OM9A 1OFDA 4W8TA 1OFEA 4XLAA 3SY2A 1CLWA 2NT9A 3DU1X 3JX8A 3B8YA 4I84A 2NSPA 2X3HA 4YDTA 2NZMA 4YCQA 1XG2A 2QY1A 1LM1A 2VJIA 1IB4A 1RWRA 2F3LA 3ZPPA 3WWGA 4XQFA 3LMWA 3P4GA 1QJVA 4OJ6A 1VBLA 4XLHA 3BH6B 1EE6A 1KTWA 4YEIA 4OJLA 4XN0A 4YZXA 3AK5A 4KH3A 2IQ7A 1OGMX 1AIRA 1GQ8A 1OFMA 2VBKA 3LYCA 3ML3A 4Z05A 2BM5A 3NB2A 4V02C 1QA2A 2PYHA 4XKVA 5JMCB 1RMGA 3H09A 4YELA 3NAWA 2VFNA 4URRA 4XONA 4YEJA 1IA5A 4XM3A 2INVA 1NHCA 4OZYA 3BH7B 5DNSA 2XTWA 4HWVA 1QA3A 2Z8GA 3PSZA 1K4ZA 1TYVA 4XLCA 5AMVA 2VBMA 1O8GA 1QCXA 2X6WA 5C1CA 2BSPA 2O17A 1WXRA 2XTXA 4XNFA 2QYUA 4YZ0A 2XTYA 4Z03A 1IDKA 2INUA 1L1IA 4U4BA 4XMYA 4C2LA 4AVZA 4OZZA 1O8JA 3LJYA 1DBOA 1O8DA 4YZAA 1KCDA 1QQ1A 3VSVA 2IOUG 2QXZA 4W8QA 4XL9A 1OFLA 3SYJA 2UVFA 2PECA 3EQNA 1CZFA 3KRGA 2YUHA 1QRBA 4PMHA 4OJPA 4XOPA 4OPWA 3PSSA 4YC5A 3VMVA 2NTBA 3GQ7A 3T9GA 1PLUA 2NSTA 4XKWA 3GRHA 1BHEA 1TSPA 1DBGA 4EW9A 1PXZA 2XT4A 1KCCA 1RU4A 1X0CA 2BM6A 4XN3A 4W8SA 2V5IA 2B0RA 4YFOA 1O8HA 1TYXA 2VJJA 1O8IA 1O8FA 2NTPA 3PETA 2QZAA 2VFPA 3EQOA 1O8EA 4MXNA 3SZEA 3N90A 2UVEA 2J8KA 1LLZA 4NK8A 3ZSCA 3VSUA 3FY3A 2O6WA 2VBEA 3SUCA 3VSTA 1O8KA 1O8MA 2BX6A 2W7ZA 2XC1A 3GQAA 4NK6A 3TH0A 4JRAC 2X6XA 4MR0A 4OJ5A 3UW0A 2O0VA 2VFOA 4XOTA 2J8IA 2VFQA 1QRCA 1OGOX 4XR6A 5C1EA 1HF2A 2NT6A 2BM7A 4U49A 1JTAA 4YZQA 2O04A 3B90A 1KQ5A 3SQVA 1H80A 1O88A 3N6ZA 1BN8A 1TYWA 4XLEA 1QA1A 2QX3A 1OOCA 1JRGA 1HG8A 2G0YA 2X85A 2O1DA 1PE9A 2O0WA 1TYUA 2PYGA 3VMWA 3RIQA 2EWEA 1K5CA 1EA0A 5JLVC 1IDJA 2X6YA 4W8RA 1DABA 2VFMA 3GQ9A 2NTQA 1O8LA 1K8FA 3GQ8A
chains in the Genus database with same CATH topology
2BM5A 4OJOA 4V02C 1QA2A 3TH0A 4JRAC 2BM4A 4OJ5A 3H09A 5JMCB 4OM9A 2VFNA 2VFOA 1TSPA 2J8IA 2VFQA 1QRCA 2BM6A 1HF2A 3BH7B 2BM7A 1QA3A 2V5IA 2B0RA 1CLWA 1K4ZA 1TYVA 3JX8A 1TYXA 1KQ5A 1WXRA 3PETA 3N6ZA 1QA1A 1TYWA 2VFPA 2F3LA 3P4GA 2G0YA 3SZEA 4OJ6A 3N90A 1TYUA 3LJYA 3RIQA 1QQ1A 2IOUG 3BH6B 5JLVC 3SYJA 1DABA 4OJLA 2YUHA 1QRBA 2VFMA 4KH3A 3LYCA 4OPWA 3ML3A 4OJPA 1K8FA 2BX6A 3AK5A 2W7ZA 2XC1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BX6 A;  3BH6 B;  1HF2 A;  3BH7 B;  4V02 C;  2B0R A;  1K4Z A;  2YUH A;  1K8F A;  1KQ5 A; 
#chains in the Genus database with same CATH topology
 4OJO A;  1LLW A;  1EZG A;  2ODL A;  1WMR A;  4XLF A;  2XT2 A;  4Z06 A;  2BM4 A;  4XOR A;  3JUR A;  3B4N A;  4OM9 A;  1OFD A;  4W8T A;  1OFE A;  4XLA A;  3SY2 A;  1CLW A;  2NT9 A;  3DU1 X;  3JX8 A;  3B8Y A;  4I84 A;  2NSP A;  2X3H A;  4YDT A;  2NZM A;  4YCQ A;  1XG2 A;  2QY1 A;  1LM1 A;  2VJI A;  1IB4 A;  1RWR A;  2F3L A;  3ZPP A;  3WWG A;  4XQF A;  3LMW A;  3P4G A;  1QJV A;  4OJ6 A;  1VBL A;  4XLH A;  3BH6 B;  1EE6 A;  1KTW A;  4YEI A;  4OJL A;  4XN0 A;  4YZX A;  3AK5 A;  4KH3 A;  2IQ7 A;  1OGM X;  1AIR A;  1GQ8 A;  1OFM A;  2VBK A;  3LYC A;  3ML3 A;  4Z05 A;  2BM5 A;  3NB2 A;  4V02 C;  1QA2 A;  2PYH A;  4XKV A;  5JMC B;  1RMG A;  3H09 A;  4YEL A;  3NAW A;  2VFN A;  4URR A;  4XON A;  4YEJ A;  1IA5 A;  4XM3 A;  2INV A;  1NHC A;  4OZY A;  3BH7 B;  5DNS A;  2XTW A;  4HWV A;  1QA3 A;  2Z8G A;  3PSZ A;  1K4Z A;  1TYV A;  4XLC A;  5AMV A;  2VBM A;  1O8G A;  1QCX A;  2X6W A;  5C1C A;  2BSP A;  2O17 A;  1WXR A;  2XTX A;  4XNF A;  2QYU A;  4YZ0 A;  2XTY A;  4Z03 A;  1IDK A;  2INU A;  1L1I A;  4U4B A;  4XMY A;  4C2L A;  4AVZ A;  4OZZ A;  1O8J A;  3LJY A;  1DBO A;  1O8D A;  4YZA A;  1KCD A;  1QQ1 A;  3VSV A;  2IOU G;  2QXZ A;  4W8Q A;  4XL9 A;  1OFL A;  3SYJ A;  2UVF A;  2PEC A;  3EQN A;  1CZF A;  3KRG A;  2YUH A;  1QRB A;  4PMH A;  4OJP A;  4XOP A;  4OPW A;  3PSS A;  4YC5 A;  3VMV A;  2NTB A;  3GQ7 A;  3T9G A;  1PLU A;  2NST A;  4XKW A;  3GRH A;  1BHE A;  1TSP A;  1DBG A;  4EW9 A;  1PXZ A;  2XT4 A;  1KCC A;  1RU4 A;  1X0C A;  2BM6 A;  4XN3 A;  4W8S A;  2V5I A;  2B0R A;  4YFO A;  1O8H A;  1TYX A;  2VJJ A;  1O8I A;  1O8F A;  2NTP A;  3PET A;  2QZA A;  2VFP A;  3EQO A;  1O8E A;  4MXN A;  3SZE A;  3N90 A;  2UVE A;  2J8K A;  1LLZ A;  4NK8 A;  3ZSC A;  3VSU A;  3FY3 A;  2O6W A;  2VBE A;  3SUC A;  3VST A;  1O8K A;  1O8M A;  2BX6 A;  2W7Z A;  2XC1 A;  3GQA A;  4NK6 A;  3TH0 A;  4JRA C;  2X6X A;  4MR0 A;  4OJ5 A;  3UW0 A;  2O0V A;  2VFO A;  4XOT A;  2J8I A;  2VFQ A;  1QRC A;  1OGO X;  4XR6 A;  5C1E A;  1HF2 A;  2NT6 A;  2BM7 A;  4U49 A;  1JTA A;  4YZQ A;  2O04 A;  3B90 A;  1KQ5 A;  3SQV A;  1H80 A;  1O88 A;  3N6Z A;  1BN8 A;  1TYW A;  4XLE A;  1QA1 A;  2QX3 A;  1OOC A;  1JRG A;  1HG8 A;  2G0Y A;  2X85 A;  2O1D A;  1PE9 A;  2O0W A;  1TYU A;  2PYG A;  3VMW A;  3RIQ A;  2EWE A;  1K5C A;  1EA0 A;  5JLV C;  1IDJ A;  2X6Y A;  4W8R A;  1DAB A;  2VFM A;  3GQ9 A;  2NTQ A;  1O8L A;  1K8F A;  3GQ8 A; 
#chains in the Genus database with same CATH homology
 2BM5 A;  4OJO A;  4V02 C;  1QA2 A;  3TH0 A;  4JRA C;  2BM4 A;  4OJ5 A;  3H09 A;  5JMC B;  4OM9 A;  2VFN A;  2VFO A;  1TSP A;  2J8I A;  2VFQ A;  1QRC A;  2BM6 A;  1HF2 A;  3BH7 B;  2BM7 A;  1QA3 A;  2V5I A;  2B0R A;  1CLW A;  1K4Z A;  1TYV A;  3JX8 A;  1TYX A;  1KQ5 A;  1WXR A;  3PET A;  3N6Z A;  1QA1 A;  1TYW A;  2VFP A;  2F3L A;  3P4G A;  2G0Y A;  3SZE A;  4OJ6 A;  3N90 A;  1TYU A;  3LJY A;  3RIQ A;  1QQ1 A;  2IOU G;  3BH6 B;  5JLV C;  3SYJ A;  1DAB A;  4OJL A;  2YUH A;  1QRB A;  2VFM A;  4KH3 A;  3LYC A;  4OPW A;  3ML3 A;  4OJP A;  1K8F A;  2BX6 A;  3AK5 A;  2W7Z A;  2XC1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...