1K8FA

Crystal structure of the human c-terminal cap1-adenylyl cyclase associated protein
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
PAVLELEGKKWRVENQENVSNLVIEDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYLSKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADENYLYL CYCLASE-ASSOCIATED PROTEIN
publication title Crystal structure of the actin binding domain of the cyclase-associated protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 47
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 1k8fA00
1HF2A 2BX6A 4V02C 2B0RA 1K4ZA 3BH7B 1KQ5A 2YUHA 1K8FA 3BH6B
chains in the Genus database with same CATH superfamily
3SUCA 2BX6A 1O8HA 3UW0A 4XLEA 4W8RA 1KTWA 2BM4A 3TH0A 1AIRA 1EZGA 2XTYA 2QX3A 1O8JA 2XC1A 3DU1X 4U49A 1OGOX 1OFMA 4XONA 4YFOA 1LM1A 4EW9A 1O8GA 4OJ6A 4YZ0A 4XLAA 3VSUA 3B4NA 2VFNA 4XM3A 3T9GA 4YC5A 1GQ8A 1QA1A 2INVA 4XL9A 1O8MA 2NSTA 3N90A 4OPWA 2XTXA 1EE6A 4OJOA 4URRA 1OFEA 4YELA 1L1IA 2B0RA 4W8TA 4OJPA 4C2LA 3GQAA 2EWEA 1O8FA 2BM5A 3EQNA 4Z06A 1EA0A 4YEIA 3VMWA 5DNSA 1K5CA 1VBLA 3GQ7A 3BH7B 4XLFA 4OZZA 1QJVA 1K8FA 1BHEA 2NZMA 2VJJA 3JURA 2IQ7A 2X85A 3JX8A 4MXNA 3KRGA 2G0YA 4OJLA 4U4BA 3B8YA 1IA5A 1XG2A 2W7ZA 2VBEA 3B90A 1O8KA 2NTQA 2VBMA 3P4GA 4I84A 1TYUA 4XMYA 3SY2A 2QZAA 3NB2A 1DBOA 4JRAC 1O88A 3AK5A 4XORA 4YZQA 1O8DA 2O04A 2O17A 4NK8A 3ZSCA 1O8LA 4V02C 1QRBA 3GRHA 5C1CA 2VFQA 1H80A 1HF2A 2VFOA 2PYHA 3LJYA 3PSSA 4XKVA 4NK6A 4XLHA 2NT6A 3ZPPA 5JLVC 1IDKA 2BM7A 4XNFA 1RWRA 2NTPA 2BSPA 2O1DA 2ODLA 2YUHA 1QA3A 2UVFA 2VBKA 1WXRA 2IOUG 4HWVA 1JRGA 1OOCA 2X3HA 2BM6A 2O0VA 2NSPA 4YZXA 4Z03A 1QA2A 5C1EA 4OM9A 1IDJA 3N6ZA 3SYJA 1TSPA 3PETA 1PLUA 2V5IA 1O8EA 2VJIA 2Z8GA 1IB4A 1TYWA 4W8QA 1DABA 3BH6B 2QYUA 4YZAA 2O0WA 2QY1A 2UVEA 2NT9A 4XLCA 2XTWA 1BN8A 4YDTA 1QRCA 3WWGA 4Z05A 1LLZA 3FY3A 3PSZA 4OZYA 2QXZA 1TYXA 1K4ZA 4KH3A 4XQFA 2VFPA 1O8IA 1CZFA 1QQ1A 4XR6A 2NTBA 1OFDA 2PYGA 4AVZA 4MR0A 4XKWA 1TYVA 3EQOA 4XN0A 4YCQA 3VSTA 5JMCB 1KCCA 1KCDA 2X6YA 2INUA 3VSVA 1KQ5A 2X6WA 1X0CA 2F3LA 2O6WA 4OJ5A 3SQVA 4PMHA 3SZEA 1NHCA 1PXZA 2XT2A 4YEJA 1WMRA 4XOTA 3RIQA 5AMVA 2X6XA 1RMGA 1HG8A 1JTAA 3H09A 1LLWA 2VFMA 2XT4A 2J8IA 2J8KA 1CLWA 1PE9A 3NAWA 4W8SA 4XN3A 1QCXA 1DBGA 1OGMX 3GQ9A 3LYCA 3GQ8A 3LMWA 3VMVA 4XOPA 3ML3A 2PECA 1OFLA 1RU4A
chains in the Genus database with same CATH topology
2BX6A 1TYVA 5JMCB 3TH0A 2BM4A 3BH7B 2BM6A 1KQ5A 2XC1A 1QA2A 4OJ5A 2F3LA 1K8FA 3JX8A 3N6ZA 4OM9A 3RIQA 3SZEA 3SYJA 2G0YA 1TSPA 4OJLA 4OJ6A 3PETA 2W7ZA 2V5IA 2VFNA 3P4GA 1TYUA 1TYWA 1DABA 3BH6B 1QA1A 3H09A 4JRAC 2VFMA 3AK5A 2J8IA 3N90A 4OPWA 1CLWA 4OJOA 1QRCA 4V02C 1QRBA 2VFQA 1HF2A 3LJYA 2VFOA 3LYCA 1QA3A 2B0RA 1TYXA 1K4ZA 4KH3A 5JLVC 2BM7A 2VFPA 3ML3A 4OJPA 1QQ1A 2YUHA 1WXRA 2IOUG 2BM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HF2 A;  2BX6 A;  4V02 C;  2B0R A;  1K4Z A;  3BH7 B;  1KQ5 A;  2YUH A;  1K8F A;  3BH6 B; 
#chains in the Genus database with same CATH topology
 3SUC A;  2BX6 A;  1O8H A;  3UW0 A;  4XLE A;  4W8R A;  1KTW A;  2BM4 A;  3TH0 A;  1AIR A;  1EZG A;  2XTY A;  2QX3 A;  1O8J A;  2XC1 A;  3DU1 X;  4U49 A;  1OGO X;  1OFM A;  4XON A;  4YFO A;  1LM1 A;  4EW9 A;  1O8G A;  4OJ6 A;  4YZ0 A;  4XLA A;  3VSU A;  3B4N A;  2VFN A;  4XM3 A;  3T9G A;  4YC5 A;  1GQ8 A;  1QA1 A;  2INV A;  4XL9 A;  1O8M A;  2NST A;  3N90 A;  4OPW A;  2XTX A;  1EE6 A;  4OJO A;  4URR A;  1OFE A;  4YEL A;  1L1I A;  2B0R A;  4W8T A;  4OJP A;  4C2L A;  3GQA A;  2EWE A;  1O8F A;  2BM5 A;  3EQN A;  4Z06 A;  1EA0 A;  4YEI A;  3VMW A;  5DNS A;  1K5C A;  1VBL A;  3GQ7 A;  3BH7 B;  4XLF A;  4OZZ A;  1QJV A;  1K8F A;  1BHE A;  2NZM A;  2VJJ A;  3JUR A;  2IQ7 A;  2X85 A;  3JX8 A;  4MXN A;  3KRG A;  2G0Y A;  4OJL A;  4U4B A;  3B8Y A;  1IA5 A;  1XG2 A;  2W7Z A;  2VBE A;  3B90 A;  1O8K A;  2NTQ A;  2VBM A;  3P4G A;  4I84 A;  1TYU A;  4XMY A;  3SY2 A;  2QZA A;  3NB2 A;  1DBO A;  4JRA C;  1O88 A;  3AK5 A;  4XOR A;  4YZQ A;  1O8D A;  2O04 A;  2O17 A;  4NK8 A;  3ZSC A;  1O8L A;  4V02 C;  1QRB A;  3GRH A;  5C1C A;  2VFQ A;  1H80 A;  1HF2 A;  2VFO A;  2PYH A;  3LJY A;  3PSS A;  4XKV A;  4NK6 A;  4XLH A;  2NT6 A;  3ZPP A;  5JLV C;  1IDK A;  2BM7 A;  4XNF A;  1RWR A;  2NTP A;  2BSP A;  2O1D A;  2ODL A;  2YUH A;  1QA3 A;  2UVF A;  2VBK A;  1WXR A;  2IOU G;  4HWV A;  1JRG A;  1OOC A;  2X3H A;  2BM6 A;  2O0V A;  2NSP A;  4YZX A;  4Z03 A;  1QA2 A;  5C1E A;  4OM9 A;  1IDJ A;  3N6Z A;  3SYJ A;  1TSP A;  3PET A;  1PLU A;  2V5I A;  1O8E A;  2VJI A;  2Z8G A;  1IB4 A;  1TYW A;  4W8Q A;  1DAB A;  3BH6 B;  2QYU A;  4YZA A;  2O0W A;  2QY1 A;  2UVE A;  2NT9 A;  4XLC A;  2XTW A;  1BN8 A;  4YDT A;  1QRC A;  3WWG A;  4Z05 A;  1LLZ A;  3FY3 A;  3PSZ A;  4OZY A;  2QXZ A;  1TYX A;  1K4Z A;  4KH3 A;  4XQF A;  2VFP A;  1O8I A;  1CZF A;  1QQ1 A;  4XR6 A;  2NTB A;  1OFD A;  2PYG A;  4AVZ A;  4MR0 A;  4XKW A;  1TYV A;  3EQO A;  4XN0 A;  4YCQ A;  3VST A;  5JMC B;  1KCC A;  1KCD A;  2X6Y A;  2INU A;  3VSV A;  1KQ5 A;  2X6W A;  1X0C A;  2F3L A;  2O6W A;  4OJ5 A;  3SQV A;  4PMH A;  3SZE A;  1NHC A;  1PXZ A;  2XT2 A;  4YEJ A;  1WMR A;  4XOT A;  3RIQ A;  5AMV A;  2X6X A;  1RMG A;  1HG8 A;  1JTA A;  3H09 A;  1LLW A;  2VFM A;  2XT4 A;  2J8I A;  2J8K A;  1CLW A;  1PE9 A;  3NAW A;  4W8S A;  4XN3 A;  1QCX A;  1DBG A;  1OGM X;  3GQ9 A;  3LYC A;  3GQ8 A;  3LMW A;  3VMV A;  4XOP A;  3ML3 A;  2PEC A;  1OFL A;  1RU4 A; 
#chains in the Genus database with same CATH homology
 2BX6 A;  1TYV A;  5JMC B;  3TH0 A;  2BM4 A;  3BH7 B;  2BM6 A;  1KQ5 A;  2XC1 A;  1QA2 A;  4OJ5 A;  2F3L A;  1K8F A;  3JX8 A;  3N6Z A;  4OM9 A;  3RIQ A;  3SZE A;  3SYJ A;  2G0Y A;  1TSP A;  4OJL A;  4OJ6 A;  3PET A;  2W7Z A;  2V5I A;  2VFN A;  3P4G A;  1TYU A;  1TYW A;  1DAB A;  3BH6 B;  1QA1 A;  3H09 A;  4JRA C;  2VFM A;  3AK5 A;  2J8I A;  3N90 A;  4OPW A;  1CLW A;  4OJO A;  1QRC A;  4V02 C;  1QRB A;  2VFQ A;  1HF2 A;  3LJY A;  2VFO A;  3LYC A;  1QA3 A;  2B0R A;  1TYX A;  1K4Z A;  4KH3 A;  5JLV C;  2BM7 A;  2VFP A;  3ML3 A;  4OJP A;  1QQ1 A;  2YUH A;  1WXR A;  2IOU G;  2BM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...