1K8FA

Crystal structure of the human c-terminal cap1-adenylyl cyclase associated protein
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
PAVLELEGKKWRVENQENVSNLVIEDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYLSKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the actin binding domain of the cyclase-associated protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
molecule keywords ADENYLYL CYCLASE-ASSOCIATED PROTEIN
total genus 47
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 1k8fA00
3BH7B 1K4ZA 1HF2A 3BH6B 2B0RA 4V02C 2BX6A 2YUHA 1K8FA 1KQ5A
chains in the Genus database with same CATH superfamily
1RWRA 3GQ8A 2EWEA 1EZGA 1QRBA 3GRHA 1GQ8A 4OPWA 2BM6A 2NT6A 3VSVA 1IDJA 4W8TA 1JRGA 2XTWA 3LMWA 3PETA 2J8IA 2G0YA 5C1CA 1XG2A 2XT2A 2PYGA 4HWVA 5AMVA 4XQFA 2O1DA 2Z8GA 4XNFA 2VFQA 4AVZA 1BHEA 1TYWA 1O8EA 1O8GA 4YZAA 2X6YA 4XM3A 1HF2A 1QCXA 4JRAC 3ZPPA 1AIRA 1PLUA 2NSTA 2NTBA 4Z03A 4YZQA 5JLVC 1O8DA 2INUA 1CLWA 3B4NA 1KCCA 2J8KA 1OFEA 5DNSA 3FY3A 1TYXA 1O8KA 3BH7B 1OFMA 3ZSCA 2X6XA 4YFOA 1QQ1A 3SQVA 1LLZA 1OOCA 2V5IA 2O0WA 4YELA 2B0RA 2BX6A 4OZZA 2X3HA 3P4GA 1KTWA 5C1EA 4C2LA 2O04A 2BM7A 2VFOA 1EA0A 1DABA 1OGMX 1HG8A 1O8JA 2QZAA 1RMGA 2XTYA 2BM5A 3N6ZA 3NB2A 4OM9A 4W8RA 4OJLA 4KH3A 1OGOX 3VMVA 5JMCB 4YDTA 1DBOA 2VFPA 3B8YA 4OZYA 4XOTA 4YEIA 4URRA 4MR0A 4XMYA 3AK5A 2INVA 3ML3A 2NTQA 3SZEA 2XTXA 3JX8A 1IB4A 2IOUG 1O8FA 1KQ5A 2O6WA 2W7ZA 4U4BA 4XR6A 3EQOA 3PSZA 1O8LA 4XOPA 1TSPA 4OJPA 2IQ7A 2NT9A 4YZ0A 4YEJA 4YC5A 2PYHA 1O8HA 2UVEA 4XLEA 4XLCA 3N90A 1PXZA 2X6WA 3T9GA 2NZMA 2NTPA 3RIQA 1LLWA 2VFNA 1L1IA 4V02C 3EQNA 1H80A 3GQAA 1LM1A 4XN3A 1OFDA 2O17A 1DBGA 2VJJA 1BN8A 3PSSA 4YZXA 3VMWA 1QA1A 4XLHA 2NSPA 4I84A 4OJ5A 4Z05A 4MXNA 1IDKA 3VSUA 4W8SA 2YUHA 3BH6B 1RU4A 2F3LA 2VBMA 3LYCA 2XT4A 4XN0A 2X85A 1NHCA 2QXZA 1WXRA 4EW9A 1O88A 3SYJA 1K4ZA 1K5CA 4U49A 2VBEA 2VFMA 4W8QA 4XLAA 1TYVA 3B90A 4PMHA 3LJYA 4Z06A 2UVFA 3NAWA 4NK6A 4XLFA 4OJ6A 4XKVA 2XC1A 2QYUA 2BM4A 4XKWA 2ODLA 2VJIA 3GQ9A 3SY2A 3SUCA 3VSTA 1QRCA 1QJVA 1K8FA 3WWGA 1X0CA 1O8MA 1CZFA 2BSPA 2VBKA 4XL9A 4XONA 4NK8A 1QA3A 1OFLA 1O8IA 2O0VA 1QA2A 1PE9A 2PECA 2QY1A 1EE6A 1WMRA 4XORA 1JTAA 3JURA 2QX3A 4OJOA 1KCDA 1TYUA 3KRGA 3H09A 3GQ7A 3UW0A 3DU1X 4YCQA 1VBLA 1IA5A 3TH0A
chains in the Genus database with same CATH topology
3BH7B 1TSPA 3SYJA 1K4ZA 1QQ1A 4OJPA 1QRBA 2V5IA 2VFMA 1WXRA 4OPWA 2B0RA 1TYVA 2BM6A 2BX6A 3LJYA 3N90A 3P4GA 4OJ6A 2XC1A 3PETA 2J8IA 2BM4A 2BM7A 2G0YA 2VFOA 1DABA 2VFNA 4V02C 1QRCA 2VFQA 1K8FA 3N6ZA 2BM5A 4OM9A 1TYWA 4OJLA 4KH3A 5JMCB 1HF2A 3TH0A 2VFPA 3BH6B 4JRAC 1QA3A 1QA2A 1QA1A 3RIQA 5JLVC 3AK5A 4OJOA 4OJ5A 1TYUA 3ML3A 3H09A 3SZEA 1CLWA 1KQ5A 3JX8A 2IOUG 2YUHA 3LYCA 1TYXA 2F3LA 2W7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BH7 B;  1K4Z A;  1HF2 A;  3BH6 B;  2B0R A;  4V02 C;  2BX6 A;  2YUH A;  1K8F A;  1KQ5 A; 
#chains in the Genus database with same CATH topology
 1RWR A;  3GQ8 A;  2EWE A;  1EZG A;  1QRB A;  3GRH A;  1GQ8 A;  4OPW A;  2BM6 A;  2NT6 A;  3VSV A;  1IDJ A;  4W8T A;  1JRG A;  2XTW A;  3LMW A;  3PET A;  2J8I A;  2G0Y A;  5C1C A;  1XG2 A;  2XT2 A;  2PYG A;  4HWV A;  5AMV A;  4XQF A;  2O1D A;  2Z8G A;  4XNF A;  2VFQ A;  4AVZ A;  1BHE A;  1TYW A;  1O8E A;  1O8G A;  4YZA A;  2X6Y A;  4XM3 A;  1HF2 A;  1QCX A;  4JRA C;  3ZPP A;  1AIR A;  1PLU A;  2NST A;  2NTB A;  4Z03 A;  4YZQ A;  5JLV C;  1O8D A;  2INU A;  1CLW A;  3B4N A;  1KCC A;  2J8K A;  1OFE A;  5DNS A;  3FY3 A;  1TYX A;  1O8K A;  3BH7 B;  1OFM A;  3ZSC A;  2X6X A;  4YFO A;  1QQ1 A;  3SQV A;  1LLZ A;  1OOC A;  2V5I A;  2O0W A;  4YEL A;  2B0R A;  2BX6 A;  4OZZ A;  2X3H A;  3P4G A;  1KTW A;  5C1E A;  4C2L A;  2O04 A;  2BM7 A;  2VFO A;  1EA0 A;  1DAB A;  1OGM X;  1HG8 A;  1O8J A;  2QZA A;  1RMG A;  2XTY A;  2BM5 A;  3N6Z A;  3NB2 A;  4OM9 A;  4W8R A;  4OJL A;  4KH3 A;  1OGO X;  3VMV A;  5JMC B;  4YDT A;  1DBO A;  2VFP A;  3B8Y A;  4OZY A;  4XOT A;  4YEI A;  4URR A;  4MR0 A;  4XMY A;  3AK5 A;  2INV A;  3ML3 A;  2NTQ A;  3SZE A;  2XTX A;  3JX8 A;  1IB4 A;  2IOU G;  1O8F A;  1KQ5 A;  2O6W A;  2W7Z A;  4U4B A;  4XR6 A;  3EQO A;  3PSZ A;  1O8L A;  4XOP A;  1TSP A;  4OJP A;  2IQ7 A;  2NT9 A;  4YZ0 A;  4YEJ A;  4YC5 A;  2PYH A;  1O8H A;  2UVE A;  4XLE A;  4XLC A;  3N90 A;  1PXZ A;  2X6W A;  3T9G A;  2NZM A;  2NTP A;  3RIQ A;  1LLW A;  2VFN A;  1L1I A;  4V02 C;  3EQN A;  1H80 A;  3GQA A;  1LM1 A;  4XN3 A;  1OFD A;  2O17 A;  1DBG A;  2VJJ A;  1BN8 A;  3PSS A;  4YZX A;  3VMW A;  1QA1 A;  4XLH A;  2NSP A;  4I84 A;  4OJ5 A;  4Z05 A;  4MXN A;  1IDK A;  3VSU A;  4W8S A;  2YUH A;  3BH6 B;  1RU4 A;  2F3L A;  2VBM A;  3LYC A;  2XT4 A;  4XN0 A;  2X85 A;  1NHC A;  2QXZ A;  1WXR A;  4EW9 A;  1O88 A;  3SYJ A;  1K4Z A;  1K5C A;  4U49 A;  2VBE A;  2VFM A;  4W8Q A;  4XLA A;  1TYV A;  3B90 A;  4PMH A;  3LJY A;  4Z06 A;  2UVF A;  3NAW A;  4NK6 A;  4XLF A;  4OJ6 A;  4XKV A;  2XC1 A;  2QYU A;  2BM4 A;  4XKW A;  2ODL A;  2VJI A;  3GQ9 A;  3SY2 A;  3SUC A;  3VST A;  1QRC A;  1QJV A;  1K8F A;  3WWG A;  1X0C A;  1O8M A;  1CZF A;  2BSP A;  2VBK A;  4XL9 A;  4XON A;  4NK8 A;  1QA3 A;  1OFL A;  1O8I A;  2O0V A;  1QA2 A;  1PE9 A;  2PEC A;  2QY1 A;  1EE6 A;  1WMR A;  4XOR A;  1JTA A;  3JUR A;  2QX3 A;  4OJO A;  1KCD A;  1TYU A;  3KRG A;  3H09 A;  3GQ7 A;  3UW0 A;  3DU1 X;  4YCQ A;  1VBL A;  1IA5 A;  3TH0 A; 
#chains in the Genus database with same CATH homology
 3BH7 B;  1TSP A;  3SYJ A;  1K4Z A;  1QQ1 A;  4OJP A;  1QRB A;  2V5I A;  2VFM A;  1WXR A;  4OPW A;  2B0R A;  1TYV A;  2BM6 A;  2BX6 A;  3LJY A;  3N90 A;  3P4G A;  4OJ6 A;  2XC1 A;  3PET A;  2J8I A;  2BM4 A;  2BM7 A;  2G0Y A;  2VFO A;  1DAB A;  2VFN A;  4V02 C;  1QRC A;  2VFQ A;  1K8F A;  3N6Z A;  2BM5 A;  4OM9 A;  1TYW A;  4OJL A;  4KH3 A;  5JMC B;  1HF2 A;  3TH0 A;  2VFP A;  3BH6 B;  4JRA C;  1QA3 A;  1QA2 A;  1QA1 A;  3RIQ A;  5JLV C;  3AK5 A;  4OJO A;  4OJ5 A;  1TYU A;  3ML3 A;  3H09 A;  3SZE A;  1CLW A;  1KQ5 A;  3JX8 A;  2IOU G;  2YUH A;  3LYC A;  1TYX A;  2F3L A;  2W7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...