1K8FA

Crystal structure of the human c-terminal cap1-adenylyl cyclase associated protein
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
157
Chain Sequence
PAVLELEGKKWRVENQENVSNLVIEDTELKQVAYIYKCVNTTLQIKGKINSITVDNCKKLGLVFDDVVGIVEIINSKDVKVQVMGKVPTISINKTDGCHAYLSKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the actin binding domain of the cyclase-associated protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
molecule keywords ADENYLYL CYCLASE-ASSOCIATED PROTEIN
total genus 47
structure length 157
sequence length 157
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-10-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.70 Mainly Beta 3 Solenoid Pectate Lyase C-like Pectate Lyase C-like 1k8fA00
1K4ZA 1K8FA 2B0RA 4V02C 2BX6A 3BH7B 2YUHA 1HF2A 3BH6B 1KQ5A
chains in the Genus database with same CATH superfamily
2XTXA 1OFDA 4XOTA 4OJPA 2QX3A 1JTAA 2NT6A 3B90A 4JRAC 4Z03A 5DNSA 1QQ1A 3GRHA 1QA2A 1QJVA 4OJOA 4YZAA 3B4NA 3VMVA 3WWGA 1TSPA 2BM4A 1BN8A 1TYUA 2NZMA 1RU4A 2VFMA 3EQOA 4YEIA 2F3LA 1O8EA 3SY2A 1O8FA 1TYXA 2VFQA 1H80A 4OZZA 2XTYA 1OFLA 2X6YA 3KRGA 1EZGA 4XKVA 3LJYA 4YC5A 4NK6A 4YZQA 3GQ8A 3EQNA 1K4ZA 2IOUG 2NTBA 4U4BA 4YCQA 3VMWA 2VJJA 4PMHA 1PLUA 3UW0A 3LMWA 3PSSA 1X0CA 4YFOA 4XQFA 4XLHA 1AIRA 2IQ7A 3H09A 2V5IA 2INUA 2VBMA 2QZAA 1PE9A 1EE6A 4YELA 1HG8A 1IDKA 2O04A 1OGMX 2UVEA 2ODLA 3AK5A 3SUCA 1OGOX 5JMCB 2X6WA 4XOPA 4YZ0A 3T9GA 5JLVC 1DABA 2G0YA 1LLZA 2O0WA 3GQ9A 3TH0A 1QRBA 1XG2A 2B0RA 4YZXA 1CZFA 3ML3A 1O8KA 1DBOA 3ZPPA 2Z8GA 4OM9A 4W8TA 1HF2A 1O8DA 3ZSCA 4V02C 1L1IA 4XLAA 3N6ZA 1KTWA 3GQAA 2XTWA 4XM3A 3PSZA 2BM7A 2X6XA 1EA0A 4AVZA 2NTPA 1IDJA 4W8SA 3GQ7A 4W8QA 2NSPA 2PYGA 2X3HA 1K5CA 1BHEA 3FY3A 1WXRA 1RWRA 4XN3A 4XNFA 2BM5A 1OFMA 2EWEA 1IB4A 2J8IA 3JURA 2PYHA 4XORA 4MXNA 4YEJA 4XLFA 2VBEA 4URRA 3VSVA 1KQ5A 2O17A 2UVFA 3JX8A 1KCCA 2QY1A 3N90A 2PECA 1LM1A 3VSUA 4C2LA 2X85A 4I84A 3SQVA 2VFPA 1PXZA 2O1DA 1JRGA 2INVA 2O6WA 2VBKA 2VFOA 3SYJA 1QRCA 2O0VA 5C1EA 1QA1A 3NAWA 2XT2A 4XLEA 2NT9A 2BSPA 4HWVA 3SZEA 4XMYA 1O8MA 1NHCA 3PETA 3BH7B 3RIQA 1O8JA 2NTQA 2YUHA 1O88A 4MR0A 4Z06A 1OFEA 4XL9A 1CLWA 1VBLA 4XN0A 1DBGA 5AMVA 2NSTA 1K8FA 4XLCA 1IA5A 3LYCA 4W8RA 3NB2A 4KH3A 1WMRA 4XONA 4YDTA 4OPWA 1GQ8A 1O8GA 1O8LA 3P4GA 4U49A 4OJ5A 3DU1X 5C1CA 4OJLA 2BX6A 2XT4A 1RMGA 3B8YA 2QYUA 1LLWA 1TYVA 1KCDA 3BH6B 4OZYA 2VFNA 1O8IA 2XC1A 1O8HA 4OJ6A 2VJIA 2J8KA 2W7ZA 4EW9A 3VSTA 1TYWA 4NK8A 4XR6A 1QA3A 1QCXA 4XKWA 4Z05A 2QXZA 2BM6A 1OOCA
chains in the Genus database with same CATH topology
4OJPA 3H09A 3SZEA 2V5IA 4JRAC 3PETA 3BH7B 1QQ1A 3RIQA 2YUHA 1QA2A 3AK5A 1WXRA 4OJOA 1CLWA 2BM5A 1K8FA 5JMCB 2J8IA 3LYCA 4KH3A 1TSPA 2BM4A 1TYUA 2VFMA 4OPWA 5JLVC 1DABA 2G0YA 3TH0A 2F3LA 1KQ5A 3P4GA 1QRBA 4OJ5A 3JX8A 4OJLA 2B0RA 1TYXA 2BX6A 2VFQA 3ML3A 3N90A 4OM9A 1TYVA 1HF2A 3BH6B 4V02C 2VFNA 3LJYA 2XC1A 4OJ6A 3N6ZA 1QA1A 1K4ZA 2IOUG 2VFPA 2VFOA 2W7ZA 1TYWA 1QA3A 2BM7A 1QRCA 3SYJA 2BM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K4Z A;  1K8F A;  2B0R A;  4V02 C;  2BX6 A;  3BH7 B;  2YUH A;  1HF2 A;  3BH6 B;  1KQ5 A; 
#chains in the Genus database with same CATH topology
 2XTX A;  1OFD A;  4XOT A;  4OJP A;  2QX3 A;  1JTA A;  2NT6 A;  3B90 A;  4JRA C;  4Z03 A;  5DNS A;  1QQ1 A;  3GRH A;  1QA2 A;  1QJV A;  4OJO A;  4YZA A;  3B4N A;  3VMV A;  3WWG A;  1TSP A;  2BM4 A;  1BN8 A;  1TYU A;  2NZM A;  1RU4 A;  2VFM A;  3EQO A;  4YEI A;  2F3L A;  1O8E A;  3SY2 A;  1O8F A;  1TYX A;  2VFQ A;  1H80 A;  4OZZ A;  2XTY A;  1OFL A;  2X6Y A;  3KRG A;  1EZG A;  4XKV A;  3LJY A;  4YC5 A;  4NK6 A;  4YZQ A;  3GQ8 A;  3EQN A;  1K4Z A;  2IOU G;  2NTB A;  4U4B A;  4YCQ A;  3VMW A;  2VJJ A;  4PMH A;  1PLU A;  3UW0 A;  3LMW A;  3PSS A;  1X0C A;  4YFO A;  4XQF A;  4XLH A;  1AIR A;  2IQ7 A;  3H09 A;  2V5I A;  2INU A;  2VBM A;  2QZA A;  1PE9 A;  1EE6 A;  4YEL A;  1HG8 A;  1IDK A;  2O04 A;  1OGM X;  2UVE A;  2ODL A;  3AK5 A;  3SUC A;  1OGO X;  5JMC B;  2X6W A;  4XOP A;  4YZ0 A;  3T9G A;  5JLV C;  1DAB A;  2G0Y A;  1LLZ A;  2O0W A;  3GQ9 A;  3TH0 A;  1QRB A;  1XG2 A;  2B0R A;  4YZX A;  1CZF A;  3ML3 A;  1O8K A;  1DBO A;  3ZPP A;  2Z8G A;  4OM9 A;  4W8T A;  1HF2 A;  1O8D A;  3ZSC A;  4V02 C;  1L1I A;  4XLA A;  3N6Z A;  1KTW A;  3GQA A;  2XTW A;  4XM3 A;  3PSZ A;  2BM7 A;  2X6X A;  1EA0 A;  4AVZ A;  2NTP A;  1IDJ A;  4W8S A;  3GQ7 A;  4W8Q A;  2NSP A;  2PYG A;  2X3H A;  1K5C A;  1BHE A;  3FY3 A;  1WXR A;  1RWR A;  4XN3 A;  4XNF A;  2BM5 A;  1OFM A;  2EWE A;  1IB4 A;  2J8I A;  3JUR A;  2PYH A;  4XOR A;  4MXN A;  4YEJ A;  4XLF A;  2VBE A;  4URR A;  3VSV A;  1KQ5 A;  2O17 A;  2UVF A;  3JX8 A;  1KCC A;  2QY1 A;  3N90 A;  2PEC A;  1LM1 A;  3VSU A;  4C2L A;  2X85 A;  4I84 A;  3SQV A;  2VFP A;  1PXZ A;  2O1D A;  1JRG A;  2INV A;  2O6W A;  2VBK A;  2VFO A;  3SYJ A;  1QRC A;  2O0V A;  5C1E A;  1QA1 A;  3NAW A;  2XT2 A;  4XLE A;  2NT9 A;  2BSP A;  4HWV A;  3SZE A;  4XMY A;  1O8M A;  1NHC A;  3PET A;  3BH7 B;  3RIQ A;  1O8J A;  2NTQ A;  2YUH A;  1O88 A;  4MR0 A;  4Z06 A;  1OFE A;  4XL9 A;  1CLW A;  1VBL A;  4XN0 A;  1DBG A;  5AMV A;  2NST A;  1K8F A;  4XLC A;  1IA5 A;  3LYC A;  4W8R A;  3NB2 A;  4KH3 A;  1WMR A;  4XON A;  4YDT A;  4OPW A;  1GQ8 A;  1O8G A;  1O8L A;  3P4G A;  4U49 A;  4OJ5 A;  3DU1 X;  5C1C A;  4OJL A;  2BX6 A;  2XT4 A;  1RMG A;  3B8Y A;  2QYU A;  1LLW A;  1TYV A;  1KCD A;  3BH6 B;  4OZY A;  2VFN A;  1O8I A;  2XC1 A;  1O8H A;  4OJ6 A;  2VJI A;  2J8K A;  2W7Z A;  4EW9 A;  3VST A;  1TYW A;  4NK8 A;  4XR6 A;  1QA3 A;  1QCX A;  4XKW A;  4Z05 A;  2QXZ A;  2BM6 A;  1OOC A; 
#chains in the Genus database with same CATH homology
 4OJP A;  3H09 A;  3SZE A;  2V5I A;  4JRA C;  3PET A;  3BH7 B;  1QQ1 A;  3RIQ A;  2YUH A;  1QA2 A;  3AK5 A;  1WXR A;  4OJO A;  1CLW A;  2BM5 A;  1K8F A;  5JMC B;  2J8I A;  3LYC A;  4KH3 A;  1TSP A;  2BM4 A;  1TYU A;  2VFM A;  4OPW A;  5JLV C;  1DAB A;  2G0Y A;  3TH0 A;  2F3L A;  1KQ5 A;  3P4G A;  1QRB A;  4OJ5 A;  3JX8 A;  4OJL A;  2B0R A;  1TYX A;  2BX6 A;  2VFQ A;  3ML3 A;  3N90 A;  4OM9 A;  1TYV A;  1HF2 A;  3BH6 B;  4V02 C;  2VFN A;  3LJY A;  2XC1 A;  4OJ6 A;  3N6Z A;  1QA1 A;  1K4Z A;  2IOU G;  2VFP A;  2VFO A;  2W7Z A;  1TYW A;  1QA3 A;  2BM7 A;  1QRC A;  3SYJ A;  2BM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...