1K9MG

Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
172
structure length
172
Chain Sequence
PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 38
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1k9mG01
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 1k9mG02
5GAGG 1YJ9E 1Q81G 3CCJE 5GAEG 1M1KG 1KC8G 1YHQE 1VQKE 3G4SE 4WF9E 3DLLE 3OW2E 3CF5E 3CCEE 1NJIG 4WFBE 1K9MG 1Q86G 3CCLE 2CQLA 1VQ5E 3CCME 5MLCH 3CCVE 5GADG 1KD1G 1VQNE 1K8AG 1Q82G 2ZJRE 2OTJE 3CC7E 5DM6E 1JJ2E 1VQME 3CCSE 4WFAE 3CXCE 2QA4E 1YITE 5JVHE 1VQPE 3CMEE 1VQ7E 4WFNE 1RL6A 1YJWE 4U67E 3I55E 1Q7YG 4IOCE 1K73G 3J7ZG 3CC2E 1QVGE 1W2BE 1VQ8E 3CD6E 1KQSE 1VQ6E 1VQ9E 3CMAE 4IO9E 1VQLE 5GAHG 1M90G 3G71E 1YI2E 3PIOE 3CCQE 1YIJE 5DM7E 1QVFE 3CCRE 3I56E 5HL7E 4WCEE 2OTLE 2ZJQE 1N8RG 3CPWE 4UY8G 3CC4E 5JVGE 3G6EE 1VQOE 2QEXE 3CCUE 1VQ4E 3PIPE 2ZJPE 4IOAE 5H1SI 1S72E 1YJNE 5AN9B
chains in the Genus database with same CATH superfamily
5GAGG 1YJ9E 1Q81G 3CCJE 5GAEG 2FKGA 2OYBO 1M1KG 1KC8G 2AF5A 1YHQE 1VQKE 5B11O 3G4SE 4WF9E 3DLLE 3OW2E 3CF5E 3CCEE 1NJIG 2I5VO 4WFBE 1K9MG 1Q86G 3CCLE 2CQLA 3EC5A 3CCME 5MLCH 1VQ5E 3CCVE 5GADG 2OY7A 1KD1G 1VQNE 1K8AG 2OL8O 2G8CO 1Q82G 2ZJRE 2OTJE 3CC7E 2PI3O 5DM6E 1JJ2E 1VQME 3AUMO 3CCSE 4WFAE 3CXCE 2QA4E 1YITE 5JVHE 1VQPE 3CMEE 1VQ7E 4WFNE 2OY5O 1RL6A 1YJWE 4U67E 3I55E 1Q7YG 4IOCE 1K73G 3J7ZG 2OL6O 2OL7A 3CC2E 1QVGE 1W2BE 1VQ8E 3CD6E 1KQSE 1P4PA 1VQ6E 1VQ9E 3CMAE 4IO9E 1VQLE 3CKGA 5GAHG 1M90G 3G71E 1RJLC 5B10O 1YI2E 3IGEA 3CKFA 3PIOE 3CCQE 1YIJE 5DM7E 2OY8A 1QVFE 1FJ1E 5B3MO 3CCRE 3I56E 5HL7E 2FKJA 4WCEE 2OTLE 2ZJQE 2HKDA 1N8RG 3CPWE 4UY8G 3CC4E 5JVGE 3IG9A 3G6EE 2QEXE 1VQOE 1OSPO 3CCUE 1VQ4E 3PIPE 2ZJPE 4IOAE 5B2AO 5H1SI 1S72E 1YJNE 2I5ZO 2OY1O 5AN9B
chains in the Genus database with same CATH topology
5GAGG 1YJ9E 1Q81G 3CCJE 5GAEG 1M1KG 1KC8G 1YHQE 1VQKE 3G4SE 4WF9E 3DLLE 3OW2E 3CF5E 3CCEE 1NJIG 4WFBE 1K9MG 1Q86G 3CCLE 2CQLA 1VQ5E 3CCME 5MLCH 3CCVE 5GADG 1KD1G 1VQNE 1K8AG 1Q82G 2ZJRE 2OTJE 3CC7E 5DM6E 1JJ2E 1VQME 3CCSE 4WFAE 3CXCE 2QA4E 1YITE 5JVHE 1VQPE 3CMEE 1VQ7E 4WFNE 1RL6A 1YJWE 4U67E 3I55E 1Q7YG 4IOCE 1K73G 3J7ZG 3CC2E 1QVGE 1W2BE 1VQ8E 3CD6E 1KQSE 1VQ6E 1VQ9E 3CMAE 4IO9E 1VQLE 5GAHG 1M90G 3G71E 1YI2E 3PIOE 3CCQE 1YIJE 5DM7E 1QVFE 3CCRE 3I56E 5HL7E 4WCEE 2OTLE 2ZJQE 1N8RG 3CPWE 4UY8G 3CC4E 5JVGE 3G6EE 1VQOE 2QEXE 3CCUE 1VQ4E 3PIPE 2ZJPE 4IOAE 5H1SI 1S72E 1YJNE 5AN9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAG G;  1YJ9 E;  1Q81 G;  3CCJ E;  5GAE G;  1M1K G;  1KC8 G;  1YHQ E;  1VQK E;  3G4S E;  4WF9 E;  3DLL E;  3OW2 E;  3CF5 E;  3CCE E;  1NJI G;  4WFB E;  1K9M G;  1Q86 G;  3CCL E;  2CQL A;  1VQ5 E;  3CCM E;  5MLC H;  3CCV E;  5GAD G;  1KD1 G;  1VQN E;  1K8A G;  1Q82 G;  2ZJR E;  2OTJ E;  3CC7 E;  5DM6 E;  1JJ2 E;  1VQM E;  3CCS E;  4WFA E;  3CXC E;  2QA4 E;  1YIT E;  5JVH E;  1VQP E;  3CME E;  1VQ7 E;  4WFN E;  1RL6 A;  1YJW E;  4U67 E;  3I55 E;  1Q7Y G;  4IOC E;  1K73 G;  3J7Z G;  3CC2 E;  1QVG E;  1W2B E;  1VQ8 E;  3CD6 E;  1KQS E;  1VQ6 E;  1VQ9 E;  3CMA E;  4IO9 E;  1VQL E;  5GAH G;  1M90 G;  3G71 E;  1YI2 E;  3PIO E;  3CCQ E;  1YIJ E;  5DM7 E;  1QVF E;  3CCR E;  3I56 E;  5HL7 E;  4WCE E;  2OTL E;  2ZJQ E;  1N8R G;  3CPW E;  4UY8 G;  3CC4 E;  5JVG E;  3G6E E;  1VQO E;  2QEX E;  3CCU E;  1VQ4 E;  3PIP E;  2ZJP E;  4IOA E;  5H1S I;  1S72 E;  1YJN E;  5AN9 B; 
#chains in the Genus database with same CATH topology
 5GAG G;  1YJ9 E;  1Q81 G;  3CCJ E;  5GAE G;  2FKG A;  2OYB O;  1M1K G;  1KC8 G;  2AF5 A;  1YHQ E;  1VQK E;  5B11 O;  3G4S E;  4WF9 E;  3DLL E;  3OW2 E;  3CF5 E;  3CCE E;  1NJI G;  2I5V O;  4WFB E;  1K9M G;  1Q86 G;  3CCL E;  2CQL A;  3EC5 A;  3CCM E;  5MLC H;  1VQ5 E;  3CCV E;  5GAD G;  2OY7 A;  1KD1 G;  1VQN E;  1K8A G;  2OL8 O;  2G8C O;  1Q82 G;  2ZJR E;  2OTJ E;  3CC7 E;  2PI3 O;  5DM6 E;  1JJ2 E;  1VQM E;  3AUM O;  3CCS E;  4WFA E;  3CXC E;  2QA4 E;  1YIT E;  5JVH E;  1VQP E;  3CME E;  1VQ7 E;  4WFN E;  2OY5 O;  1RL6 A;  1YJW E;  4U67 E;  3I55 E;  1Q7Y G;  4IOC E;  1K73 G;  3J7Z G;  2OL6 O;  2OL7 A;  3CC2 E;  1QVG E;  1W2B E;  1VQ8 E;  3CD6 E;  1KQS E;  1P4P A;  1VQ6 E;  1VQ9 E;  3CMA E;  4IO9 E;  1VQL E;  3CKG A;  5GAH G;  1M90 G;  3G71 E;  1RJL C;  5B10 O;  1YI2 E;  3IGE A;  3CKF A;  3PIO E;  3CCQ E;  1YIJ E;  5DM7 E;  2OY8 A;  1QVF E;  1FJ1 E;  5B3M O;  3CCR E;  3I56 E;  5HL7 E;  2FKJ A;  4WCE E;  2OTL E;  2ZJQ E;  2HKD A;  1N8R G;  3CPW E;  4UY8 G;  3CC4 E;  5JVG E;  3IG9 A;  3G6E E;  2QEX E;  1VQO E;  1OSP O;  3CCU E;  1VQ4 E;  3PIP E;  2ZJP E;  4IOA E;  5B2A O;  5H1S I;  1S72 E;  1YJN E;  2I5Z O;  2OY1 O;  5AN9 B; 
#chains in the Genus database with same CATH homology
 5GAG G;  1YJ9 E;  1Q81 G;  3CCJ E;  5GAE G;  1M1K G;  1KC8 G;  1YHQ E;  1VQK E;  3G4S E;  4WF9 E;  3DLL E;  3OW2 E;  3CF5 E;  3CCE E;  1NJI G;  4WFB E;  1K9M G;  1Q86 G;  3CCL E;  2CQL A;  1VQ5 E;  3CCM E;  5MLC H;  3CCV E;  5GAD G;  1KD1 G;  1VQN E;  1K8A G;  1Q82 G;  2ZJR E;  2OTJ E;  3CC7 E;  5DM6 E;  1JJ2 E;  1VQM E;  3CCS E;  4WFA E;  3CXC E;  2QA4 E;  1YIT E;  5JVH E;  1VQP E;  3CME E;  1VQ7 E;  4WFN E;  1RL6 A;  1YJW E;  4U67 E;  3I55 E;  1Q7Y G;  4IOC E;  1K73 G;  3J7Z G;  3CC2 E;  1QVG E;  1W2B E;  1VQ8 E;  3CD6 E;  1KQS E;  1VQ6 E;  1VQ9 E;  3CMA E;  4IO9 E;  1VQL E;  5GAH G;  1M90 G;  3G71 E;  1YI2 E;  3PIO E;  3CCQ E;  1YIJ E;  5DM7 E;  1QVF E;  3CCR E;  3I56 E;  5HL7 E;  4WCE E;  2OTL E;  2ZJQ E;  1N8R G;  3CPW E;  4UY8 G;  3CC4 E;  5JVG E;  3G6E E;  1VQO E;  2QEX E;  3CCU E;  1VQ4 E;  3PIP E;  2ZJP E;  4IOA E;  5H1S I;  1S72 E;  1YJN E;  5AN9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...