1K9MP

Co-crystal structure of tylosin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
115
structure length
115
Chain Sequence
b'SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00828 Ribosomal_L27A Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.100.10.10 Alpha Beta Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 Ribosomal Protein L15; Chain: K; domain 2 1k9mP00
3CPWN 1M90P 1VQ6L 3CCVO 3CC7L 1YIJO 2OTLO 2OTJO 3G6EL 3CD6L 1N8RM 3CCQO 2QEXO 3CC4O 1VQPO 1YJ9L 3CCVL 1YIJL 2OTLL 3G71O 1KD1P 2QEXL 1KC8P 3CC4L 1QVGN 1QVFK 3CCJO 1K8AM 1K73M 3I55O 1W2BN 1K9MP 1JJ2K 3CCRO 3OW2N 1Q81M 3CMAL 1YITO 3CCSO 3CC2O 1VQMO 1M1KM 1N8RP 3CCJL 3G4SO 1Q86M 1VQ7O 1QVFN 1VQ5O 1VQKO 3CCLO 1Q7YM 3I55L 2OTJL 3CCRL 3I56O 3CCQL 1VQ8O 3CXCK 1KQSK 1VQNO 1VQPL 3CCMO 1YITL 3CCSL 3CCUO 1VQML 3CCEO 3CMEO 3G4SL 1VQ4O 3CPWK 2QA4O 3CCLL 1VQKL 1Q82M 3I56L 1VQ8L 3G71L 1K8AP 1K73P 1NJIM 3CC7O 1VQNL 3CCML 3CXCN 1VQ9O 3CCUL 3CCEL 1YJNO 3CMEL 1Q81P 1VQ4L 2QA4L 1VQOO 1YHQO 1VQLO 1M1KP 1Q86P 1JJ2N 1YI2O 1Q7YP 1S72O 3CC2L 1VQ9L 1QVGK 1YJWO 1YJNL 1VQ7L 1VQ5L 1VQOL 1YHQL 1W2BK 1VQLL 1VQ6O 1KD1M 3OW2K 1KC8M 1YI2L 3G6EO 1S72L 1Q82P 1M90M 3CD6O 1KQSN 3CMAO 1YJWL 1NJIP 1K9MM 1YJ9O
chains in the Genus database with same CATH superfamily
3CPWN 1M90P 1VQ6L 3CCVO 3CC7L 1YIJO 2OTLO 2OTJO 3G6EL 3CD6L 1N8RM 3CCQO 2QEXO 3CC4O 1VQPO 1YJ9L 3CCVL 1YIJL 2OTLL 4XTKA 4WJ0A 3G71O 1KD1P 2QEXL 1KC8P 3CC4L 5DS4A 1QVGN 1QVFK 4QDLA 3CCJO 1K8AM 1K73M 3I55O 1W2BN 1K9MP 1JJ2K 3CCRO 3OW2N 4W8KA 1Q81M 3CMAL 5DQTA 1YITO 3CCSO 3CC2O 1VQMO 3NKDA 1M1KM 1N8RP 3CCJL 3G4SO 4P6IC 1Q86M 1VQ7O 1QVFN 1VQ5O 1VQKO 5DS6A 3CCLO 1Q7YM 3I55L 2OTJL 3CCRL 3I56O 3CCQL 1VQ8O 5DQZA 3CXCK 1KQSK 1VQNO 1VQPL 3CCMO 1YITL 3CCSL 3CCUO 1VQML 3CCEO 5DS5A 3CMEO 3G4SL 5DLJA 4N06A 1VQ4O 3CPWK 2QA4O 3CCLL 1VQKL 1Q82M 3I56L 1VQ8L 3G71L 1K8AP 1K73P 1NJIM 3CC7O 1VQNL 5FCLA 3GODA 3CCML 3CXCN 1VQ9O 3CCUL 3CCEL 1YJNO 3CMEL 1Q81P 1VQ4L 2QA4L 1VQOO 1YHQO 1VQLO 1M1KP 2YZSA 1Q86P 1JJ2N 1YI2O 1Q7YP 1S72O 3CC2L 1VQ9L 1QVGK 1YJWO 1YJNL 1VQ7L 1VQ5L 1VQOL 1YHQL 1W2BK 1VQLL 1VQ6O 1KD1M 3OW2K 1KC8M 1YI2L 3G6EO 1S72L 1Q82P 1M90M 3CD6O 1KQSN 3CMAO 1YJWL 1NJIP 1K9MM 1YJ9O
chains in the Genus database with same CATH topology
3CPWN 1M90P 1VQ6L 3CCVO 3CC7L 1YIJO 2OTLO 2OTJO 3G6EL 3CD6L 1N8RM 3CCQO 2QEXO 3CC4O 1VQPO 1YJ9L 3CCVL 1YIJL 2OTLL 4XTKA 4WJ0A 3G71O 1KD1P 2QEXL 1KC8P 3CC4L 5DS4A 1QVGN 1QVFK 4QDLA 3CCJO 1K8AM 1K73M 3I55O 1W2BN 1K9MP 1JJ2K 3CCRO 3OW2N 4W8KA 1Q81M 3CMAL 5DQTA 1YITO 3CCSO 3CC2O 1VQMO 3NKDA 1M1KM 1N8RP 3CCJL 3G4SO 4P6IC 1Q86M 1VQ7O 1QVFN 1VQ5O 1VQKO 5DS6A 3CCLO 1Q7YM 3I55L 2OTJL 3CCRL 3I56O 3CCQL 1VQ8O 5DQZA 3CXCK 1KQSK 1VQNO 1VQPL 3CCMO 1YITL 3CCSL 3CCUO 1VQML 3CCEO 5DS5A 3CMEO 3G4SL 5DLJA 4N06A 1VQ4O 3CPWK 2QA4O 3CCLL 1VQKL 1Q82M 3I56L 1VQ8L 3G71L 1K8AP 1K73P 1NJIM 3CC7O 1VQNL 5FCLA 3GODA 3CCML 3CXCN 1VQ9O 3CCUL 3CCEL 1YJNO 3CMEL 1Q81P 1VQ4L 2QA4L 1VQOO 1YHQO 1VQLO 1M1KP 2YZSA 1Q86P 1JJ2N 1YI2O 1Q7YP 1S72O 3CC2L 1VQ9L 1QVGK 1YJWO 1YJNL 1VQ7L 1VQ5L 1VQOL 1YHQL 1W2BK 1VQLL 1VQ6O 1KD1M 3OW2K 1KC8M 1YI2L 3G6EO 1S72L 1Q82P 1M90M 3CD6O 1KQSN 3CMAO 1YJWL 1NJIP 1K9MM 1YJ9O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW N;  1M90 P;  1VQ6 L;  3CCV O;  3CC7 L;  1YIJ O;  2OTL O;  2OTJ O;  3G6E L;  3CD6 L;  1N8R M;  3CCQ O;  2QEX O;  3CC4 O;  1VQP O;  1YJ9 L;  3CCV L;  1YIJ L;  2OTL L;  3G71 O;  1KD1 P;  2QEX L;  1KC8 P;  3CC4 L;  1QVG N;  1QVF K;  3CCJ O;  1K8A M;  1K73 M;  3I55 O;  1W2B N;  1K9M P;  1JJ2 K;  3CCR O;  3OW2 N;  1Q81 M;  3CMA L;  1YIT O;  3CCS O;  3CC2 O;  1VQM O;  1M1K M;  1N8R P;  3CCJ L;  3G4S O;  1Q86 M;  1VQ7 O;  1QVF N;  1VQ5 O;  1VQK O;  3CCL O;  1Q7Y M;  3I55 L;  2OTJ L;  3CCR L;  3I56 O;  3CCQ L;  1VQ8 O;  3CXC K;  1KQS K;  1VQN O;  1VQP L;  3CCM O;  1YIT L;  3CCS L;  3CCU O;  1VQM L;  3CCE O;  3CME O;  3G4S L;  1VQ4 O;  3CPW K;  2QA4 O;  3CCL L;  1VQK L;  1Q82 M;  3I56 L;  1VQ8 L;  3G71 L;  1K8A P;  1K73 P;  1NJI M;  3CC7 O;  1VQN L;  3CCM L;  3CXC N;  1VQ9 O;  3CCU L;  3CCE L;  1YJN O;  3CME L;  1Q81 P;  1VQ4 L;  2QA4 L;  1VQO O;  1YHQ O;  1VQL O;  1M1K P;  1Q86 P;  1JJ2 N;  1YI2 O;  1Q7Y P;  1S72 O;  3CC2 L;  1VQ9 L;  1QVG K;  1YJW O;  1YJN L;  1VQ7 L;  1VQ5 L;  1VQO L;  1YHQ L;  1W2B K;  1VQL L;  1VQ6 O;  1KD1 M;  3OW2 K;  1KC8 M;  1YI2 L;  3G6E O;  1S72 L;  1Q82 P;  1M90 M;  3CD6 O;  1KQS N;  3CMA O;  1YJW L;  1NJI P;  1K9M M;  1YJ9 O; 
#chains in the Genus database with same CATH topology
 3CPW N;  1M90 P;  1VQ6 L;  3CCV O;  3CC7 L;  1YIJ O;  2OTL O;  2OTJ O;  3G6E L;  3CD6 L;  1N8R M;  3CCQ O;  2QEX O;  3CC4 O;  1VQP O;  1YJ9 L;  3CCV L;  1YIJ L;  2OTL L;  4XTK A;  4WJ0 A;  3G71 O;  1KD1 P;  2QEX L;  1KC8 P;  3CC4 L;  5DS4 A;  1QVG N;  1QVF K;  4QDL A;  3CCJ O;  1K8A M;  1K73 M;  3I55 O;  1W2B N;  1K9M P;  1JJ2 K;  3CCR O;  3OW2 N;  4W8K A;  1Q81 M;  3CMA L;  5DQT A;  1YIT O;  3CCS O;  3CC2 O;  1VQM O;  3NKD A;  1M1K M;  1N8R P;  3CCJ L;  3G4S O;  4P6I C;  1Q86 M;  1VQ7 O;  1QVF N;  1VQ5 O;  1VQK O;  5DS6 A;  3CCL O;  1Q7Y M;  3I55 L;  2OTJ L;  3CCR L;  3I56 O;  3CCQ L;  1VQ8 O;  5DQZ A;  3CXC K;  1KQS K;  1VQN O;  1VQP L;  3CCM O;  1YIT L;  3CCS L;  3CCU O;  1VQM L;  3CCE O;  5DS5 A;  3CME O;  3G4S L;  5DLJ A;  4N06 A;  1VQ4 O;  3CPW K;  2QA4 O;  3CCL L;  1VQK L;  1Q82 M;  3I56 L;  1VQ8 L;  3G71 L;  1K8A P;  1K73 P;  1NJI M;  3CC7 O;  1VQN L;  5FCL A;  3GOD A;  3CCM L;  3CXC N;  1VQ9 O;  3CCU L;  3CCE L;  1YJN O;  3CME L;  1Q81 P;  1VQ4 L;  2QA4 L;  1VQO O;  1YHQ O;  1VQL O;  1M1K P;  2YZS A;  1Q86 P;  1JJ2 N;  1YI2 O;  1Q7Y P;  1S72 O;  3CC2 L;  1VQ9 L;  1QVG K;  1YJW O;  1YJN L;  1VQ7 L;  1VQ5 L;  1VQO L;  1YHQ L;  1W2B K;  1VQL L;  1VQ6 O;  1KD1 M;  3OW2 K;  1KC8 M;  1YI2 L;  3G6E O;  1S72 L;  1Q82 P;  1M90 M;  3CD6 O;  1KQS N;  3CMA O;  1YJW L;  1NJI P;  1K9M M;  1YJ9 O; 
#chains in the Genus database with same CATH homology
 3CPW N;  1M90 P;  1VQ6 L;  3CCV O;  3CC7 L;  1YIJ O;  2OTL O;  2OTJ O;  3G6E L;  3CD6 L;  1N8R M;  3CCQ O;  2QEX O;  3CC4 O;  1VQP O;  1YJ9 L;  3CCV L;  1YIJ L;  2OTL L;  4XTK A;  4WJ0 A;  3G71 O;  1KD1 P;  2QEX L;  1KC8 P;  3CC4 L;  5DS4 A;  1QVG N;  1QVF K;  4QDL A;  3CCJ O;  1K8A M;  1K73 M;  3I55 O;  1W2B N;  1K9M P;  1JJ2 K;  3CCR O;  3OW2 N;  4W8K A;  1Q81 M;  3CMA L;  5DQT A;  1YIT O;  3CCS O;  3CC2 O;  1VQM O;  3NKD A;  1M1K M;  1N8R P;  3CCJ L;  3G4S O;  4P6I C;  1Q86 M;  1VQ7 O;  1QVF N;  1VQ5 O;  1VQK O;  5DS6 A;  3CCL O;  1Q7Y M;  3I55 L;  2OTJ L;  3CCR L;  3I56 O;  3CCQ L;  1VQ8 O;  5DQZ A;  3CXC K;  1KQS K;  1VQN O;  1VQP L;  3CCM O;  1YIT L;  3CCS L;  3CCU O;  1VQM L;  3CCE O;  5DS5 A;  3CME O;  3G4S L;  5DLJ A;  4N06 A;  1VQ4 O;  3CPW K;  2QA4 O;  3CCL L;  1VQK L;  1Q82 M;  3I56 L;  1VQ8 L;  3G71 L;  1K8A P;  1K73 P;  1NJI M;  3CC7 O;  1VQN L;  5FCL A;  3GOD A;  3CCM L;  3CXC N;  1VQ9 O;  3CCU L;  3CCE L;  1YJN O;  3CME L;  1Q81 P;  1VQ4 L;  2QA4 L;  1VQO O;  1YHQ O;  1VQL O;  1M1K P;  2YZS A;  1Q86 P;  1JJ2 N;  1YI2 O;  1Q7Y P;  1S72 O;  3CC2 L;  1VQ9 L;  1QVG K;  1YJW O;  1YJN L;  1VQ7 L;  1VQ5 L;  1VQO L;  1YHQ L;  1W2B K;  1VQL L;  1VQ6 O;  1KD1 M;  3OW2 K;  1KC8 M;  1YI2 L;  3G6E O;  1S72 L;  1Q82 P;  1M90 M;  3CD6 O;  1KQS N;  3CMA O;  1YJW L;  1NJI P;  1K9M M;  1YJ9 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...