1K9OE

Crystal structure of michaelis serpin-trypsin complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDAGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALASERPIN
publication title The structure of a Michaelis serpin-protease complex.
pubmed doi rcsb
source organism Manduca sexta
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k9oE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k9oE02
5EPYA 2VB0A 4H6TA 3SV9A 3RU4E 1GBAA 4CBOA 1QL7A 1YPGH 4K1SA 3DA9B 1AIXH 5C2ZA 1ZLRA 5BPEA 2ZU4A 1GI0A 1P06A 4KTCA 2FS8A 3VB7A 1HAPH 2GV6A 1TIOA 4I8KA 3A85A 3VB5A 4FXGH 3A83A 2FYRA 2BY9X 2ZU3A 2ULLA 1FN8A 1GVKB 4X6MA 4ABJA 3BV9B 1GI5A 1L4DA 3IWMA 2WPHS 4Y8XA 1H8DH 2OQ5A 3ITIA 5ABWA 5AF9H 1K1IA 1IOEA 1OSSA 5I25A 1J14A 2SNVA 1T7CA 3MU8A 3OY5U 3M5MA 2SGDE 5B6OA 3WY8A 1AZZA 1TGNA 1VITH 4BAQB 2BDCA 1TBRH 4IGDA 3U1JB 1EZXC 5T3HA 2ZPSA 4UEHH 1Y5BT 1E38B 1ZOMA 1IQGA 3BEIB 1XM1A 1OWDA 2IN2A 3QO6A 1EJNA 1ELEE 1E37B 4NWLA 2ZPQA 2HRVA 2BLQA 1DITH 1GI1A 1TBZH 4XE4A 4DT7B 1UMAH 2BY8X 4WMEA 5F8TA 1SOZA 1L2EA 2HALA 3QZQA 1HNEE 1UTOA 1V2OT 3ESTA 1GBMA 2BX4A 2ZPRA 2NWNA 2G52A 2Z94A 1AB9B 1CO7E 4UONA 4MQAA 1AWFH 4BANB 1P2IA 1KY9A 1XUIA 2H2ZA 1C1QA 1P3EA 1EZUC 1JMOH 4MPUA 2SFAA 1GHBG 1AGJA 2BD2A 3MYWA 1S81A 2W26A 3B9FH 3QX5H 4WMDA 5A09A 1RTLA 2WPMS 2B5TB 2Q6DA 3SUGA 1Z6JH 2QF3A 2D2DA 1MTNC 4CREA 2A5AA 4I8LA 2GDDA 4NIWA 1T4UH 3LGTA 3V3MA 3E16B 4WWYA 1ZJKA 1EB2A 1THRH 5JBTA 4QT8C 2NU2E 1NPMA 2C8XB 4X6PA 1IQHA 3N7OA 4AFQA 8LPRA 8GCHG 1OWEA 1DT2A 3ODDA 1GHYH 2UUYA 4F49A 5E0JA 3PYHA 4THNH 4XSKU 1Z1JA 3A82A 1LVBA 1QB6A 4Q7XA 4YESB 2FZZA 2BQWB 2XBVA 4H42U 1HFDA 4YT6H 1IHSH 1N6XA 1EUFA 2LNCA 2A31A 4XOJA 1K2I1 2DE8A 1K21H 3MO3A 1NM6A 4Y79A 4GSOA 5EXMA 1QTFA 1FY4A 2DE9A 1C2JA 1O39A 1ZMLA 2R9PA 4Y8ZA 4MNYA 3A86A 3RC4A 1TX8A 4JZDH 1KXEA 1CA0C 1JXPA 1OWKA 1PPHE 1T8OA 1Z8RA 3A8DA 1T31A 1F5KU 3A88A 1FLEE 1MCTA 1YBWA 4TY7A 3KQDA 3ZVDA 3F9EA 5AVDA 3RXSA 1J9CH 1QJ1B 4A7IB 2EA3A 1MTVA 4IC6A 3M7QA 1O2UA 1D6RA 1O37A 1ARCA 1O3OA 1Q3XA 1WQSA 1O2NA 2ZNKH 4NIYA 3W94A 3PLKA 1TOCB 2JH6D 3PLBA 1ARBA 1RFNA 1M9UA 2ZHEH 4MNVA 1GI6A 1RGQA 1SMFE 4GUXA 3P95A 2ZC9H 1X7AC 2XXLA 1V2WT 2ZWLH 2VVUA 3LJJA 1EATA 3SV6A 1CE5A 3AAUA 3MH7A 1RTFB 1XXDA 1INCA 3A7YA 1IQMA 1C2LA 3ZYDA 1W14U 1T32A 1S82A 1K1OA 1MQ6A 1EOLA 1JIRA 3BF6H 2BD9A 2BD3A 1NT1A 4K3JA 1A0JA 1MTNB 2ASUB 1NFXA 3I78A 1WU1A 1CVWH 4B73A 1CGIE 1BMLA 5BRRE 1EB1H 1FAXA 3BTKE 1XUKA 1ACBE 1GJ5H 3GY3A 2AGEX 1GHWH 4BOHA 2Y5FA 1ELFA 3FANA 3UR6A 4I31A 1Y3VA 2FYQA 1O33A 2W7UA 1UK2A 1LO6A 1HLTH 2R2WU 4ABIA 4DIIH 3D65E 4D7GA 1EXFA 4OS1A 5FBEA 3RXJA 5ESTE 3UY9A 1FI8A 1C1MA 2A4QA 4XBDA 3KQEA 3SHAH 1QBVH 1GJ4H 3SI4H 1PYTC 1V2KT 1O35A 1FY3A 3E90B 1GWAA 3SU2A 2ZFFH 3PROA 4IC5A 1L1GA 1Z8IB 2OINA 2GP9B 5E0GA 5I46H 4ISHH 2A7HA 1CA0B 3MH4A 1DY9A 3RC5A 3PM3A 4OS5A 3UOUA 2STAE 4AORA 3C27B 2ZI2H 2PFEA 3OX7U 2D8WA 1TA2A 3RU4D 3SQEE 3UNSA 2BMGB 2P3UB 1CGHA 4CRAA 2RDLA 1O2VA 4RSPA 1TB6H 4O03A 1MBMA 4U2WA 1D6WA 5DP9A 3NZIA 1DWEH 1P2JA 2BVSH 2FI3E 3JZ1B 1JWTA 1KXFA 4U01A 1WAYB 4NGAH 1W13U 1GVZA 1QRWA 2ZDVH 2A0QB 2BM2A 3ZV9A 4X0WU 4JYTA 4D9QA 1MAYA 5DP8A 3DT0H 4XFQA 2Y81A 2WV4A 1C1NA 3GDUA 1PJPA 5JBBS 2VJ1A 3PO1C 5EQQA 1QB1A 3V0XA 3UQOA 2BDIA 5DP5A 1ZMNA 1O2YA 1ELVA 1MZDA 3PB1E 2CN0H 5DGJA 4ZKNU 5SGAE 2PHBA 1RS0A 1V6DA 4ISNA 1DDJA 3BTFE 3LH1A 5L30H 1TFXA 3KF2A 2YNAA 3K9XB 1ORFA 3TJUA 5FCKA 1FZZA 2RA0A 2UWOA 3V7TA 2G55A 1H9IE 4I8JA 1OP8A 2XBYA 1TNJA 1D3QB 1HIAA 1BTHH 2P16A 3RLWH 3SU1A 4DURA 1Y5AT 3NCLA 5EGMA 3VB4A 3P6ZB 3GCOA 4ABFA 3QDZB 2JH0D 1P03A 1QBNA 3LGWA 3U1IB 5J4SA 3DD2H 5GCHF 1G2LA 2PSYA 2BOKA 2OC8A 3BTTE 1EAUA 5C5OA 1PYTD 2DUCA 1YCPH 2RG3A 3U8TH 3GY6A 1L4ZA 2B8OH 2VVCA 3FVFB 4SGAE 1MCVA 1NROH 1O30A 4FUBA 3QTOH 4HGCA 4B74A 1HUTH 1GDQA 1GHXH 4GVUA 3ATIA 2PTNA 3L6PA 4YZUA 2AERH 3VEQB 3GDVA 3RXEA 2QCYA 1GMCG 1QQ4A 2THFB 1TONA 3TU7H 1UVTH 2IOTA 2TGAA 2HNTC 3T5FH 4NIXA 1C2FA 2ZGHA 5FPYA 3DUXH 1C5ZB 2XC5A 4KTUA 1Y3UA 1P01A 4FUJA 1O31A 3OSYA 1GHBF 3U9AH 2O8TA 4ABEA 4CRBA 2ANKH 2UUFB 3ZZ4A 1UVOA 2AMDA 4BTIB 4UFGH 3CP7A 4UE7H 2ZGXH 4HTCH 2GTBA 2ZECA 3NK8A 1ETRH 1ZGIA 1A5IA 1DUEA 3ATLA 3PMBB 4TWWA 3PO1B 3Q3XA 1TABE 1SGFA 5JDUB 1GMDG 1A5GH 4MNWA 3RXVA 3SO3A 1MUEB 1LQDB 1O3FA 2GMTB 4ZHLU 4OGXA 4GHQA 4ZROA 1O5DH 1QFKH 1AE5A 5A0CA 5EXNA 2HGTH 1S83A 1PQ7A 2BQ7B 1NC6A 1O3NA 3TH2H 1DVAH 1D3TB 2ZTYA 1AKSB 1P9SA 5JYIA 1O3JA 2NU1E 1G32B 5CE1A 4R8TB 3UOPA 1THPB 2F9UA 2BZ6H 1D9IA 1KLIH 4UDWH 4WMFA 4B2AA 2OC7A 1T4VH 1T8MA 2CHAC 4K1EA 1UTMA 4DJZB 4NSYA 4WF8A 1C5WB 2EI6A 2G00A 1K1NA 2ZTXA 4MPVA 4ZAEA 1C1OA 1O5EH 1Y3XA 2BB4A 4X8UH 4Y0YE 1UVUH 1Z71A 3RMNH 2ANYA 3RXHA 3SU3A 1C2IA 3UNQA 2R2MB 1O5AB 2FOHA 1J16A 2Q1JA 1KSNA 3TJVA 2H9HA 1CA8B 5F03A 5DO4H 3ZZ5A 4FVDA 1K28D 3I29A 3CENA 1W0ZU 3S9CA 1EPTC 3M5LA 1C5SA 2BDAA 2VIOA 2Z3CA 3NKKA 2BD4A 1GJ6A 2KAIA 3GDSA 1G3BA 3BTME 3T2NA 2OQUA 3BTWE 4J2YB 1Y3WA 2ZGJA 1AVWA 3ZZAA 2XC4A 2FTLE 2BDHA 2PKAA 2Y80A 3K65B 4D76A 4FUDA 2Y7XA 1AVGH 2VIPA 3MTYA 4DY7B 1L0ZA 7KMEH 1BBRH 1HYLA 1EAWA 2ANMH 5L2ZH 2QIQA 5DP4A 3V12A 2SGPE 2ZDAH 4MG3A 1NRSH 2G5VA 3ZZ8A 2ZGCA 1CHGA 3NWUA 1VITG 1ELGA 4ABBA 3MU1A 3TNTA 1TE0A 3S0NA 1QIXB 3TK6A 2R0LA 1KDQA 3SU5A 4X8TH 1VR1H 1ETTH 1SGNE 4UD9H 4IN1A 2H5DA 1LVMA 2EEKA 3GCTG 1TMBH 1MKXH 3LKWA 1AHTH 1N8OC 2ZTZA 1V2ST 4CRDA 1UCYK 1F92A 4TPIZ 1A46H 2P3FH 1XUHA 1NN6A 2QAAA 1C5PA 2WPJS 3MO9A 5DP7A 1CT2E 5JB8S 2TBSA 1PQ5A 2CHAB 3F68H 1PPFE 2M5TA 3HKIB 4NA7A 1K9OE 1NFYA 5DP6A 5EXLA 5CHAB 1SOTA 1O5GH 2D1JA 2FX6A 1ZR0A 2VGCC 1SPJA 1HPGA 1UTPA 4JMYA 1B0FA 5HYOA 3A7ZA 1FIZA 1QR3E 2Z9IA 2FESH 4YO9A 3E8LA 1KLTA 1NO9H 3HK3B 1DLKB 1KXAA 3SU4A 1C2HA 1EP5A 1O34A 1WTHD 1UCYE 1JOUB 3GYMA 4NA9H 3SGAE 1FV9A 1DXWA 1EPTB 6GCHF 3H7OA 1FNIA 3RM0H 5H4IB 1C5QA 1TQ7B 6LPRA 5LPRA 1C2KA 2OUAA 3KEEA 5EOKA 1DANH 3EGKH 3BIVH 1GMHF 2AH4X 2XW9A 3ZZCA 2VIQA 1UK4A 1SFQB 1BJUA 3T27A 1E0FD 2RA3A 1W8BH 1RIWC 2BX3A 1LVYA 1LKBA 2C90B 2W5EA 3O8CA 4BAOB 1O3PB 4ABAA 3SJOA 2ZEBA 1ZHPA 1ANCA 1MU8B 1GJBB 2ANWA 1HAVB 3A84A 3CS7A 3GY2A 3URCA 2XWBI 4E06H 2F3CE 1AUJA 1Z7KA 3ZVAA 1NS3A 5G4BA 2R3YA 2NU4E 2UWPA 1O2HA 1DFPA 1P9UA 1FPCH 3MMGA 3HGPA 3SN8A 1GBBA 3TJOA 2P94A 1O36A 3UTUH 1O2IA 3RXUA 1S6FA 4ZHMU 1C4Y2 1D3PB 1DM4B 1F2SE 1TGTA 2P8OC 1N8OB 4GAWA 1AN1E 4AB9A 1O5CB 1S85A 2A5KA 1YM0A 1BRCE 1MTWA 3UREA 1C5MD 2WINI 4AOQA 1GBHA 1G2MA 1LVOA 2HVXA 2GVFA 2QXHA 4MLFB 1SB1H 1HAIH 1O2GH 1BQYA 1BOQA 1DX5M 3BTQE 1SGIB 1UTLM 2OLGA 4NZLA 4ZHAA 9ESTA 4A92A 2QC2A 2FTMA 2TPIZ 1ZRBA 2AYWA 3UPEA 1GHZA 4Y7AA 1LCYA 1UHBB 2QY0B 1F5RA 2FMJA 4YTAA 1YLCA 4Y10E 1QB9A 4IMQA 1TRYA 1EASA 1Y3YA 3SGBE 1ELCA 1WSSH 1C5OH 1GCDA 2VGCB 2W3IA 1NFWA 2FOGA 3UFAA 1C1RA 1TNHA 2QN5T 3FP8E 2V35A 1BA8B 4MNXA 4X2XA 1BDAA 5JPMH 1O2RA 1YF4A 1YPLH 3A8BA 4FUHA 1TQ0B 2AMPA 2IJOB 1MD8A 1O32A 4IN2A 4YOJA 1J17T 1AD8H 3RXOA 3E0PB 1OXGA 1QJ7B 2FM2A 4FUEA 3TGJE 2ODYB 4YLUA 4X8SH 2P59A 1JBUH 4XDEA 3LC3A 2JH5D 3FP6E 4ZMAH 1MKWK 3RLYH 3TK9A 2WUCA 2V3HH 3PTBA 3T25A 1GI9B 1LHDH 1C9PA 2BD7A 4X1NU 2ZA5A 2XYAA 3M5NA 1MTSA 2Z3EA 2GCHG 3P8FA 4NG9H 4NFFA 2XTTB 5FBIA 4INLA 1BIOA 2CGAA 3EA9A 4K2YA 1TA6A 2F83A 4AFUA 3RXAA 1O3BA 4OS2A 2ZU2A 2ZG0H 4A1TA 3PWBA 3SUFA 2ZCHP 4RN6A 1TNGA 2ZFSA 4BAMB 4Q80A 1ETSH 1O2KA 3SV8A 2FXRA 3F9FA 4IMZA 3E3TA 1YPJH 2JETC 2PTCE 2ZKSA 1HJAC 2P8OB 3TK5A 3TNSA 2BDBA 5T6GA 2K1QA 1PPZA 1UTQA 4M7GA 3A80A 5EW1H 2Y5HA 3SNCA 3K6ZA 2ALVA 1W0YH 1WBGB 4AX9H 5TCAA 8ESTE 1HDTH 1A5HA 2PV9B 1F5LA 3Q76A 3OU0A 4DVAU 1LHCH 1HJ8A 1KTSB 1RRKA 1HAYB 7GCHF 1Z8JB 2G51A 2HNTE 1XUGA 1DS2E 1VCQA 1A7SA 2CXVA 2TGDA 3RMOH 2GV7A 2WUBA 2Z9LA 5JBAS 5LPFA 5HXFA 1XXFA 4WH6A 1CBWC 3D23A 1C1VH 1K22H 1J15A 1ID5H 5TCCA 1HGTH 3ZVCA 3LGUA 2SGEE 1BMAA 2CF8H 2WYGA 4HZHA 1B0EA 5EQRA 1KLJH 2J92A 5K0HA 3U69H 1GJ9B 3U8RH 3LT3A 2YNBA 2VH0A 2F9NA 4KP0A 3VPKA 1DUAA 3RXFA 2VWNA 1O2WA 1CGJE 3TGIE 4XBBA 1FY5A 3MH5A 4D7FA 1O3MA 5J4QA 1XVMA 3ZVEA 4B76A 2ZDLA 3LDXH 3C1KA 4AG2A 3FP7E 2GKVE 2FOMB 1QQUA 1GHAF 1SQTA 1QCPA 3MNSA 3BEFB 2VWLA 4GCHG 3VXEH 5EQSA 1TMUH 3T26A 1BMNH 1LDTT 3GY4A 2ZO3H 3HGNA 1CHOG 5LPEA 2BXUH 3GY5A 5FPSA 3RUOA 1V2JT 4AYVB 2JETB 1HJAB 1ZMJA 3QWCH 1E35B 2BYAX 1RJXB 3FZDA 1ABIH 1BUIA 1OS8A 1GPZA 1QL8A 3FFGA 2XBXA 4ZKRU 3A87A 1IQFA 1NZQH 2TGTA 1THSH 1FN6A 1TWXB 3KQBA 3S7KB 1TX7A 1NRRH 5GPIB 4UFDH 1F0SA 5PTPA 1IQJA 2SGAA 3M37A 2XCNA 3SU6A 3ZZ9A 1YPEH 2XWAA 2PGBB 2PR3A 5EW2H 1ELDE 1QHRB 4NZQA 1CT4E 1O2XA 1G3CA 1LQEA 3EDXB 3PMJA 4X6NA 1QRZA 1ANDA 1C5UA 1GI4A 2ODQA 3RU4T 1IAUA 3P92A 2TGPZ 3GOVB 1BTWA 1V2TT 2H9TH 1KYNA 3MFJA 1TPSA 1YPHE 2QF0A 2GT8A 4A1XA 4BAKB 4Q7YA 1O2SA 1T8LA 2AIPA 3SUDA 1SGFG 1T8NA 3K2UA 2P3TB 3ATWA 1P10A 3MNCA 2OTVA 1O2OA 1UTJA 1SR5C 4ZXYH 2BY7X 1TNLA 4AZ2B 2Z9KA 3SI3H 1IHTH 3NXPA 4J1YA 4FUGA 4B1TA 2Y7ZA 3Q3YA 3RXQA 3E0NB 1PPCE 1NY22 1HAGE 3W95A 1Z1IA 1AZ8A 2ZQ2A 4FU9A 4ZH8A 1TRNA 5FAHA 3RMLH 4X2WA 1TNIA 1LHGH 5FX5A 1NU9A 1YPMH 3H5CB 1C4V2 2VINA 4Y7BA 4AFSA 2BHGA 4CH8B 2HPQH 1O2MA 1ZJDA 2FOEA 3D49H 1Y59T 3BTGE 1N6YA 1H9LB 2A1DB 1D3DB 1MBQA 2J9NA 3O8BA 2Z9JA 2UUJB 4DIHH 1WQVH 1FUJA 1O2JA 2FO9A 2ZHDA 3SNBA 4TPYA 3GICB 4TWYA 1V2RT 2GZ8A 4E05H 3L33A 3QTVH 1GG6C 5F8ZA 2J4IA 1C5XB 2D26C 4O3TA 3UWJH 1HXFH 2I6QA 3RXCA 8GCHF 1JRTA 5EODA 1DICA 3G01A 1OP0A 2ODPA 1FAKH 1AY6H 1L1JA 5AHGH 2CMYA 1C2DA 3PV4A 4OGYA 5DJ7A 4NSVA 1V2PT 3E91A 1C2EA 1G37A 3UUZA 2J34A 3TVJB 1Z6EA 1SGPE 2AS9A 2XRCA 5F8XA 3CS0A 2WYJA 4R0IA 4ISOA 4INKA 1QNJA 1AMHA 3AVZA 1OWIA 2H9EH 5ESBA 4AGKA 1OWJA 1G3DA 3LGIA 1D4PB 2HNTF 4JZFH 2B0FA 1ZTJA 2FI5E 2UWLA 2WPIS 3DFJA 3RXRA 2VIVA 2C4FH 8KME2 2SNWA 4CRGA 3MH6A 1LHEH 5K7RA 4MPXA 5E2PA 1S84A 5C1YA 5IDKA 1DY8A 1AE8H 3QN7A 4YOGA 4Y0ZE 3HPTB 3MOCA 2G4TA 4SGBE 2FS9A 4JZIA 3M3TA 2OXSA 3ODFA 1W12U 2UUKB 3M7TA 1O3EA 3I77A 1GJDB 3P8NA 4O3UA 3GY7A 3P8OA 1F0TA 3EA8A 1H8IH 2ESTE 3BG8A 5C5NA 4KKDA 1GL0E 1AFQC 2PKSC 1TAWA 1BB0B 3RDZA 3NPSA 1V2LT 1PFXC 3LOXA 1ZTLA 4FUCA 2HLCA 1SG8B 3QUMP 4CBNA 1AU8A 1O3CA 5A0AE 2TIOA 3BG4C 4K5ZA 2SGFE 5E8EH 2VH6A 1FONA 4HI3A 4X1SU 1YPHC 1TNKA 3B8JA 1BMMH 4AYYB 5C3NA 1VCWA 1GG6B 2RCEA 1A0HB 4JZ1A 4XBCA 3VFEA 1MD7A 3PMAB 1BBRE 3QGNB 4K69A 1A3BH 1QL9A 2EI7A 3SW2B 1OP2A 2HPPH 4H4FA 2BLWA 3SJKA 5GWZA 4GLYA 1LKAA 1ANBA 1BTZA 1LPGB 1GBJA 4IW4E 4Y8YA 2ZFRH 3E6PH 1KIGH 5CMXH 1WUNH 1DSTA 2W7SA 2H6MA 3M35A 1OOKB 4BNRA 1WOFA 1A2CH 1EKBB 4AN7A 1WYKA 1QY6A 1P2KA 5E0HA 3F9HA 1FXYA 1HCGA 3PWCA 5GDSH 4CR9A 4JCNA 1ZSLA 4YT7H 3F6UH 1C5RA 1L1NA 1SHHB 1IQNA 4CRCA 1BRBE 1P2NA 1GJAB 3BEUA 4DOQA 1AVXA 3KQCA 1UTKA 2O9QA 1A0LA 1LPZB 3EAJA 1Q31A 4TY6A 3QLPH 2VU8E 5HMAA 2C8YB 3BTHE 3TH4H 1NRQH 2H1UA 1SHYA 2BLOA 3T28A 3T62A 2OC1A 1E36B 3SBKA 3SNAA 3ZVGA 1ABJH 1K1MA 4GCHF 1EZSC 5T6FA 1DWBH 5E2OA 3V13A 4E7NA 4WJG2 1SQOA 4CHAC 1RD3B 4A5TS 1CHOF 2A2QH 4JK6A 1EOJA 2ZHWH 2FLBH 4X1QU 2BVXH 2FX4A 1C2GA 3VGCC 4ESTE 1BCUH 1AFQB 2PKSB 1QGFA 1P09A 2A4RA 5EU8A 3RXBA 1HAHH 4MPWA 4ZXXH 1BT7A 6ESTA 1W3CA 4YLQH 3D62A 2VIDA 3M5OA 3BG4B 2ZFTA 1YP9A 1EQ9A 1HIAB 1O2LA 1BHXF 2XNIA 3SJIA 1UCYH 1ELAA 3ZZBA 9LPRA 3U98H 1B5GH 1LTOA 3TLOA 2AMQA 1W7GH 1AI8H 2O8WA 4ZUHA 3O8RA 4JYUH 1C5TA 3DHKH 3A89A 4GPGA 4AB8A 5FX6A 1NU7B 2Z9GA 1XVOA 1P0SH 2J94A 3UWIA 5GCHG 1TRMA 2Y82A 2SGQE 2C3SA 4X2VA 4LZ4B 4B71A 3E1XB 1FPHH 3PLPA 2O8MA 3P17H 4WVPE 1YCPM 3SNDA 4WXIA 3SJ9A 1FY1A 1HAZB 2HWLB 3A8CA 4AG1A 1H4WA 1YKTA 4RKJB 4FVBA 1BHXB 3R3GB 1IQEA 3RXMA 1ZGVA 3RXDA 4DCDA 2F9VA 2ZZUH 3M7UA 4ABGA 4I8HA 1TLDA 1VGCC 1VJAU 2GZ9A 1IQKA 3DFLA 3RMMH 4JK5A 2QYIA 4IBLH 3BSQA 2V0BA 1SI5H 5C1XA 1GMCF 1EAXA 1SL3A 4WY3A 1SFIA 4KELA 1PQ8A 1SGCA 1PPBH 2C93B 3S9BA 2CF9H 3GCHC 2A7JA 4CHAB 1V2NT 1MZAA 4WH8A 1HAXB 1F0UA 2BLVA 2ZDKA 3LU9B 3MNXA 2XCFA 3MNBA 1NFUA 2F9BH 1MH0A 4FU7A 1EP6A 2STBE 5DG6A 3EE0B 3STJA 3A8AA 5AFZH 3VGCB 3RXKA 5JB9S 1DLEA 1P2MA 5L2YH 1PPEE 3TIUA 1GBDA 2ZGBH 1G3EA 2OD3B 4JZEH 2ZIQH 4FU8A 4ABHA 1G30B 2EI8A 2V6NA 3ENSB 4NWKA 4DG4A 1RIWB 1DWDH 1IQLA 3PMHB 2OCVB 4Y71A 1A61H 2O8LA 1GMDF 4MTBA 1BZXE 1ANEA 1O5BB 3UIRA 1JRSA 1LMWB 2ZHFH 2QXIA 3MU4A 3B23B 7LPRA 2FI4E 4BXSA 1GBKA 4X6OA 4HFPB 2GD4B 2Z7FE 2ZF0H 3KL6A 3RXIA 1GJ8B 4E7RG 5EG4A 1K1JA 2FOFA 1GBFA 2G81E 4ISLA 3GISB 1TGBA 4X1PU 1MQ5A 1PQAA 2ZP0H 4YOIA 1O3IA 1NESE 1AKSA 4NCYA 1GJ7B 3BTEE 3SV7A 5GIBA 3UQVA 1SLXB 1GBIA 1GCTC 3GCNA 2J38A 4Y76A 1TGSZ 1SVPA 3LPRA 2PSXA 1AWHB 4UFFH 1BITA 1P8VC 2FLRH 1ZSJA 2Z3DA 4A1VA 1FDPA 1AO5A 1TPAE 2I6SA 2FODA 4I32A 1C1PA 1C9TA 3KIDU 1FMGA 3O8DA 1TGCA 4BTTB 2QXJA 1GJCB 1SSXA 1P3CA 1J8AA 1VGCB 2KAIB 1P2QA 4ZKOU 1O3AA 2QA9E 3AW1A 1RTKA 1JIMA 1O0DH 3RXTA 5ETXA 1GGDC 1MKWH 3SUEA 2PKAB 1GBLA 5A8XA 1AQ7A 1SGRE 1V2UT 3GY8A 2ZU1A 1HV7A 2BY6X 3P70B 5T6DA 3GCHB 2R3UA 4JYVH 1KXCA 1UK3A 1P04A 2AIQA 1BRAA 2JKHA 2QV1A 2FIRH 1SQAA 1SGDE 1V3XA 2FPZA 4BXWA 4NIVA 1TX6A 1P05A 1QBOA 5HM2A 3TH3H 2C8ZB 1YGCH 3KHVA 1F0RA 1VCPA 5C67A 4Q7ZA 4LOYH 1KDQB 3KN2A 3ZVFA 1O3DA 2Y5GA 1LPKB 3LONA 1P2OA 5AFYH 2PLXA 1GVLA 2VIWA 3HKJB 5A8ZA 2GCTC 4B2BA 1UJ1A 2ZFQH 1DPOA 2WPLS 3LC5A 1SC8U 1G9IE 2F9OA 1TYNA 2O8UA 4LXBH 5A0BA 3Q3KA 1BTPA 2A2XH 1VITF 1OX1A 3S69A 3EQ0H 3RXPA 4DW2U 2B9LA 2J95A 2Q6GA 4Q2KA 3MWIU 5L6NH 1ZHRA 3GYLB 2Y6TA 4DGJA 1XUFA 1Y5UT 2P93A 3GCTF 4LZ1H 1OPHB 4D9RA 5DPAA 2Z6BD 2VVVA 3VB6A 4CRFA 2AEIH 1HRTH 3BTDE 4Z6AH 1GCTB 2ZDNA 1U6QA 3KCGH 1V2VT 2QGRA 1FIWA 1MTUA 1G36A 1W10U 5EPNA 4I8GA 4X8VH 3A7WA 1ESTA 3RM2H 1BRUP 1YCPK 2FDAA 4D8NA 2CV3A 1C4U2 3ZZ3A 2FEQH 4AFZA 1N1LA 1ZYOA 1BJVA 1P57B 2ZU5A 6GCHG 3ZZ7A 1SGTA 4B75A 1GGDB 4I7YH 1HJ9A 1GMHG 1MU6B 5FCRA 4B2CA 2A4GA 3MU0A 3VXFH 3AAVA 3URDA 3TITA 1YLDA 3HATH 4H6SB 4VGCC 4O9VA 3Q00A 2J2UA 5LGOA 1CBWB 1ZTKA 2IPHA 3A7XA 2HOBA 1TBQH 1V2MT 1SBWA 1VJ9U 2GMTC 1MMJN 2Q6FA 1HAOH 1QA0A 1EPTA 1GI8B 2FOBA 4K8BA 4PROA 1DWCH 3QK1A 1ESAA 3R0FA 1HXEH 3SV2H 2NU3E 2GT7A 1FJSA 4KTSA 3LGVA 3UR9A 3UNRA 2AGIX 2F9PA 3A7TA 2C8WB 1UO6A 2G8TA 2GCTB 3SZNA 4NA8A 3ZZ6A 2GX4A 4BTUB 2B7DH 4U32A 1WCZA 5DP3A 1HAVA 1QA7A 1HB0B 3OY6U 1Q2WA 2PUQH 4OS4A 1F7ZA 1QURH 1IQIA 2BZAA 4F4OC 1O3KA 1O3GA 1SLWB 5C20A 4KGAA 1GDUA 4AGJA 1GHVH 1AUTC 1V2QT 1C1WH 3KNXA 1A4WH 2VNTA 1OYTH 1UVPA 1ZPZA 5GXPA 1ZRKA 4U30A 4INHA 4I33A 3SQHE 1S6HA 2BVRH 5C1UA 3RC6A 3SORA 1ZSKA 2OBOA 2ZFPH 2GZ7A 1BTYA 2A45B 2A4OA 3ZZDA 4OS7A 1O5FH 1S5SA 4K60A 3NUMA 1GI2A 3ELAH 4Z0KA 3JZ2B 3AASA 5IYTA 1ELBA 1P12E 2PWXA 3BIUH 3VB3A 2W3KA 1UTNA 1ZPCA 4Y6DA 2YOLA 2ZCKP 3ATMA 1QRXA 3LJOA 2FP7B 1KXDA 1VZQH 2XC0A 2EC9H 1QJ6B 2FWWA 1CSOE 1CQQA 4MVNA 2A32A 4MDSA 1UVSH 1UHBA 3QGJA 5HGGA 2V3OH 2ZQ1A 3F1SB 1MAXA 3M61U 1Z8GA 3SGQE 1C5LH 1S0RA 1C5YB 1XMNB 2QXGA 1O2TA 2LPRA 3M3VA 2BY5X 2AGGX 3EA7A 1SGYE 2R0KA 1C5VA 1WV7H 1A1RA 3K6YA 3U8OH 4X1RU 3RXGA 1C1SA 2BXTH 4VGCB 1BTUA 1P11E 2XBWA 2OC0A 2GGVB 1EAIA 1DXPA 1XKBC 1NRNH 1O2QA 1TALA 1SGQE 1HBTH 2BDYA 1ELTA 5FXLA 1KTTB 3BN9A 2FOCA 2BQ6B 5GJ4B 4ZKSU 1H1BA 2WV5A 3PTNA 3RP2A 1W2KH 2PUXB 1FY8E 1CU1A 1KXBA 2VWOA 2GCHF 4IS5A 3AW0A 4A6LA 5A2MH 1H9HE 6CHAC 4FUIA 3T29A 1C2MA 2VWMA 5DK1A 1EJMA 1ESBA 4CR5A 1GL1A 2WPKS 3HK6B 3ATKA 1BBRK 3P8GA 3MI4A 1DSUA 2BDGA 1SLVB 3MU5A 1GBEA 1OWHA 2PW8H 3SHCH 5JBCS 2ZCLP 5FHTA 5CHAC 1CT0E 3QZRA 2OP9A 4OS6A 4LK4A 3M3SA 2NU0E 3EYDA 3LIWA 3A81A 4CH2B 1GBTA 3MO6A 3TJNA 1SLUB 5DKMA 7GCHG 4UFEH 4FUFA 4TYDA 1MKXK 2TRMA 1DE7H 2H5CA 1XUJA 2BTCE 1TMTH 1TPPA 2CJIA 1C1TA 1AFEH 1ZPBA 3S9AA 2ALPA 2ILNA 4O97A 3ZYEA 2AFQB 2GDEH 2P95A 1O3LA 1B7XB 1WTGH 4GHTA 2A5IA 4K1TA 1W11U 4WXVA 1XX9A 5FPTA 3SU0A 2OBQA 1DOJA 3F9GA 5TJXA 4YM9A 2A7CA 1SGEE 1NRPH 2G4UA 3IG6B 3LGYA 3IITA 3OTJE 3OYPA 1E34B 4BAHB 1YC0A 4Y11E 1XKAC 3ZVBA 4RKOB 1TPOA 3FAOA 1GI3A 2F91A 1C1UH 1C5NH 2PGQB 1PPGE 3L3TA 3M36A 1O3HA 1O2PA 3FZZA 3RXLA 5F6MA 5LH8A 1O2ZA 2ZDMA 4NFEA 2BD8A 1YYY1 1GI7B 3A7VA 1OKXA 1EX3A 1LHFH 5HM9A 3STIA 1YPKH 5A8YA 3Q77A 4X2YA 2FOAA 2BOHB 1GDNA 3KGPA 1AB9C 1BTXA 1GBCA 1OYQA 1NTPA 1GHAG 3SJ8A 1K1PA 7ESTE 1FQ3A 1S0QA 2ZHQH 1EZQA 3TGKE 1EJAA 3S7HB 2G5NA 1RXPA 1A3EH 1K1LA 3SNEA 3H7TA 3TPIZ 1ZHMA 1ZZZA 4K8YA 4ABDA 6CHAB 1P02A 2BD5A 4ASHA 1O38A 3MHWU 1Y8TA 3ZV8A 1W7XH 1TOMH 3LH3A 4ISIH 3SOSA
chains in the Genus database with same CATH superfamily
5EPYA 2VB0A 4H6TA 3PRDA 3SV9A 3RU4E 1GBAA 4CBOA 1QL7A 1YPGH 4K1SA 3DA9B 1AIXH 5C2ZA 1ZLRA 5BPEA 2ZU4A 1GI0A 1P06A 4KTCA 2FS8A 3VB7A 1HAPH 2GV6A 1TIOA 4I8KA 3A85A 3VB5A 4FXGH 3A83A 2FYRA 2BY9X 2ZU3A 2ULLA 1FN8A 1GVKB 3WWFA 4X6MA 4ABJA 3BV9B 1GI5A 1L4DA 3IWMA 2WPHS 4Y8XA 1H8DH 2OQ5A 3ITIA 5ABWA 5AF9H 1K1IA 1IOEA 1OSSA 5I25A 1J14A 2SNVA 1T7CA 3MU8A 3OY5U 3M5MA 2SGDE 5B6OA 3WY8A 1AZZA 1TGNA 1VITH 2KCAA 2BDCA 4BAQB 1TBRH 4IGDA 3U1JB 1EZXC 5T3HA 2ZPSA 4UEHH 1Y5BT 1E38B 1ZOMA 1IQGA 3BEIB 1XM1A 1OWDA 2IN2A 3QO6A 1EJNA 1ELEE 1E37B 4NWLA 2ZPQA 2HRVA 2BLQA 1DITH 1GI1A 1TBZH 4XE4A 4DT7B 1UMAH 2BY8X 4WMEA 5F8TA 1SOZA 1L2EA 2HALA 3QZQA 1HNEE 1UTOA 1V2OT 3ESTA 1GBMA 2BX4A 2ZPRA 2NWNA 2G52A 2Z94A 1AB9B 1CO7E 4UONA 4MQAA 2K8IA 1AWFH 1NBME 4BANB 1P2IA 1KY9A 1XUIA 2H2ZA 1C1QA 3DSGA 1P3EA 1EZUC 1JMOH 4MPUA 2SFAA 1GHBG 1AGJA 2BD2A 3MYWA 1S81A 2W26A 3B9FH 3QX5H 4WMDA 5A09A 5C0UA 1RTLA 2WPMS 2B5TB 2Q6DA 3SUGA 1Z6JH 2QF3A 2D2DA 1MTNC 4CREA 2A5AA 4I8LA 2GDDA 4NIWA 1T4UH 3LGTA 3V3MA 3E16B 4WWYA 1ZJKA 1EB2A 1THRH 2IJD1 2WPDD 1KMHB 5JBTA 4QT8C 2NU2E 1NPMA 2C8XB 4X6PA 1IQHA 3N7OA 4AFQA 8LPRA 8GCHG 1OWEA 1DT2A 3ODDA 1GHYH 2UUYA 4F49A 5E0JA 3PYHA 4THNH 4XSKU 1Z1JA 3A82A 1LVBA 1QB6A 4Q7XA 2WZQA 4YESB 2FZZA 2BQWB 2XBVA 4H42U 1HFDA 4YT6H 5IK2D 1IHSH 3ZIAD 1N6XA 1EUFA 2LNCA 2A31A 4XOJA 1K2I1 2DE8A 2JJ1D 1K21H 3MO3A 1NM6A 4Y79A 4GSOA 5EXMA 1QTFA 1FY4A 2DE9A 1C2JA 1O39A 1ZMLA 2PP6A 2R9PA 4Y8ZA 4MNYA 3A86A 3RC4A 1TX8A 4JZDH 1KXEA 1CA0C 1JXPA 1OWKA 1PPHE 1T8OA 1Z8RA 3A8DA 1T31A 1COWD 1F5KU 3A88A 1FLEE 1MCTA 1YBWA 4TY7A 3KQDA 3ZVDA 3F9EA 5AVDA 3RXSA 1J9CH 1QJ1B 4A7IB 2EA3A 1MTVA 4IC6A 3M7QA 2J98A 1O2UA 1D6RA 1O37A 1ARCA 1O3OA 1Q3XA 1WQSA 1O2NA 2ZNKH 4NIYA 3W94A 3PLKA 5DN6D 1TOCB 2JH6D 3PLBA 1ARBA 1RFNA 5KEDA 1M9UA 2ZHEH 4MNVA 1GI6A 1RGQA 1SMFE 4GUXA 3P95A 2ZC9H 1X7AC 2XXLA 1V2WT 2ZWLH 2VVUA 3LJJA 1EATA 3SV6A 1CE5A 3AAUA 3MH7A 1RTFB 1XXDA 1INCA 3A7YA 1IQMA 1C2LA 3ZYDA 1W14U 1T32A 1S82A 1K1OA 1MQ6A 1EOLA 1JIRA 3BF6H 2BD9A 4TT3D 2BD3A 1NT1A 4K3JA 1A0JA 1MTNB 2ASUB 1NFXA 3I78A 1WU1A 1CVWH 4B73A 1CGIE 1BMLA 5BRRE 1EB1H 1FAXA 3PV2A 3BTKE 1XUKA 1ACBE 1GJ5H 3GY3A 2V7QD 3F0OA 2AGEX 2EY4C 1GHWH 4BOHA 2Y5FA 1ELFA 3FANA 4TSFD 3UR6A 4I31A 1Y3VA 2FYQA 1O33A 2W7UA 1UK2A 1LO6A 1HLTH 2R2WU 4ABIA 4DIIH 3D65E 4D7GA 1EXFA 4OS1A 5FBEA 3RXJA 5ESTE 3UY9A 1FI8A 1C1MA 2A4QA 4XBDA 3KQEA 3SHAH 1QBVH 4XRNA 1GJ4H 3SI4H 1PYTC 1V2KT 1O35A 1FY3A 3E90B 1GWAA 3F0PA 3SU2A 2ZFFH 3PROA 4IC5A 1L1GA 1Z8IB 2OINA 2GP9B 2KM0A 5E0GA 5I46H 4ISHH 2A7HA 1CA0B 3MH4A 1DY9A 3RC5A 3PM3A 4OS5A 3UOUA 2L6OA 2STAE 4AORA 3C27B 1E1QD 2ZI2H 2PFEA 3OX7U 2D8WA 1TA2A 3RU4D 3SQEE 3UNSA 2BMGB 2P3UB 1CGHA 4CRAA 2RDLA 1O2VA 4RSPA 1TB6H 4O03A 1MBMA 4U2WA 1D6WA 5DP9A 3NZIA 1DWEH 1P2JA 2BVSH 2FI3E 3JZ1B 1JWTA 1KXFA 4U01A 1WAYB 4NGAH 1W13U 1GVZA 1QRWA 2ZDVH 2A0QB 2BM2A 3ZV9A 4X0WU 4JYTA 4D9QA 1MAYA 5DP8A 3DT0H 4XFQA 2Y81A 4YXWD 2WV4A 1C1NA 3GDUA 1PJPA 5JBBS 2VJ1A 3PO1C 5EQQA 1QB1A 3V0XA 3UQOA 2BDIA 5DP5A 1ZMNA 1O2YA 5C94A 1ELVA 1MZDA 3PB1E 2CN0H 5DGJA 4ZKNU 5SGAE 2EQNA 2PHBA 1RS0A 1V6DA 4ISNA 1DDJA 3BTFE 3LH1A 5L30H 1TFXA 3KF2A 2YNAA 3K9XB 1ORFA 3TJUA 5FCKA 1FZZA 2RA0A 2UWOA 3V7TA 2G55A 4HG6A 1H9IE 4I8JA 1OP8A 2XBYA 1TNJA 1D3QB 1HIAA 1BTHH 2P16A 3RLWH 3SU1A 4DURA 1Y5AT 3NCLA 4Q4LA 5EGMA 3VB4A 3P6ZB 3GCOA 4ABFA 3QDZB 2JH0D 1P03A 1QBNA 3LGWA 3U1IB 5J4SA 4RT0A 3DD2H 5GCHF 1G2LA 2PSYA 2BOKA 2OC8A 3BTTE 1NBMD 1EAUA 5C5OA 1PYTD 2DUCA 1YCPH 2RG3A 3U8TH 2HVYB 3GY6A 1L4ZA 2B8OH 5C17A 2VVCA 3FVFB 4SGAE 1MCVA 1NROH 1O30A 4FUBA 3QTOH 4HGCA 4B74A 1HUTH 1GDQA 1GHXH 4GVUA 3ATIA 2PTNA 3L6PA 4YZUA 2AERH 3VEQB 3GDVA 3RXEA 2QCYA 1GMCG 1QQ4A 2THFB 1TONA 3TU7H 1UVTH 2IOTA 2TGAA 2HNTC 3T5FH 4NIXA 1C2FA 2ZGHA 5FPYA 3DUXH 1C5ZB 2XC5A 4KTUA 1Y3UA 1P01A 4P02A 4FUJA 1O31A 3OSYA 1GHBF 3U9AH 2K0QA 2O8TA 4ABEA 4CRBA 2ANKH 2UUFB 3ZZ4A 1UVOA 2AMDA 4BTIB 4UFGH 3CP7A 4UE7H 2KR7A 2ZGXH 4HTCH 2GTBA 2ZECA 3NK8A 1ETRH 1ZGIA 1A5IA 1DUEA 3ATLA 3PMBB 4TWWA 3PO1B 1FX0B 1TABE 1SGFA 3Q3XA 1GMDG 5JDUB 1A5GH 4MNWA 3RXVA 3SO3A 1MUEB 1LQDB 1O3FA 2GMTB 4ZHLU 4OGXA 4GHQA 4ZROA 1O5DH 1QFKH 1AE5A 5A0CA 5EXNA 2HGTH 1S83A 1PQ7A 2BQ7B 1NC6A 1O3NA 3TH2H 1DVAH 1D3TB 2ZTYA 1AKSB 1P9SA 5JYIA 1O3JA 2NU1E 1G32B 5CE1A 4R8TB 3UOPA 1THPB 2CK3D 2F9UA 2BZ6H 1D9IA 1KLIH 4UDWH 4WMFA 4B2AA 2OC7A 1T4VH 1T8MA 2V3MA 2CHAC 4K1EA 1UTMA 4DJZB 4NSYA 4WF8A 1C5WB 2EI6A 2G00A 1K1NA 2ZTXA 4MPVA 4ZAEA 1C1OA 1O5EH 1Y3XA 2BB4A 4X8UH 4Y0YE 1UVUH 1Z71A 3RMNH 3NRLA 2ANYA 3RXHA 3SU3A 4F55A 1C2IA 3UNQA 2R2MB 1O5AB 2FOHA 1J16A 2Q1JA 1KSNA 3TJVA 2H9HA 1CA8B 5F03A 5DO4H 3ZZ5A 4FVDA 1K28D 3I29A 3CENA 1W0ZU 3S9CA 3DSOA 1EPTC 3M5LA 1C5SA 2BDAA 2VIOA 2Z3CA 3NKKA 2BD4A 1GJ6A 2KAIA 3GDSA 1G3BA 3BTME 3T2NA 2OQUA 3BTWE 4J2YB 1Y3WA 2ZGJA 1AVWA 3ZZAA 2XC4A 3FN8A 2FTLE 2BDHA 2PKAA 2Y80A 3N7DA 3K65B 1BMFD 4D76A 4FUDA 2Y7XA 1AVGH 2GJGA 2VIPA 3MTYA 4DY7B 1L0ZA 7KMEH 1BBRH 1HYLA 1EAWA 2ANMH 2YMSC 3OEED 5L2ZH 2QIQA 5DP4A 3V12A 2SGPE 2ZDAH 4MG3A 1NRSH 2G5VA 3ZZ8A 2ZGCA 1CHGA 3NWUA 1VITG 4M9FA 1ELGA 4ABBA 3MU1A 3TNTA 1TE0A 3S0NA 1QIXB 3TK6A 2R0LA 1KDQA 3SU5A 4X8TH 1VR1H 1ETTH 1SGNE 2F43B 4UD9H 4IN1A 2H5DA 1LVMA 2EEKA 3GCTG 2QE7D 1TMBH 1MKXH 3LKWA 1AHTH 1N8OC 2ZTZA 1V2ST 4CRDA 1UCYK 1F92A 3EE7A 4TPIZ 1A46H 2P3FH 1XUHA 1NN6A 2QAAA 1C5PA 2WPJS 3MO9A 5DP7A 1CT2E 5JB8S 1H8ED 2TBSA 1PQ5A 2CHAB 3F68H 1PPFE 2M5TA 3HKIB 4NA7A 1K9OE 1NFYA 5DP6A 5EXLA 5CHAB 1SOTA 1O5GH 2D1JA 2FX6A 2OK5A 2LELA 1ZR0A 2VBCA 2VGCC 1SPJA 1HPGA 1UTPA 4JMYA 1B0FA 5HYOA 3A7ZA 1FIZA 2RDEA 1QR3E 2Z9IA 2FESH 4YO9A 3E8LA 1KLTA 1NO9H 3HK3B 1DLKB 1KXAA 3SU4A 1C2HA 1EP5A 1O34A 1WTHD 1UCYE 1JOUB 3GYMA 4NA9H 3SGAE 1FV9A 1DXWA 1EPTB 6GCHF 3H7OA 1FNIA 3RM0H 4Q63A 5H4IB 1C5QA 1TQ7B 6LPRA 5LPRA 1C2KA 2OUAA 3KEEA 5EOKA 1DANH 3EGKH 1QZ8A 3BIVH 1GMHF 2AH4X 2XW9A 3ZZCA 2VIQA 1UK4A 1SFQB 1BJUA 3T27A 1E0FD 2RA3A 1W8BH 1RIWC 2BX3A 1LVYA 1LKBA 2C90B 2W5EA 3O8CA 4BAOB 1O3PB 4ABAA 3SJOA 2ZEBA 1ZHPA 1ANCA 1MU8B 1GJBB 2YMSD 2ANWA 1HAVB 2YMSB 1SQRA 3KQ5A 3A84A 3CS7A 3GY2A 3URCA 2XWBI 4E06H 2F3CE 1AUJA 1Z7KA 3ZVAA 1NS3A 2QF4A 5G4BA 4ACBA 2R3YA 2NU4E 2UWPA 1O2HA 1DFPA 1P9UA 1FPCH 3MMGA 3HGPA 3SN8A 1GBBA 3TJOA 2P94A 1O36A 3UTUH 1O2IA 3RXUA 1S6FA 4ZHMU 1C4Y2 1D3PB 1DM4B 1F2SE 1TGTA 2P8OC 1N8OB 4GAWA 1AN1E 4AB9A 1O5CB 1S85A 2A5KA 1YM0A 1BRCE 1MTWA 3UREA 1C5MD 2WINI 4AOQA 1GBHA 1G2MA 1LVOA 2HVXA 2GVFA 2QXHA 4MLFB 1SB1H 1HAIH 1O2GH 1BQYA 1BOQA 1DX5M 3BTQE 1SGIB 1UTLM 2OLGA 4NZLA 4ZHAA 9ESTA 4A92A 2QC2A 2FTMA 2TPIZ 1ZRBA 2AYWA 3UPEA 1GHZA 4Y7AA 1LCYA 1UHBB 2QY0B 1F5RA 5KGOA 2FMJA 4P00A 4YTAA 1YLCA 4Y10E 1QB9A 4IMQA 1TRYA 1EASA 5HIYA 1Y3YA 3SGBE 1ELCA 1WSSH 1C5OH 1GCDA 2VGCB 2W3IA 1NFWA 2FOGA 3UFAA 1C1RA 1TNHA 2QN5T 3FP8E 2V35A 1BA8B 4MNXA 2RFKC 4DT4A 4X2XA 1BDAA 5JPMH 1O2RA 1YF4A 1YPLH 3A8BA 4FUHA 1TQ0B 2AMPA 4I86A 2IJOB 1MD8A 1O32A 4IN2A 4YOJA 1J17T 1W0JD 1AD8H 3RXOA 3E0PB 1OXGA 1WXRA 1QJ7B 2FM2A 4FUEA 3TGJE 2ODYB 4XD7D 2J5UA 4YLUA 2KZ4A 4X8SH 2P59A 1JBUH 4RT1A 4XDEA 3LC3A 2JH5D 3FP6E 4ZMAH 1MKWK 3RLYH 3TK9A 2QF5A 2WUCA 2V3HH 3PTBA 3T25A 1GI9B 1LHDH 1C9PA 2BD7A 4X1NU 2ZA5A 2XYAA 2KFWA 1MTSA 3M5NA 2Z3EA 2GCHG 3P8FA 4NG9H 4NFFA 2XTTB 5FBIA 4INLA 1BIOA 2CGAA 3EA9A 4K2YA 1TA6A 2F83A 4AFUA 3RXAA 1O3BA 4OS2A 2ZU2A 2ZG0H 4A1TA 3PWBA 3SUFA 2ZCHP 4RN6A 1TNGA 2ZFSA 4BAMB 1MABB 4Q80A 1ETSH 1O2KA 3SV8A 2FXRA 3F9FA 1W0KD 4IMZA 3E3TA 1YPJH 2JETC 2PTCE 2ZKSA 1HJAC 2P8OB 3TK5A 3TNSA 2BDBA 5T6GA 2K1QA 1PPZA 1UTQA 4M7GA 3A80A 5EW1H 2Y5HA 3SNCA 3K6ZA 2ALVA 1W0YH 1WBGB 4AX9H 5TCAA 8ESTE 1HDTH 1A5HA 5GNDA 2PV9B 1F5LA 3Q76A 3OU0A 4DVAU 2WV9A 3DSPA 1LHCH 1HJ8A 1KTSB 1RRKA 1HAYB 7GCHF 1Z8JB 2G51A 2HNTE 1XUGA 1DS2E 1VCQA 1A7SA 2CXVA 5F53A 2TGDA 3RMOH 2GV7A 2WUBA 2Z9LA 3WWBA 5JBAS 5LPFA 3MQKC 5HXFA 1XXFA 4WH6A 1CBWC 3D23A 1C1VH 1K22H 1J15A 2HLDD 1ID5H 5TCCA 1HGTH 3ZVCA 3LGUA 2SGEE 1BMAA 2CF8H 2WYGA 4HZHA 1B0EA 5EQRA 1KLJH 2J92A 5K0HA 3U69H 1GJ9B 3U8RH 3LT3A 3KYFA 5EIYA 2YNBA 2VH0A 2F9NA 4KP0A 3VPKA 1DUAA 1K0HA 3RXFA 2VWNA 1O2WA 1CGJE 3TGIE 4XBBA 1FY5A 3MH5A 4D7FA 3PV5A 1O3MA 5J4QA 1XVMA 3ZVEA 4B76A 2ZDLA 3LDXH 3C1KA 4AG2A 4F48B 3FP7E 2GKVE 2FOMB 1QQUA 1GHAF 1SQTA 1QCPA 3MNSA 3BEFB 2VWLA 4GCHG 3VXEH 5EQSA 1TMUH 3T26A 1BMNH 1LDTT 2LP6A 3GY4A 2ZO3H 3HGNA 1CHOG 5LPEA 2BXUH 3GY5A 5FPSA 3RUOA 5T1VA 1V2JT 4AYVB 2JETB 1HJAB 1ZMJA 3QWCH 1E35B 2BYAX 1RJXB 3FZDA 1ABIH 1BUIA 1OS8A 1GPZA 1QL8A 3FFGA 3F2FA 2XBXA 4ZKRU 3A87A 1IQFA 1NZQH 2TGTA 1THSH 1FN6A 1TWXB 3KQBA 3S7KB 1TX7A 1NRRH 5GPIB 4UFDH 1F0SA 5PTPA 1IQJA 2SGAA 3M37A 2XCNA 3SU6A 3ZZ9A 1YPEH 2XWAA 2PGBB 2PR3A 5EW2H 1ELDE 1QHRB 4NZQA 1CT4E 1O2XA 1G3CA 1LQEA 3EDXB 3PMJA 2W6JD 4X6NA 1QRZA 1ANDA 1C5UA 1GI4A 2ODQA 3RU4T 1IAUA 3P92A 2TGPZ 3GOVB 1BTWA 1V2TT 2H9TH 1KYNA 3MFJA 1TPSA 1YPHE 2QF0A 2GT8A 4A1XA 4BAKB 4Q7YA 1O2SA 1T8LA 2AIPA 3SUDA 1SGFG 1T8NA 3UAIC 3K2UA 2P3TB 3ATWA 1P10A 3MNCA 2OTVA 1O2OA 1UTJA 1SR5C 4ZXYH 2BY7X 1TNLA 4AZ2B 2Z9KA 3SI3H 1IHTH 3NXPA 4J1YA 4FUGA 4B1TA 2Y7ZA 3Q3YA 3RXQA 3E0NB 3CNRA 1PPCE 1NY22 1HAGE 3W95A 1Z1IA 1AZ8A 2ZQ2A 4FU9A 4ZH8A 1TRNA 5FAHA 3RMLH 4X2WA 1TNIA 1LHGH 5FX5A 1NU9A 1YPMH 3SYJA 3H5CB 1C4V2 2VINA 4Y7BA 4AFSA 2BHGA 4CH8B 2HPQH 1O2MA 1ZJDA 2FOEA 3D49H 1Y59T 3BTGE 1WDIA 1N6YA 1H9LB 2A1DB 1D3DB 1MBQA 2J9NA 3O8BA 2Z9JA 2UUJB 4DIHH 1WQVH 1FUJA 1O2JA 2FO9A 2ZHDA 3SNBA 4TPYA 3GICB 4TWYA 1V2RT 2GZ8A 4E05H 3L33A 3QTVH 1GG6C 5F8ZA 5HIZA 2J4IA 1C5XB 2D26C 4O3TA 3UWJH 1HXFH 2I6QA 3RXCA 8GCHF 1JRTA 5EODA 1DICA 3G01A 1OP0A 2ODPA 1FAKH 1AY6H 1L1JA 5AHGH 2CMYA 1C2DA 3PV4A 4OGYA 5DJ7A 4NSVA 3W1EA 1V2PT 3E91A 1C2EA 1G37A 3UUZA 2J34A 3TVJB 2JJ2D 1Z6EA 1SGPE 2AS9A 2XRCA 5F8XA 3CS0A 2WYJA 4R0IA 4ISOA 5CHBA 4INKA 1QNJA 1AMHA 3AVZA 1OWIA 2H9EH 4Z1MD 5ESBA 4AGKA 1OWJA 1G3DA 3LGIA 1D4PB 2HNTF 2J97A 4JZFH 2B0FA 1ZTJA 2FI5E 2J98B 2UWLA 2WPIS 3DFJA 3RXRA 2VIVA 2C4FH 8KME2 2SNWA 4CRGA 3MH6A 1LHEH 5K7RA 4MPXA 5E2PA 1S84A 5C1YA 5IDKA 1DY8A 1AE8H 3QN7A 4YOGA 4Y0ZE 3HPTB 3MOCA 2G4TA 4SGBE 2FS9A 3DCLA 4JZIA 3M3TA 3OE7D 2OXSA 3ODFA 1W12U 2UUKB 3M7TA 1O3EA 3I77A 1GJDB 3P8NA 4O3UA 3GY7A 3P8OA 1F0TA 3EA8A 1H8IH 2ESTE 3N7EA 3BG8A 5C5NA 4KKDA 3U28C 1GL0E 1AFQC 2PKSC 1TAWA 1BB0B 3RDZA 3NPSA 1V2LT 1PFXC 3LOXA 1ZTLA 4FUCA 2HLCA 1SG8B 3QUMP 4CBNA 1AU8A 1O3CA 5A0AE 2TIOA 3BG4C 4K5ZA 2SGFE 5E8EH 2VH6A 1FONA 4HI3A 4X1SU 1YPHC 2L74A 1TNKA 3B8JA 1BMMH 4AYYB 5C3NA 1VCWA 1GG6B 2RCEA 1A0HB 4JZ1A 4XBCA 3VFEA 1MD7A 3PMAB 1BBRE 3QGNB 4K69A 1YWUA 1A3BH 1QL9A 2EI7A 3SW2B 1OP2A 2HPPH 4H4FA 2BLWA 3SJKA 4AC9A 5GWZA 4GLYA 1LKAA 1ANBA 1BTZA 1LPGB 1GBJA 4IW4E 4Y8YA 2ZFRH 3E6PH 1KIGH 5CMXH 1WUNH 1DSTA 2W7SA 4OM9A 2H6MA 3M35A 1OOKB 4BNRA 1WOFA 1A2CH 1EKBB 2KCYA 4AN7A 1WYKA 1QY6A 1P2KA 5E0HA 2XNDD 3F9HA 1FXYA 1HCGA 3PWCA 5GDSH 4CR9A 4JCNA 1ZSLA 4YT7H 3F6UH 1C5RA 1L1NA 1SHHB 1IQNA 4CRCA 1BRBE 1P2NA 1GJAB 3BEUA 4DOQA 1AVXA 3KQCA 1UTKA 2O9QA 1A0LA 1LPZB 1EFRD 1Q31A 3EAJA 4TY6A 3QLPH 2VU8E 5HMAA 2C8YB 3BTHE 3OEHD 1NRQH 3TH4H 2H1UA 1SHYA 2BLOA 3T28A 3T62A 2OC1A 1E36B 3SBKA 3SNAA 3ZVGA 1ABJH 1K1MA 4GCHF 1EZSC 5T6FA 1DWBH 5E2OA 3V13A 4E7NA 4WJG2 1SQOA 4CHAC 1RD3B 4A5TS 1CHOF 2A2QH 4JK6A 1EOJA 2ZHWH 2FLBH 1UW7A 4X1QU 2BVXH 2FX4A 1C2GA 3VGCC 4ESTE 1BCUH 1AFQB 2PKSB 1QGFA 1P09A 2A4RA 5EU8A 3RXBA 1HAHH 4MPWA 4ZXXH 1BT7A 6ESTA 1W3CA 4YLQH 3D62A 2VIDA 3M5OA 3BG4B 2ZFTA 1YP9A 1EQ9A 1HIAB 1O2LA 1BHXF 2XNIA 3SJIA 1UCYH 1ELAA 3ZZBA 9LPRA 3U98H 1B5GH 1LTOA 3KYGA 3TLOA 2AMQA 1W7GH 1AI8H 2O8WA 4ZUHA 3O8RA 4JYUH 1C5TA 3DHKH 3A89A 4GPGA 4AB8A 5FX6A 1NU7B 2Z9GA 1XVOA 1P0SH 2J94A 3UWIA 1VKYA 5GCHG 1TRMA 2Y82A 2SGQE 2C3SA 4X2VA 4LZ4B 4B71A 3E1XB 1FPHH 3PLPA 2O8MA 3P17H 4WVPE 1YCPM 3SNDA 4WXIA 3SJ9A 1FY1A 1HAZB 2HWLB 3A8CA 4AG1A 1H4WA 1YKTA 4RKJB 4FVBA 1BHXB 3R3GB 1IQEA 3RXMA 1ZGVA 3RXDA 4DCDA 2F9VA 2ZZUH 3M7UA 4ABGA 4I8HA 1TLDA 1VGCC 1VJAU 2GZ9A 1IQKA 3DFLA 3RMMH 4JK5A 2QYIA 4IBLH 3BSQA 2V0BA 1SI5H 5C1XA 1GMCF 1EAXA 5FL7D 1SL3A 4WY3A 1SFIA 4KELA 1PQ8A 1SGCA 1PPBH 2C93B 3H09A 3S9BA 2WSSD 2CF9H 3GCHC 2A7JA 4CHAB 1V2NT 1MZAA 4WH8A 1HAXB 4FETA 1F0UA 2BLVA 2ZDKA 3LU9B 3MNXA 2XCFA 3MNBA 1NFUA 2F9BH 1MH0A 4FU7A 1EP6A 2STBE 5DG6A 3EE0B 3STJA 3A8AA 5AFZH 3VGCB 3RXKA 5JB9S 1DLEA 1P2MA 5L2YH 1PPEE 3TIUA 1GBDA 2ZGBH 1G3EA 2OD3B 2WHXA 4JZEH 2ZIQH 4FU8A 4ABHA 1G30B 2EI8A 2V6NA 3N99A 3ENSB 3OAAD 4NWKA 4DG4A 1RIWB 1DWDH 1IQLA 3PMHB 2OCVB 4Y71A 1A61H 2O8LA 1GMDF 2XOKD 4MTBA 1BZXE 1ANEA 1O5BB 3UIRA 1JRSA 1LMWB 2ZHFH 2QXIA 3MU4A 3B23B 7LPRA 2FI4E 3FOAA 1GBKA 4BXSA 4X6OA 4HFPB 4FOUC 2GD4B 2Z7FE 2AHME 2ZF0H 3KL6A 3RXIA 1GJ8B 4E7RG 5EG4A 1K1JA 2FOFA 1GBFA 2G81E 4ISLA 3GISB 1TGBA 4X1PU 1MQ5A 3GS9A 1PQAA 2ZP0H 4YOIA 1O3IA 1NESE 1AKSA 4NCYA 1GJ7B 3BTEE 3SV7A 5GIBA 3UQVA 1SLXB 1GBIA 1GCTC 3GCNA 1OHHD 2J38A 4RI0A 4Y76A 2W6ID 1TGSZ 1SVPA 3LPRA 2PSXA 1AWHB 4UFFH 1BITA 3FKSD 1P8VC 2FLRH 1ZSJA 2Z3DA 4A1VA 1FDPA 1AO5A 1TPAE 2I6SA 2FODA 4I32A 1C1PA 3F2GA 1C9TA 3FO8D 3KIDU 1FMGA 3O8DA 1TGCA 4BTTB 2QXJA 1GJCB 1SSXA 1YLNA 1P3CA 1J8AA 1VGCB 2KAIB 1P2QA 4ZKOU 1O3AA 2QA9E 3AW1A 1RTKA 1JIMA 1O0DH 3RXTA 5ETXA 1GGDC 1MKWH 3SUEA 3PRBA 2PKAB 1GBLA 5A8XA 1AQ7A 1SGRE 1V2UT 3WW7A 3GY8A 2ZU1A 1HV7A 2BY6X 3P70B 5T6DA 3GCHB 2R3UA 4JYVH 1KXCA 1UK3A 1P04A 2AIQA 1BRAA 2JKHA 2QV1A 2FIRH 1SQAA 1SGDE 1V3XA 2FPZA 4BXWA 4NIVA 1TX6A 1P05A 1QBOA 5HM2A 5CDFE 3TH3H 2C8ZB 1YGCH 3KHVA 1F0RA 1VCPA 5C67A 4Q7ZA 4LOYH 1KDQB 3KN2A 3ZVFA 1O3DA 2Y5GA 1LPKB 3LONA 1P2OA 5AFYH 2PLXA 1GVLA 2VIWA 3HKJB 5A8ZA 2GCTC 4B2BA 1UJ1A 2ZFQH 1DPOA 2WPLS 3LC5A 1SC8U 1G9IE 2KX4A 2F9OA 1TYNA 2JDID 2O8UA 4LXBH 5A0BA 3Q3KA 1BTPA 5EJLA 2A2XH 1VITF 1OX1A 3S69A 3EQ0H 3RXPA 4DW2U 2B9LA 2J95A 2Q6GA 5C0TA 4Q2KA 3MWIU 5L6NH 1ZHRA 3GYLB 2Y6TA 4DGJA 1XUFA 1Y5UT 2P93A 3GCTF 4LZ1H 1OPHB 4D9RA 5DPAA 2Z6BD 2VVVA 3VB6A 4CRFA 2AEIH 1HRTH 3BTDE 4Z6AH 1GCTB 2ZDNA 1U6QA 3KCGH 1V2VT 2QGRA 1FIWA 1MTUA 1G36A 1W10U 5EPNA 4I8GA 4X8VH 3A7WA 1ESTA 4ASUD 3RM2H 1BRUP 1YCPK 2FDAA 4D8NA 2CV3A 1C4U2 3ZZ3A 2FEQH 4AFZA 2IPQX 1N1LA 1ZYOA 1BJVA 1P57B 2ZU5A 4ACAA 6GCHG 3ZZ7A 1SGTA 4B75A 1GGDB 4I7YH 1HJ9A 1GMHG 1MU6B 5FCRA 4B2CA 2A4GA 3MU0A 3VXFH 3AAVA 3URDA 3TITA 1YLDA 3HATH 5EJ1A 4H6SB 4VGCC 4O9VA 1SKYE 3Q00A 2J2UA 2KCOA 5LGOA 1CBWB 1ZTKA 2IPHA 3A7XA 2HOBA 1TBQH 1V2MT 1SBWA 1VJ9U 2GMTC 1MMJN 2Q6FA 1HAOH 1QA0A 1EPTA 1GI8B 2FOBA 4K8BA 4PROA 1DWCH 3QK1A 1ESAA 3R0FA 1HXEH 3SV2H 2NU3E 2GT7A 1FJSA 4KTSA 3LGVA 5HKKD 3UR9A 3UNRA 2AGIX 2F9PA 3A7TA 2C8WB 1UO6A 2G8TA 4B6FA 2GCTB 3SZNA 4NA8A 3ZZ6A 2GX4A 4BTUB 2B7DH 4U32A 1WCZA 3F3BA 1HAVA 1QA7A 1HB0B 3OY6U 1Q2WA 2PUQH 4OS4A 1F7ZA 1QURH 1IQIA 2BZAA 4F4OC 1O3KA 1O3GA 1SLWB 2F4LA 5C20A 4KGAA 1GDUA 4AGJA 1GHVH 1AUTC 1V2QT 1C1WH 3KNXA 5KECA 1A4WH 2VNTA 1OYTH 1UVPA 1ZPZA 2KCPA 5GXPA 1ZRKA 4U30A 4INHA 4I33A 3SQHE 1S6HA 2BVRH 5C1UA 3RC6A 3SORA 1ZSKA 2OBOA 2ZFPH 2GZ7A 1BTYA 2A45B 2A4OA 3ZZDA 4OS7A 1O5FH 1S5SA 4K60A 3NUMA 1GI2A 3ELAH 4Z0KA 1E1RD 3JZ2B 3AASA 5IYTA 1ELBA 1P12E 2PWXA 3BIUH 3VB3A 2W3KA 1UTNA 1ZPCA 4Y6DA 1S6LA 3UB0A 2YOLA 2ZCKP 5EJZA 3ATMA 1QRXA 3LJOA 2FP7B 1KXDA 1VZQH 2XC0A 2EC9H 1QJ6B 2FWWA 1CSOE 1CQQA 4MVNA 2A32A 4MDSA 1UVSH 1UHBA 3QGJA 5HGGA 2V3OH 2ZQ1A 3F1SB 1MAXA 3M61U 1Z8GA 3SGQE 1C5LH 1S0RA 1C5YB 1XMNB 2QXGA 1O2TA 2LPRA 3M3VA 2BY5X 2AGGX 3EA7A 1SGYE 2R0KA 1C5VA 3SZEA 1WV7H 1A1RA 3K6YA 3U8OH 4X1RU 3RXGA 1C1SA 2BXTH 4VGCB 1BTUA 1P11E 2XBWA 2OC0A 2GGVB 1EAIA 1DXPA 1XKBC 1NRNH 1O2QA 1TALA 1SGQE 1HBTH 2BDYA 1ELTA 5FXLA 1KTTB 3BN9A 2FOCA 2BQ6B 5GJ4B 4ZKSU 5B6LA 1H1BA 2WV5A 3PTNA 3RP2A 1W2KH 1E79D 2PUXB 1FY8E 1CU1A 1KXBA 2VWOA 2GCHF 4IS5A 3AW0A 4A6LA 3F2HA 5A2MH 1H9HE 6CHAC 4FUIA 3T29A 1C2MA 2VWMA 5DK1A 1EJMA 1ESBA 2JIZD 4CR5A 1GL1A 2WPKS 3HK6B 3ATKA 1BBRK 3P8GA 3MI4A 1DSUA 2BDGA 1SLVB 3MU5A 1GBEA 1OWHA 2PW8H 3SHCH 5JBCS 2ZCLP 5FHTA 5CHAC 1CT0E 3QZRA 2OP9A 4OS6A 4LK4A 3M3SA 2NU0E 3EYDA 3LIWA 3A81A 4CH2B 1GBTA 3MO6A 3TJNA 1SLUB 5DKMA 7GCHG 4UFEH 4FUFA 4TYDA 1MKXK 2TRMA 1DE7H 3VG8A 2H5CA 1XUJA 2BTCE 1TMTH 1TPPA 2CJIA 1C1TA 1AFEH 1ZPBA 4B6EA 3S9AA 1H8HD 2ALPA 2ILNA 4O97A 3ZYEA 2AFQB 2GDEH 2P95A 1O3LA 1B7XB 1WTGH 4GHTA 2A5IA 4K1TA 1W11U 4WXVA 1XX9A 5FPTA 3SU0A 2OBQA 1DOJA 3F9GA 5TJXA 4YM9A 2A7CA 1SGEE 5DSFA 1NRPH 2G4UA 3IG6B 3LGYA 5DP3A 3IITA 3OTJE 3OYPA 1E34B 4BAHB 1YC0A 4Y11E 1XKAC 3ZVBA 4RKOB 1TPOA 2M2AA 3FAOA 1GI3A 2F91A 1C1UH 1C5NH 2PGQB 1PPGE 3L3TA 3M36A 1O3HA 1O2PA 3FZZA 3RXLA 5F6MA 5LH8A 1O2ZA 2ZDMA 4NFEA 2BD8A 1YYY1 1GI7B 3A7VA 1OKXA 1EX3A 1LHFH 5HM9A 3STIA 1YPKH 5A8YA 3Q77A 4X2YA 2FOAA 2BOHB 1GDNA 3KGPA 1AB9C 1BTXA 1GBCA 1OYQA 1NTPA 1GHAG 3AK5A 3SJ8A 1K1PA 7ESTE 1FQ3A 1S0QA 2ZHQH 1EZQA 3TGKE 1EJAA 3S7HB 2G5NA 1RXPA 1A3EH 1K1LA 3OTPA 3SNEA 3H7TA 3TPIZ 1ZHMA 1ZZZA 4K8YA 4ABDA 6CHAB 1P02A 2BD5A 4ZCNA 1YY3A 4ASHA 1O38A 3MHWU 1Y8TA 3ZV8A 1W7XH 1TOMH 3LH3A 3OFND 4ISIH 3SOSA
chains in the Genus database with same CATH topology
5EPYA 2VB0A 4H6TA 3SV9A 3RU4E 1GBAA 4CBOA 1QL7A 1YPGH 4K1SA 3DA9B 1AIXH 5C2ZA 1ZLRA 5BPEA 2ZU4A 1GI0A 1P06A 4KTCA 2FS8A 3VB7A 1HAPH 2GV6A 1TIOA 4I8KA 3A85A 3VB5A 4FXGH 3A83A 2FYRA 2BY9X 2ZU3A 2ULLA 1FN8A 1GVKB 4X6MA 4ABJA 3BV9B 1GI5A 1L4DA 3IWMA 2WPHS 4Y8XA 1H8DH 2OQ5A 3ITIA 5ABWA 5AF9H 1K1IA 1IOEA 1OSSA 5I25A 1J14A 2SNVA 1T7CA 3MU8A 3OY5U 3M5MA 2SGDE 5B6OA 3WY8A 1AZZA 1TGNA 1VITH 4BAQB 2BDCA 1TBRH 4IGDA 3U1JB 1EZXC 5T3HA 2ZPSA 4UEHH 1Y5BT 1E38B 1ZOMA 1IQGA 3BEIB 1XM1A 1OWDA 2IN2A 3QO6A 1EJNA 1ELEE 1E37B 4NWLA 2ZPQA 2HRVA 2BLQA 1DITH 1GI1A 1TBZH 4XE4A 4DT7B 1UMAH 2BY8X 4WMEA 5F8TA 1SOZA 1L2EA 2HALA 3QZQA 1HNEE 1UTOA 1V2OT 3ESTA 1GBMA 2BX4A 2ZPRA 2NWNA 2G52A 2Z94A 1AB9B 1CO7E 4UONA 4MQAA 1AWFH 4BANB 1P2IA 1KY9A 1XUIA 2H2ZA 1C1QA 1P3EA 1EZUC 1JMOH 4MPUA 2SFAA 1GHBG 1AGJA 2BD2A 3MYWA 1S81A 2W26A 3B9FH 3QX5H 4WMDA 5A09A 1RTLA 2WPMS 2B5TB 2Q6DA 3SUGA 1Z6JH 2QF3A 2D2DA 1MTNC 4CREA 2A5AA 4I8LA 2GDDA 4NIWA 1T4UH 3LGTA 3V3MA 3E16B 4WWYA 1ZJKA 1EB2A 1THRH 5JBTA 4QT8C 2NU2E 1NPMA 2C8XB 4X6PA 1IQHA 3N7OA 4AFQA 8LPRA 8GCHG 1OWEA 1DT2A 3ODDA 1GHYH 2UUYA 4F49A 5E0JA 3PYHA 4THNH 4XSKU 1Z1JA 3A82A 1LVBA 1QB6A 4Q7XA 4YESB 2FZZA 2BQWB 2XBVA 4H42U 1HFDA 4YT6H 1IHSH 1N6XA 1EUFA 2LNCA 2A31A 4XOJA 1K2I1 2DE8A 1K21H 3MO3A 1NM6A 4Y79A 4GSOA 5EXMA 1QTFA 1FY4A 2DE9A 1C2JA 1O39A 1ZMLA 2R9PA 4Y8ZA 4MNYA 3A86A 3RC4A 1TX8A 4JZDH 1KXEA 1CA0C 1JXPA 1OWKA 1PPHE 1T8OA 1Z8RA 3A8DA 1T31A 1F5KU 3A88A 1FLEE 1MCTA 1YBWA 4TY7A 3KQDA 3ZVDA 3F9EA 5AVDA 3RXSA 1J9CH 1QJ1B 4A7IB 2EA3A 1MTVA 4IC6A 3M7QA 1O2UA 1D6RA 1O37A 1ARCA 1O3OA 1Q3XA 1WQSA 1O2NA 2ZNKH 4NIYA 3W94A 3PLKA 1TOCB 2JH6D 3PLBA 1ARBA 1RFNA 1M9UA 2ZHEH 4MNVA 1GI6A 1RGQA 1SMFE 4GUXA 3P95A 2ZC9H 1X7AC 2XXLA 1V2WT 2ZWLH 2VVUA 3LJJA 1EATA 3SV6A 1CE5A 3AAUA 3MH7A 1RTFB 1XXDA 1INCA 3A7YA 1IQMA 1C2LA 3ZYDA 1W14U 1T32A 1S82A 1K1OA 1MQ6A 1EOLA 1JIRA 3BF6H 2BD9A 2BD3A 1NT1A 4K3JA 1A0JA 1MTNB 2ASUB 1NFXA 3I78A 1WU1A 1CVWH 4B73A 1CGIE 1BMLA 5BRRE 1EB1H 1FAXA 3BTKE 1XUKA 1ACBE 1GJ5H 3GY3A 2AGEX 1GHWH 4BOHA 2Y5FA 1ELFA 3FANA 3UR6A 4I31A 1Y3VA 2FYQA 1O33A 2W7UA 1UK2A 1LO6A 1HLTH 2R2WU 4ABIA 4DIIH 3D65E 4D7GA 1EXFA 4OS1A 5FBEA 3RXJA 5ESTE 3UY9A 1FI8A 1C1MA 2A4QA 4XBDA 3KQEA 3SHAH 1QBVH 1GJ4H 3SI4H 1PYTC 1V2KT 1O35A 1FY3A 3E90B 1GWAA 3SU2A 2ZFFH 3PROA 4IC5A 1L1GA 1Z8IB 2OINA 2GP9B 5E0GA 5I46H 4ISHH 2A7HA 1CA0B 3MH4A 1DY9A 3RC5A 3PM3A 4OS5A 3UOUA 2STAE 4AORA 3C27B 2ZI2H 2PFEA 3OX7U 2D8WA 1TA2A 3RU4D 3SQEE 3UNSA 2BMGB 2P3UB 1CGHA 4CRAA 2RDLA 1O2VA 4RSPA 1TB6H 4O03A 1MBMA 4U2WA 1D6WA 5DP9A 3NZIA 1DWEH 1P2JA 2BVSH 2FI3E 3JZ1B 1JWTA 1KXFA 4U01A 1WAYB 4NGAH 1W13U 1GVZA 1QRWA 2ZDVH 2A0QB 2BM2A 3ZV9A 4X0WU 4JYTA 4D9QA 1MAYA 5DP8A 3DT0H 4XFQA 2Y81A 2WV4A 1C1NA 3GDUA 1PJPA 5JBBS 2VJ1A 3PO1C 5EQQA 1QB1A 3V0XA 3UQOA 2BDIA 5DP5A 1ZMNA 1O2YA 1ELVA 1MZDA 3PB1E 2CN0H 5DGJA 4ZKNU 5SGAE 2PHBA 1RS0A 1V6DA 4ISNA 1DDJA 3BTFE 3LH1A 5L30H 1TFXA 3KF2A 2YNAA 3K9XB 1ORFA 3TJUA 5FCKA 1FZZA 2RA0A 2UWOA 3V7TA 2G55A 1H9IE 4I8JA 1OP8A 2XBYA 1TNJA 1D3QB 1HIAA 1BTHH 2P16A 3RLWH 3SU1A 4DURA 1Y5AT 3NCLA 5EGMA 3VB4A 3P6ZB 3GCOA 4ABFA 3QDZB 2JH0D 1P03A 1QBNA 3LGWA 3U1IB 5J4SA 3DD2H 5GCHF 1G2LA 2PSYA 2BOKA 2OC8A 3BTTE 1EAUA 5C5OA 1PYTD 2DUCA 1YCPH 2RG3A 3U8TH 3GY6A 1L4ZA 2B8OH 2VVCA 3FVFB 4SGAE 1MCVA 1NROH 1O30A 4FUBA 3QTOH 4HGCA 4B74A 1HUTH 1GDQA 1GHXH 4GVUA 3ATIA 2PTNA 3L6PA 4YZUA 2AERH 3VEQB 3GDVA 3RXEA 2QCYA 1GMCG 1QQ4A 2THFB 1TONA 3TU7H 1UVTH 2IOTA 2TGAA 2HNTC 3T5FH 4NIXA 1C2FA 2ZGHA 5FPYA 3DUXH 1C5ZB 2XC5A 4KTUA 1Y3UA 1P01A 4FUJA 1O31A 3OSYA 1GHBF 3U9AH 2O8TA 4ABEA 4CRBA 2ANKH 2UUFB 3ZZ4A 1UVOA 2AMDA 4BTIB 4UFGH 3CP7A 4UE7H 2ZGXH 4HTCH 2GTBA 2ZECA 3NK8A 1ETRH 1ZGIA 1A5IA 1DUEA 3ATLA 3PMBB 4TWWA 3PO1B 3Q3XA 1TABE 1SGFA 5JDUB 1GMDG 1A5GH 4MNWA 3RXVA 3SO3A 1MUEB 1LQDB 1O3FA 2GMTB 4ZHLU 4OGXA 4GHQA 4ZROA 1O5DH 1QFKH 1AE5A 5A0CA 5EXNA 2HGTH 1S83A 1PQ7A 2BQ7B 1NC6A 1O3NA 3TH2H 1DVAH 1D3TB 2ZTYA 1AKSB 1P9SA 5JYIA 1O3JA 2NU1E 1G32B 5CE1A 4R8TB 3UOPA 1THPB 2F9UA 2BZ6H 1D9IA 1KLIH 4UDWH 4WMFA 4B2AA 2OC7A 1T4VH 1T8MA 2CHAC 4K1EA 1UTMA 4DJZB 4NSYA 4WF8A 1C5WB 2EI6A 2G00A 1K1NA 2ZTXA 4MPVA 4ZAEA 1C1OA 1O5EH 1Y3XA 2BB4A 4X8UH 4Y0YE 1UVUH 1Z71A 3RMNH 2ANYA 3RXHA 3SU3A 1C2IA 3UNQA 2R2MB 1O5AB 2FOHA 1J16A 2Q1JA 1KSNA 3TJVA 2H9HA 1CA8B 5F03A 5DO4H 3ZZ5A 4FVDA 1K28D 3I29A 3CENA 1W0ZU 3S9CA 1EPTC 3M5LA 1C5SA 2BDAA 2VIOA 2Z3CA 3NKKA 2BD4A 1GJ6A 2KAIA 3GDSA 1G3BA 3BTME 3T2NA 2OQUA 3BTWE 4J2YB 1Y3WA 2ZGJA 1AVWA 3ZZAA 2XC4A 2FTLE 2BDHA 2PKAA 2Y80A 3K65B 4D76A 4FUDA 2Y7XA 1AVGH 2VIPA 3MTYA 4DY7B 1L0ZA 7KMEH 1BBRH 1HYLA 1EAWA 2ANMH 5L2ZH 2QIQA 5DP4A 3V12A 2SGPE 2ZDAH 4MG3A 1NRSH 2G5VA 3ZZ8A 2ZGCA 1CHGA 3NWUA 1VITG 1ELGA 4ABBA 3MU1A 3TNTA 1TE0A 3S0NA 1QIXB 3TK6A 2R0LA 1KDQA 3SU5A 4X8TH 1VR1H 1ETTH 1SGNE 4UD9H 4IN1A 2H5DA 1LVMA 2EEKA 3GCTG 1TMBH 1MKXH 3LKWA 1AHTH 1N8OC 2ZTZA 1V2ST 4CRDA 1UCYK 1F92A 4TPIZ 1A46H 2P3FH 1XUHA 1NN6A 2QAAA 1C5PA 2WPJS 3MO9A 5DP7A 1CT2E 5JB8S 2TBSA 1PQ5A 2CHAB 3F68H 1PPFE 2M5TA 3HKIB 4NA7A 1K9OE 1NFYA 5DP6A 5EXLA 5CHAB 1SOTA 1O5GH 2D1JA 2FX6A 1ZR0A 2VGCC 1SPJA 1HPGA 1UTPA 4JMYA 1B0FA 5HYOA 3A7ZA 1FIZA 1QR3E 2Z9IA 2FESH 4YO9A 3E8LA 1KLTA 1NO9H 3HK3B 1DLKB 1KXAA 3SU4A 1C2HA 1EP5A 1O34A 1WTHD 1UCYE 1JOUB 3GYMA 4NA9H 3SGAE 1FV9A 1DXWA 1EPTB 6GCHF 3H7OA 1FNIA 3RM0H 5H4IB 1C5QA 1TQ7B 6LPRA 5LPRA 1C2KA 2OUAA 3KEEA 5EOKA 1DANH 3EGKH 3BIVH 1GMHF 2AH4X 2XW9A 3ZZCA 2VIQA 1UK4A 1SFQB 1BJUA 3T27A 1E0FD 2RA3A 1W8BH 1RIWC 2BX3A 1LVYA 1LKBA 2C90B 2W5EA 3O8CA 4BAOB 1O3PB 4ABAA 3SJOA 2ZEBA 1ZHPA 1ANCA 1MU8B 1GJBB 2ANWA 1HAVB 3A84A 3CS7A 3GY2A 3URCA 2XWBI 4E06H 2F3CE 1AUJA 1Z7KA 3ZVAA 1NS3A 5G4BA 2R3YA 2NU4E 2UWPA 1O2HA 1DFPA 1P9UA 1FPCH 3MMGA 3HGPA 3SN8A 1GBBA 3TJOA 2P94A 1O36A 3UTUH 1O2IA 3RXUA 1S6FA 4ZHMU 1C4Y2 1D3PB 1DM4B 1F2SE 1TGTA 2P8OC 1N8OB 4GAWA 1AN1E 4AB9A 1O5CB 1S85A 2A5KA 1YM0A 1BRCE 1MTWA 3UREA 1C5MD 2WINI 4AOQA 1GBHA 1G2MA 1LVOA 2HVXA 2GVFA 2QXHA 4MLFB 1SB1H 1HAIH 1O2GH 1BQYA 1BOQA 1DX5M 3BTQE 1SGIB 1UTLM 2OLGA 4NZLA 4ZHAA 9ESTA 4A92A 2QC2A 2FTMA 2TPIZ 1ZRBA 2AYWA 3UPEA 1GHZA 4Y7AA 1LCYA 1UHBB 2QY0B 1F5RA 2FMJA 4YTAA 1YLCA 4Y10E 1QB9A 4IMQA 1TRYA 1EASA 1Y3YA 3SGBE 1ELCA 1WSSH 1C5OH 1GCDA 2VGCB 2W3IA 1NFWA 2FOGA 3UFAA 1C1RA 1TNHA 2QN5T 3FP8E 2V35A 1BA8B 4MNXA 4X2XA 1BDAA 5JPMH 1O2RA 1YF4A 1YPLH 3A8BA 4FUHA 1TQ0B 2AMPA 2IJOB 1MD8A 1O32A 4IN2A 4YOJA 1J17T 1AD8H 3RXOA 3E0PB 1OXGA 1QJ7B 2FM2A 4FUEA 3TGJE 2ODYB 4YLUA 4X8SH 2P59A 1JBUH 4XDEA 3LC3A 2JH5D 3FP6E 4ZMAH 1MKWK 3RLYH 3TK9A 2WUCA 2V3HH 3PTBA 3T25A 1GI9B 1LHDH 1C9PA 2BD7A 4X1NU 2ZA5A 2XYAA 3M5NA 1MTSA 2Z3EA 2GCHG 3P8FA 4NG9H 4NFFA 2XTTB 5FBIA 4INLA 1BIOA 2CGAA 3EA9A 4K2YA 1TA6A 2F83A 4AFUA 3RXAA 1O3BA 4OS2A 2ZU2A 2ZG0H 4A1TA 3PWBA 3SUFA 2ZCHP 4RN6A 1TNGA 2ZFSA 4BAMB 4Q80A 1ETSH 1O2KA 3SV8A 2FXRA 3F9FA 4IMZA 3E3TA 1YPJH 2JETC 2PTCE 2ZKSA 1HJAC 2P8OB 3TK5A 3TNSA 2BDBA 5T6GA 2K1QA 1PPZA 1UTQA 4M7GA 3A80A 5EW1H 2Y5HA 3SNCA 3K6ZA 2ALVA 1W0YH 1WBGB 4AX9H 5TCAA 8ESTE 1HDTH 1A5HA 2PV9B 1F5LA 3Q76A 3OU0A 4DVAU 1LHCH 1HJ8A 1KTSB 1RRKA 1HAYB 7GCHF 1Z8JB 2G51A 2HNTE 1XUGA 1DS2E 1VCQA 1A7SA 2CXVA 2TGDA 3RMOH 2GV7A 2WUBA 2Z9LA 5JBAS 5LPFA 5HXFA 1XXFA 4WH6A 1CBWC 3D23A 1C1VH 1K22H 1J15A 1ID5H 5TCCA 1HGTH 3ZVCA 3LGUA 2SGEE 1BMAA 2CF8H 2WYGA 4HZHA 1B0EA 5EQRA 1KLJH 2J92A 5K0HA 3U69H 1GJ9B 3U8RH 3LT3A 2YNBA 2VH0A 2F9NA 4KP0A 3VPKA 1DUAA 3RXFA 2VWNA 1O2WA 1CGJE 3TGIE 4XBBA 1FY5A 3MH5A 4D7FA 1O3MA 5J4QA 1XVMA 3ZVEA 4B76A 2ZDLA 3LDXH 3C1KA 4AG2A 3FP7E 2GKVE 2FOMB 1QQUA 1GHAF 1SQTA 1QCPA 3MNSA 3BEFB 2VWLA 4GCHG 3VXEH 5EQSA 1TMUH 3T26A 1BMNH 1LDTT 3GY4A 2ZO3H 3HGNA 1CHOG 5LPEA 2BXUH 3GY5A 5FPSA 3RUOA 1V2JT 4AYVB 2JETB 1HJAB 1ZMJA 3QWCH 1E35B 2BYAX 1RJXB 3FZDA 1ABIH 1BUIA 1OS8A 1GPZA 1QL8A 3FFGA 2XBXA 4ZKRU 3A87A 1IQFA 1NZQH 2TGTA 1THSH 1FN6A 1TWXB 3KQBA 3S7KB 1TX7A 1NRRH 5GPIB 4UFDH 1F0SA 5PTPA 1IQJA 2SGAA 3M37A 2XCNA 3SU6A 3ZZ9A 1YPEH 2XWAA 2PGBB 2PR3A 5EW2H