1K9OE

Crystal structure of michaelis serpin-trypsin complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKDSCQGDAGGPVVCNGELQGIVSWGYGCALPDNPGVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALASERPIN
publication title The structure of a Michaelis serpin-protease complex.
pubmed doi rcsb
source organism Manduca sexta
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k9oE01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1k9oE02
1EAXA 1K1JA 4ZKNU 4KTSA 2GP9B 1BTHH 3ZZ7A 1GBBA 1QURH 1DSUA 3KF2A 1PQAA 3VB3A 4CBOA 1GCTC 3FP7E 5ESBA 4O3TA 3QTVH 5C1UA 2G5NA 1GMHF 1KYNA 1WYKA 3RMNH 4AX9H 3CENA 1K9OE 5EU8A 4A1TA 4DOQA 1FIWA 4UFFH 4ZAEA 3TVJB 4VGCB 1W8BH 1EAWA 1TBZH 1SQOA 3OSYA 1FN6A 4A5TS 4AN7A 2ANMH 2BD4A 1BMMH 4GPGA 5FPYA 1BHXF 1SVPA 4INKA 4H4FA 1G3EA 4F4OC 3MNXA 4CBNA 1S6HA 4IMQA 1DY8A 1AD8H 2CMYA 2AGEX 1KXCA 2A7JA 2P3FH 1W12U 2GV7A 5DO4H 1J8AA 3V7TA 3D65E 4SGAE 4VGCC 2QC2A 4BTIB 1GBEA 7GCHG 3T25A 1YKTA 1AU8A 4LZ4B 4CHAB 1FMGA 1K1NA 3MH4A 2BDBA 1IQIA 4ZROA 2ALPA 3MO9A 3TH3H 1ELVA 1C5TA 3EE0B 4I8JA 5C67A 1B5GH 2FWWA 1V2VT 2O8TA 4NIXA 2P95A 2TGAA 2J94A 3LONA 1MAYA 1QRWA 4WH6A 1HGTH 2A5IA 4ABEA 2QYIA 2BD8A 4H42U 1OWKA 1ZRKA 1GBKA 1S5SA 1WSSH 3SJOA 1UO6A 2R3YA 3RXVA 7ESTE 1ZZZA 4FUCA 1UJ1A 3S0NA 3C27B 5EOKA 4FU9A 5GPIB 2AGIX 5C2ZA 4UFDH 1KXAA 3STIA 1C1RA 3R3GB 1GJBB 1UVPA 1T8OA 3MMGA 2OBOA 3PLKA 1S84A 1DICA 2ZWLH 2ZU4A 2RA0A 1EZQA 3GDUA 1C5XB 3SOSA 5K7RA 1V2LT 2TGDA 3SJ8A 1THPB 3DFJA 3HKJB 3EYDA 3SV2H 1NRQH 1O36A 1GHAG 2HVXA 1NFWA 5J4SA 1ESTA 4KGAA 3LJJA 1TOMH 1HYLA 5DP9A 1TNKA 5ABWA 1J14A 3A89A 1P2QA 1ZPCA 3SNDA 2VINA 4OS5A 1VJ9U 1JOUB 4ISNA 1XUIA 1TALA 2WPJS 1IQKA 2ZFFH 4X1NU 3TJVA 2XWAA 1ANCA 1B0FA 3F1SB 1TNJA 4FU7A 4Z0KA 1DXWA 1TAWA 2ZPRA 3E3TA 1QA7A 5C1XA 3QUMP 1LVBA 1GJ5H 2CXVA 4NFFA 4OS4A 4X1SU 1QJ1B 2SNVA 2ZF0H 1XUKA 2IOTA 3O8CA 1RTFB 1T4VH 1YPHE 1BTZA 1V2JT 1TQ0B 2FOGA 3Q00A 1SGTA 3QLPH 4MNXA 4YTAA 4X2XA 2GMTC 2QN5T 1O5CB 1OX1A 1V2RT 3SZNA 1UCYE 4B71A 1MUEB 2SGFE 1MKXK 1NFXA 1UHBA 3NXPA 1UCYH 1YPEH 1T32A 3PMJA 1F5RA 1T8MA 3UR9A 1A3EH 1C5QA 1TA6A 2BM2A 1WQVH 2JH5D 1SPJA 3SU6A 2ZCHP 1ORFA 1KY9A 1LQDB 1WQSA 3PO1B 5HMAA 2ZU1A 4Q80A 1XKAC 1HJ8A 2ANKH 4I8GA 1W0ZU 3EA9A 2ZDVH 9ESTA 5LPFA 1LTOA 3M5LA 3S9AA 3RXHA 2ZHWH 2SGPE 2FS9A 1TPSA 1UHBB 2BD5A 2FPZA 1BTPA 4IGDA 1EASA 1GGDB 3OX7U 4PROA 1YLDA 1W2KH 3PO1C 1Y5UT 1GI1A 2B7DH 2V6NA 4E05H 1LHDH 1K21H 1AI8H 2BLWA 2O8LA 1YGCH 1AFQC 3W94A 2VH6A 1DM4B 3U8TH 3UWJH 5EW2H 1KXEA 3LC5A 3VB5A 1O2OA 2A45B 2BLQA 3ZVDA 1T8NA 1RTKA 7LPRA 3AAVA 4TPYA 1G3CA 1GGDC 4TYDA 1PYTC 3K65B 1C1MA 5A8YA 3BG4C 3KL6A 4WH8A 4X8VH 3TK5A 4E06H 2ZFRH 1O0DH 1Y5BT 4JZEH 3EQ0H 2XBYA 3UQVA 1K2I1 1W10U 1GJCB 3A8BA 2DE9A 5JBAS 1GI2A 2BDAA 4D7GA 1IHTH 2BD9A 3LH3A 1C5RA 4K3JA 1C5YB 4Y6DA 1ARCA 1V2ST 2TGTA 4ISHH 4DJZB 1O2UA 2AYWA 1O3HA 4DCDA 1A5IA 3BIVH 1SB1H 2FOFA 1KLIH 3ODDA 3CS0A 1V2WT 2F9NA 4LXBH 2BY6X 3N7OA 1MTNB 2W7SA 1P09A 2HOBA 1O5BB 1SGNE 3BV9B 5FBIA 1C2KA 4FUHA 4FUEA 1UMAH 2A32A 1TGSZ 2HRVA 2ZDKA 1BCUH 3FANA 1BJVA 4XDEA 1P2JA 1QJ7B 4TY6A 4ISIH 2BXTH 3RXSA 3MOCA 1IQMA 1UVOA 5IYTA 2G4UA 1UK4A 2FXRA 1V3XA 1VCQA 1QQUA 1EZSC 2GVFA 2XCFA 4NSYA 1PYTD 4JK5A 2AMQA 1VGCB 1O3KA 1ZMLA 1SFQB 1MMJN 2PKAA 2PV9B 5G4BA 3LKWA 1O2KA 3ZZ9A 3SBKA 3Q76A 3RXPA 2UUYA 4NZQA 4Z6AH 2FI3E 4BAHB 2ANYA 2GTBA 1GL1A 3GY4A 1IQJA 2XTTB 4OS2A 1KDQA 2BLOA 2VB0A 4K8YA 3ZZ8A 4AG1A 3HGPA 1HBTH 1UTKA 2A2XH 2Z9GA 1V2NT 3UQOA 2O8MA 3PLBA 1CE5A 1NN6A 1TGCA 3QO6A 4ABGA 1ETRH 2C4FH 1GI4A 2NU1E 5A0BA 3ENSB 4DIHH 1GMDF 1PJPA 2BY9X 1IQLA 1GBJA 2GGVB 1N8OB 5LPRA 3U1IB 3UREA 2ZPQA 1O3NA 4FUBA 1O39A 4UDWH 3L3TA 8GCHG 1HDTH 1YCPH 2OP9A 4ZUHA 1G36A 1QR3E 2ZFTA 1YPJH 2Z94A 1FONA 1WBGB 3DD2H 5HXFA 1BZXE 1F0TA 1DVAH 4YO9A 1VR1H 1GBAA 1EATA 2ZGBH 1CT4E 1SC8U 4CRCA 1O37A 1HB0B 1FPHH 1NC6A 1ELGA 1D9IA 3BEUA 5DP8A 1O33A 1FJSA 1C2IA 4UFGH 1O3JA 4MPXA 3MO3A 1C5PA 4X8SH 3D23A 1YPGH 1W3CA 1GMCG 1WTHD 1JBUH 4UEHH 3SHCH 4TWWA 3EAJA 1KSNA 2P8OB 2R0LA 1AFEH 4JYUH 4NCYA 2FZZA 3GY7A 3A80A 1MCVA 3QN7A 3S69A 5L30H 3VGCB 1O2IA 3U98H 2ZDMA 4X6OA 4OS7A 1XUHA 1DS2E 4Q7YA 1DUEA 4O3UA 1Z8IB 3GY6A 2H6MA 5TCCA 1FN8A 3VB6A 5AF9H 1H9HE 3QDZB 2BHGA 2P8OC 4NA8A 3SU5A 4U30A 1SGCA 2H5DA 2XC5A 4INHA 2ZTYA 1AWFH 1O3FA 1NU9A 1C5UA 4ZKSU 2VNTA 1UTOA 2Y6TA 3GICB 4HZHA 1KXFA 4YLQH 1HFDA 2HPPH 1E34B 2PGBB 1OWHA 3RMMH 3SJIA 1D3DB 4WMFA 4RKJB 3P8GA 1IQNA 3UFAA 2LNCA 2UWLA 1QCPA 1QB6A 4OGXA 3SU1A 3ZZBA 3GCHB 1GVKB 4AYYB 3M3VA 3FVFB 4BAQB 1P2NA 4RKOB 1CT0E 1TNGA 3OY5U 1TPPA 1QQ4A 4DURA 2ZU5A 2P3TB 2F91A 3D49H 4BANB 1J17T 3BTKE 3A7XA 1E36B 5DGJA 1ZTKA 3B9FH 1V2MT 1V2QT 1SGRE 5GCHF 1ID5H 2CF8H 1FY4A 2GDDA 3FZDA 2R3UA 1DWEH 3BTME 4ZHMU 1E38B 2Z7FE 3ZZ3A 1CHOG 3RXJA 3TK9A 3V3MA 2AERH 3UNRA 3MH6A 1AVGH 3SORA 1Q3XA 4JYTA 3Q3KA 1KXDA 1CO7E 1XX9A 5IDKA 4ZHAA 5C5NA 3E91A 4FUGA 3O8BA 1NTPA 1CGJE 2VWNA 3MO6A 3VB4A 2FYQA 2ZTZA 5E2OA 2H9HA 1AKSA 1AB9C 3ZYEA 2OC8A 2JKHA 4X2VA 1ZMNA 3LGUA 4BXWA 4DT7B 3NPSA 1YP9A 1BRUP 1GDNA 1J9CH 1HIAA 1QBOA 2ZGJA 2GX4A 1EJAA 1H8IH 1QRZA 3JZ2B 1UTQA 6GCHG 1P2MA 3RC4A 3SQEE 2TBSA 1TRMA 1SLXB 3T28A 3M36A 3MHWU 5E2PA 1YPMH 3PYHA 3T62A 2A0QB 4DGJA 1C2FA 1GI7B 1Z6EA 1NZQH 2C8ZB 3A7ZA 2XBWA 3PMAB 3RXOA 1NESE 2ZHFH 3GISB 1TABE 3L6PA 3U9AH 1M9UA 2BLVA 2THFB 4BXSA 2A7CA 1VCPA 3SU4A 2NU2E 2GCTC 3B23B 1GCTB 1EQ9A 5EODA 2YOLA 2ILNA 3SUGA 4ABAA 1EKBB 4J1YA 3A83A 1D4PB 1ZRBA 5B6OA 1MTVA 4XBCA 3URDA 3D62A 1DE7H 1GHWH 1N1LA 2C8YB 4YT6H 3SV6A 4I8LA 1CT2E 1KTTB 2UWOA 1K1MA 3PWCA 2W3IA 3TLOA 2SGQE 3KQDA 2GCHF 1ZJKA 2D8WA 3UPEA 2VIDA 1VJAU 1MAXA 1P2KA 3A7YA 3ZVGA 3NUMA 1RS0A 5EPYA 1C1UH 2F9VA 1O2QA 2WPHS 4QT8C 2P94A 3SU3A 2FEQH 1IOEA 3KGPA 1HRTH 5CMXH 1SGIB 3M3TA 4THNH 1JWTA 2QF0A 1LVMA 2G00A 3A7VA 3MNSA 3Q3YA 1AIXH 5HM9A 5DP4A 1IQEA 5FCRA 3SV8A 1OPHB 3BTHE 1UCYK 1BRCE 1ANBA 2H9TH 4XE4A 5EPNA 3M35A 2FIRH 4LZ1H 5JBBS 1K1OA 1SGFG 3RXQA 1L2EA 1DY9A 1G37A 2FLBH 1CVWH 1D6RA 5L2ZH 3ZV8A 4CH8B 4KELA 4MNYA 1TYNA 3RP2A 1ZPBA 2BVXH 5EGMA 2HGTH 1H9LB 1Y3YA 2ZI2H 3RXTA 1ELFA 1OWJA 1O2RA 1ZSLA 1PPGE 2I6SA 3GCNA 4ZH8A 3HATH 4DW2U 5JB8S 1T7CA 4K1TA 3F68H 4A6LA 1ESAA 1C5WB 1AQ7A 1AGJA 4MPUA 4WY3A 2EI6A 4Q2KA 1V2KT 2VH0A 4Q7ZA 2JH6D 3IITA 1DWDH 1BTWA 1GBLA 2EA3A 1GHXH 1SLWB 1F0UA 2CN0H 3A8CA 2ZU2A 1HXFH 1LMWB 5F8TA 5ETXA 2FODA 3E0PB 5LGOA 3LC3A 3SI4H 1HNEE 2ZP0H 3LGIA 1BB0B 3MU0A 1OKXA 2ZNKH 3OYPA 4GLYA 1ZPZA 3BTWE 3SJ9A 2QXIA 1EPTA 2BY8X 1C5LH 1P04A 4MVNA 1PFXC 4LOYH 2ZDAH 1D3TB 1UTJA 3UOUA 1C2MA 3BTEE 1SOZA 1YLCA 1C5ZB 1Z8RA 3SNCA 3P17H 1SHYA 2CHAC 2ZDNA 4FVBA 5FX5A 2PW8H 1O2XA 1CHGA 2BMGB 1P05A 1EAIA 1SG8B 2HNTE 4MQAA 1TMTH 1ELEE 4XOJA 1HCGA 3RXBA 4DY7B 2BOHB 2HALA 2J4IA 2Q1JA 2W7UA 1GPZA 4MDSA 3WY8A 1MD7A 2BB4A 1QGFA 4HGCA 1HAIH 3ESTA 1B7XB 1S81A 1TX8A 4ZXXH 3FAOA 4KTCA 1SBWA 2EI7A 1SOTA 3GCTG 2OD3B 4FUFA 1FDPA 4IN1A 4X0WU 3P8NA 3P95A 4I31A 1MQ6A 3SNBA 8LPRA 2R2MB 2QXGA 3QTOH 4NIVA 1FIZA 1LVOA 2IPHA 1HAZB 3O8RA 2FOAA 3GY5A 4IN2A 1K1LA 2OC0A 3V0XA 2Y82A 2H5CA 4B1TA 1EPTC 4GUXA 3A81A 1O3IA 3CP7A 5GIBA 2GMTB 1TGBA 1LCYA 1A61H 1GI6A 4Y7BA 5L6NH 3AW0A 1ELBA 1MD8A 5DP7A 1G3DA 1YC0A 3MI4A 5C20A 2VIOA 1CGHA 5A09A 1F2SE 4JMYA 1HAVA 1GBCA 1Y59T 2XXLA 2NU4E 1MBQA 2ZHDA 4H6SB 1AY6H 1SMFE 2OCVB 1ELCA 1OWEA 2QIQA 2V3HH 1FY8E 1GWAA 1DWCH 2AEIH 2C8WB 1L1JA 1C2HA 4YOJA 2ASUB 4GCHG 1XM1A 2ZTXA 1O2ZA 4ZKRU 4CRAA 1SQTA 4O97A 4H6TA 2FESH 4YOGA 1LHEH 1P3CA 2TRMA 4FUIA 4X1RU 3QK1A 1GJAB 3PLPA 3NKKA 3W95A 4ZHLU 3SW2B 4U2WA 1EJMA 3QX5H 3T2NA 2UUJB 4NSVA 2W26A 1XUJA 5DP5A 1A0HB 1ARBA 1O3CA 2VIWA 3L33A 1GMHG 1SR5C 1RFNA 1YCPM 3M7QA 4D7FA 4ISLA 2BOKA 1YCPK 2ZFPH 4K69A 1AFQB 1SGDE 3GY8A 1NFYA 2YNBA 1BRAA 4CH2B 1AE8H 1GJ7B 1O2MA 3ZVFA 3M5OA 3T27A 1O5GH 3SI3H 1NRNH 5T6DA 3AAUA 4X8TH 1F5KU 1QL7A 2H2ZA 1MTWA 1C5SA 1TFXA 3BG4B 1CGIE 3PM3A 4R8TB 4MPVA 1PPCE 5T6FA 2A2QH 1EUFA 4MTBA 1A7SA 4CRGA 2FI4E 3PB1E 2WUBA 1O2SA 1BMLA 1U6QA 2VWLA 9LPRA 1W7XH 2R9PA 1CA0C 1O30A 1HAHH 2SNWA 3MTYA 2C90B 2SGEE 1FLEE 4TWYA 5E0HA 5HYOA 2ZQ1A 2XBXA 2PKSC 1FQ3A 1GBTA 1ZSJA 3NCLA 4ISOA 3PMHB 1NY22 2KAIA 4CR9A 2DE8A 2GT7A 2O8WA 1GG6C 1LHCH 1GJ8B 4JZFH 1EZXC 3P70B 1IQGA 4IC6A 3SHAH 2EEKA 3RM2H 2FYRA 3BN9A 1SFIA 5EQRA 5AHGH 4UE7H 3GDSA 1O2YA 1GJ4H 2PUXB 1O3MA 1BTYA 1AE5A 2ZC9H 4AFUA 4O9VA 2A4RA 3NWUA 3OU0A 2A31A 1HJ9A 4AFQA 2HWLB 2FM2A 1TX6A 4AGKA 1O2NA 3G01A 4XBDA 1VITF 5CE1A 2WYJA 1RJXB 4WXVA 3RLYH 4JZIA 5GXPA 5FX6A 3TJNA 1ETSH 2KAIB 1DPOA 3TGKE 1A5GH 1NS3A 2G51A 2VIPA 4X2YA 1KXBA 2BX3A 4X1QU 2SGAA 2ESTE 1EOLA 2ZPSA 2I6QA 1P9SA 4ABDA 4I32A 1ABIH 2GV6A 3A82A 4IC5A 3KHVA 1ZR0A 2VJ1A 2IN2A 4ABFA 4B2AA 3T29A 2ZIQH 2A5AA 2BD7A 1FXYA 1EZUC 3AVZA 1O2JA 4ASHA 1O2PA 3ZYDA 3UUZA 4GVUA 1OYTH 2GZ7A 4YOIA 1BBRE 4R0IA 3AW1A 1C9PA 3TNSA 2Q6FA 5DKMA 1NPMA 1XUGA 1ANDA 1A1RA 1BBRH 2GDEH 1Y5AT 1ZHPA 1YPKH 1QA0A 1PPHE 2BY5X 2FOHA 2UUKB 1UK3A 2VVCA 4Y79A 1GHBG 1GI9B 1CSOE 2B0FA 1C5VA 4NWKA 3SU2A 4Y71A 3PWBA 3TIUA 3GYLB 1EAUA 2VVVA 1L1NA 2BX4A 5FAHA 5GWZA 2Z9IA 3VEQB 1YPHC 1LO6A 5HGGA 3SGBE 1LHFH 2ZFSA 4IS5A 2OLGA 1C2DA 6LPRA 4AYVB 3IWMA 2NU3E 1MZAA 3ZVBA 2A1DB 4FVDA 3RXMA 4ZMAH 1HJAC 2VWMA 1GDQA 4I8KA 2PKAB 1WV7H 4A1VA 5DP6A 2D26C 4AOQA 5A8ZA 2QGRA 3AASA 1DLKB 2JH0D 1SL3A 4K5ZA 3LDXH 2G55A 1O5FH 3RC6A 3ATIA 1KDQB 5F8ZA 2H9EH 5ESTE 1QB9A 2EI8A 1DITH 2AIPA 1W0YH 1WU1A 1V2TT 1YF4A 5EW1H 3JZ1B 2ULLA 1O2VA 3PROA 3RLWH 1CA8B 1HPGA 5EXNA 1O3BA 1L4DA 2VGCC 1EX3A 2AMPA 1AMHA 1A3BH 2FX6A 5TJXA 1S83A 4MLFB 1UVSH 1AN1E 3VXFH 1VZQH 4Y8ZA 2XC0A 3A8AA 4I33A 2BYAX 2F9PA 1O34A 4E7RG 1C2GA 3M7UA 3LGYA 4JCNA 5F03A 3DUXH 1AZ8A 2P93A 3PTNA 3RDZA 1GCDA 4WXIA 2FP7B 1D6WA 1FAXA 2FOEA 4BNRA 2WV5A 3ZVAA 2O9QA 4AORA 4DIIH 1BOQA 2TIOA 3TJUA 1Y3WA 2ZG0H 1EB1H 1JRSA 3RMLH 3T5FH 3VB7A 1X7AC 3P8OA 2XNIA 2ODYB 2FOBA 4K1SA 3TGJE 1D3QB 1OP8A 2JETC 3C1KA 2ALVA 1C9TA 4D76A 4K1EA 3M37A 5LPEA 3RXEA 3TH4H 1LQEA 4AZ2B 2Z3EA 5C5OA 3H7OA 1BA8B 1GBMA 3A7WA 5J4QA 1O32A 4JYVH 1C1TA 1ANEA 7GCHF 1XVOA 4WVPE 2WV4A 3LJOA 1A4WH 1HAGE 2ZQ2A 2W5EA 4XSKU 3K6YA 3V13A 1RTLA 1QL8A 4XFQA 1GDUA 1TMBH 1GBHA 2OXSA 5H4IB 2R0KA 4ZXYH 3TGIE 1TNLA 1O5DH 4K8BA 1TNHA 3SQHE 1SSXA 3KCGH 4CRDA 2OBQA 1C1OA 1INCA 1N6YA 3GY2A 1AB9B 1C5NH 1DFPA 1BDAA 1WOFA 1XMNB 2J95A 1SLVB 4U32A 1FY1A 1GI5A 3DHKH 3O8DA 5JDUB 1QBNA 3VFEA 2QXHA 4B74A 2ZDLA 4BOHA 5FPSA 3BEIB 4X2WA 3CS7A 2O8UA 4ABIA 1JRTA 3E16B 2PTNA 6CHAC 1HAXB 1EP6A 3EA7A 5A0CA 1GVZA 1HV7A 1UTLM 1Y8TA 1SGYE 2FS8A 4FU8A 3ZZ5A 3MU8A 3NZIA 1GHAF 1G9IE 3LGVA 3VXEH 3BTQE 3H7TA 5TCAA 3E0NB 1O5EH 2QAAA 1RIWC 1TGNA 4ESTE 2A7HA 2GCTB 4YM9A 1V2OT 1E35B 1GBFA 5C1YA 1GI0A 1TLDA 1C1PA 4Y8XA 1AKSB 2SFAA 5L2YH 1FI8A 2XWBI 1F92A 3ZZ4A 2LPRA 2Y80A 2BZAA 1CBWC 1NFUA 1HIAB 1L4ZA 1V6DA 1TRYA 2CGAA 4O03A 1GMDG 4Y11E 5CHAC 1AZZA 1C1WH 3MNBA 2AMDA 2QA9E 1QJ6B 4KKDA 1PQ7A 3P92A 1HUTH 1RRKA 3MFJA 2QXJA 1J15A 2Y5GA 1AUJA 1TIOA 3RXKA 4A92A 1JIRA 3BTTE 2J9NA 3GOVB 5JPMH 2A4OA 1PPFE 2FMJA 3S7HB 4Y0ZE 3SUFA 3EGKH 3TNTA 2XW9A 3IG6B 1E37B 3TPIZ 1P06A 2CV3A 1GJ6A 5A0AE 1BMNH 1T31A 1N6XA 1GVLA 3A7TA 4IMZA 1O3GA 2ZHEH 1GHZA 3MU4A 1G2LA 2PSYA 3K2UA 1XXFA 4DVAU 1EB2A 3FFGA 1LKBA 1QRXA 1Z7KA 3A86A 1FUJA 2Q6DA 3SUEA 2D1JA 5AVDA 1O3PB 1QL9A 1JMOH 1QBVH 2A4GA 1C2EA 3MNCA 1FY3A 1ESBA 2V0BA 4BAKB 4X1PU 1HLTH 3A8DA 3OY6U 4K2YA 1IQHA 4B75A 2OQ5A 1AUTC 4OGYA 2VU8E 4AB8A 4OS1A 3M3SA 1L0ZA 4NG9H 4ZKOU 1RXPA 2ZZUH 2J38A 2RCEA 3SV7A 3S9BA 4Y0YE 4WWYA 5JYIA 2BDCA 2ZGHA 3I77A 1C1QA 3BTGE 1BJUA 2G4TA 3MH7A 3LGTA 3RU4T 3A87A 1A0LA 3ATMA 2ZU3A 2CF9H 1MU6B 4FXGH 2Z3CA 1P3EA 2BQ6B 5SGAE 1FV9A 3RXAA 4X6MA 1S82A 2CHAB 4Q7XA 1HXEH 1T4UH 3BTFE 3E90B 2ZCLP 2BD2A 3ZZ6A 1UTPA 1J16A 1ZYOA 5AFYH 3UIRA 1C2LA 1W13U 2B8OH 5GCHG 4J2YB 2V3OH 1EOJA 2FI5E 4B73A 1GJ9B 5FBEA 3SJKA 4CHAC 1FY5A 4UONA 1IHSH 3TH2H 1NO9H 3A84A 1MZDA 3M7TA 4TY7A 4YESB 1DANH 3F9GA 1Y3VA 2BQ7B 2J92A 2P16A 2ZA5A 3HK6B 1BRBE 2C93B 2VVUA 3M5MA 1EPTB 3SGAE 4B76A 5A8XA 1MU8B 1S0QA 1GI3A 1DSTA 1YYY1 3QZQA 1MKWH 3GY3A 4ABJA 2NU0E 3PTBA 5EQSA 2WYGA 1LHGH 3ATWA 1O2WA 5FPTA 1TBRH 5JBCS 1MQ5A 1BIOA 2RG3A 2V35A 1QIXB 2F9OA 4YZUA 2TPIZ 3KQEA 1SGFA 4IBLH 1OWIA 2BDIA 1P01A 3STJA 1O31A 3RMOH 3ZZCA 1OYQA 1TQ7B 4DG4A 2ZGCA 2YNAA 1S0RA 3F6UH 1GL0E 1BBRK 1GHBF 2PLXA 3UNSA 1K1IA 1HAPH 2BD3A 2C3SA 2Z3DA 4GHTA 4NFEA 1TRNA 3MH5A 3RXGA 1S85A 4NWLA 1OP0A 4RSPA 3GYMA 3RU4E 1TB6H 4D8NA 2F83A 1TBQH 4K60A 1TWXB 3LPRA 1Z71A 1FAKH 4WF8A 3NK8A 3EA8A 1NU7B 1TPOA 2ZKSA 5HM2A 1HAVB 1LPKB 2GCHG 1A5HA 1LDTT 1F7ZA 1ELDE 1S6FA 3A88A 4BTUB 1TMUH 8GCHF 1P0SH 3ZV9A 3FP6E 4U01A 4HFPB 4AGJA 3E6PH 2SGDE 1H4WA 5EG4A 1ZLRA 1AVXA 3HKIB 1O5AB 2PR3A 1CA0B 2AGGX 1A2CH 1AWHB 2XBVA 3E1XB 1K1PA 3DA9B 2FO9A 3UNQA 3I29A 3RXCA 3RXLA 1KLTA 2PKSB 3BEFB 1GMCF 4NA9H 1BT7A 2XC4A 1DOJA 1QTFA 2Y81A 3HGNA 1W14U 1QFKH 1GG6B 3UR6A 1O2TA 1WUNH 1GJDB 2H1UA 3A85A 3PMBB 1KIGH 1H8DH 2ODPA 1O2LA 1DXPA 1MTSA 2D2DA 1F0RA 2ZECA 5A2MH 1DT2A 2K1QA 4GSOA 2J34A 3BF6H 3ATLA 2P59A 2BXUH 3MU1A 4WJG2 4CRBA 1BTUA 1O2GH 1QB1A 3QWCH 1OSSA 2BDGA 1G32B 1O3AA 1SQAA 3KQCA 1NRPH 3M5NA 1P12E 3SV9A 1O2HA 4F49A 4TPIZ 3F9EA 4ABHA 1PQ8A 1F5LA 1P8VC 1A46H 1OOKB 1Y3XA 2UUFB 4FUDA 3RXUA 2BQWB 3UY9A 1OS8A 1T8LA 2GKVE 1EJNA 4Y76A 4X6PA 2QY0B 3LH1A 2BTCE 1E0FD 3U8OH 5PTPA 3Q3XA 4Y8YA 2B9LA 5K0HA 1DUAA 3ZZAA 5DK1A 3R0FA 2OUAA 2F9UA 2QCYA 3QGNB 4GHQA 4WMEA 5DJ7A 2HNTC 2PHBA 5EXLA 2BVRH 1CU1A 2QV1A 1ZTLA 1O3EA 3UWIA 1XUFA 1NM6A 1KTSB 1MTUA 4YLUA 2F3CE 5LH8A 1Z1JA 1LPZB 1WCZA 1Y3UA 4HTCH 3U8RH 5DPAA 2F9BH 1HAYB 2OTVA 3LT3A 1DX5M 1K28D 1P2OA 3FP8E 1XXDA 5E0GA 1QY6A 2QF3A 3GCOA 5E0JA 1TX7A 1CHOF 2C8XB 2Y7XA 2Y7ZA 1AHTH 4X8UH 4E7NA 2PTCE 2PFEA 4UFEH 3MU5A 1BQYA 4D9QA 1ZMJA 2TGPZ 3M61U 1ELTA 3RXRA 5AFZH 4CRFA 1UVTH 1HJAB 1Z8GA 2G5VA 1ZGVA 1MCTA 3ZVCA 4AFSA 1MTNC 2B5TB 4A7IB 3KIDU 2WPMS 1BUIA 2Z9KA 2ZFQH 4UD9H 3URCA 1ABJH 1FZZA 1V2PT 3KEEA 2STBE 1QNJA 5F8XA 3TK6A 2ZHQH 2ZO3H 1VCWA 1C4V2 1ZOMA 1EXFA 3HPTB 6GCHF 1FNIA 4D9RA 1PPEE 3QGJA 3V12A 5I46H 4MNWA 1BHXB 1ACBE 3LU9B 1UTNA 1XVMA 3ODFA 1UK2A 3KNXA 1AO5A 1YM0A 2VGCB 1TPAE 1MKXH 2FOMB 1THRH 4IW4E 1VGCC 2G8TA 1G3BA 1DDJA 2NWNA 4WMDA 1SGPE 1C4U2 2XCNA 3SN8A 5BRRE 1P9UA 1SI5H 1FPCH 1Z6JH 3BTDE 2ZCKP 1GBDA 3S7KB 1EP5A 1GI8B 4YT7H 3F9FA 1NROH 1GHVH 3ATKA 3TITA 2WINI 1Q2WA 1IAUA 2OQUA 2ZEBA 1V2UT 1JIMA 5EXMA 3F9HA 7KMEH 1C1SA 1P10A 3QZRA 2R2WU 2FX4A 4INLA 3KN2A 2J2UA 3LGWA 1WAYB 1C5OH 1P03A 2WPKS 5I25A 1K22H 2PUQH 1SGEE 1C4Y2 2JETB 2BZ6H 2FTMA 1DWBH 1N8OC 5DP3A 1CQQA 2Z9JA 1TGTA 3MYWA 1KLJH 1ZSKA 2ANWA 1NRSH 1DLEA 2CJIA 5T3HA 1PPZA 1JXPA 3VPKA 3RU4D 1QHRB 1TNIA 2OC7A 1ZGIA 3UTUH 3EDXB 3RM0H 2AFQB 4MPWA 2XRCA 2A4QA 4OS6A 2DUCA 1O38A 1O3OA 2GD4B 2AIQA 1F0SA 1THSH 5FCKA 1OXGA 2GZ9A 1BTXA 1H9IE 1Z1IA 1AVWA 4JK6A 4CR5A 5F6MA 2AH4X 3K6ZA 1MBMA 1IQFA 5JB9S 4I8HA 3MWIU 3P8FA 3RUOA 3H5CB 4JZDH 3RXDA 1C1VH 2WPLS 1G30B 1ZHRA 4KP0A 4B2CA 1RD3B 2Z9LA 3LOXA 3ZVEA 2Z6BD 4X6NA 2BVSH 4A1XA 2FTLE 3PV4A 5FXLA 2GZ8A 1O3LA 5GDSH 3VGCC 2IJOB 5FHTA 3ELAH 2RA3A 1NT1A 4HI3A 1Z8JB 3TJOA 1LVYA 1GHYH 2STAE 5BPEA 1VITH 4JZ1A 3GDVA 1MH0A 2Q6GA 1TONA 1VITG 2BDHA 5E8EH 2Y5HA 3OTJE 4NZLA 1UVUH 3P6ZB 1OP2A 2AS9A 6CHAB 3BIUH 5DG6A 2HPQH 3B8JA 4B2BA 1YPLH 2Y5FA 1C5MD 4AG2A 1P57B 2FLRH 4NIYA 2G81E 4ABBA 3U1JB 1OWDA 5T6GA 1C1NA 3SNAA 1W7GH 3Q77A 2BDYA 3RXIA 4AB9A 1PPBH 1RGQA 1TOCB 2OC1A 4SGBE 2FOCA 1L1GA 3S9CA 1H1BA 3GCHC 2EC9H 3DFLA 1P02A 2W3KA 3SNEA 3T26A 1RIWB 5C3NA 4KTUA 2OINA 4BAMB 1NRRH 1WTGH 1YBWA 4FUJA 1P11E 4AFZA 2PWXA 2RDLA 3U69H 1CBWB 1D3PB 3TU7H 2WPIS 1BITA 1ZHMA 1C2JA 1LKAA 1UTMA 4NGAH 5JBTA 3ZZDA 1A0JA 2HNTF 5CHAB 4LK4A 8KME2 4I7YH 1TE0A 4CREA 3I78A 4NIWA 3GCTF 2VIVA 3HK3B 4BAOB 1ELAA 1BMAA 1MKWK 2VWOA 2FDAA 2ZGXH 4RN6A 1SLUB 8ESTE 1XKBC 1LPGB 1P2IA 4M7GA 1SHHB 2GT8A 2HLCA 1PQ5A 4BTTB 2ODQA 2P3UB 3K9XB 3ITIA 3RC5A 3SGQE 1ZJDA 3BG8A 6ESTA 4GAWA 4Y7AA 2PGQB 3E8LA 2A5KA 1GBIA 1O35A 3SO3A 2G52A 1SGQE 3LIWA 5GJ4B 1Q31A 3KQBA 4MG3A 3UOPA 3DT0H 1HAOH 1G2MA 1TA2A 1ETTH 2VIQA 2PSXA 2M5TA 4XBBA 2XYAA 2WUCA 1B0EA 3FZZA 4NA7A 3BSQA 1ZTJA 4MNVA 4GCHF 3RXFA 3SUDA 3SU0A 2BY7X 5EQQA 2UWPA 4Y10E 1O3DA 1W11U
chains in the Genus database with same CATH superfamily
3FN8A 1EAXA 1K1JA 4ZKNU 4KTSA 4XRNA 2GP9B 1BTHH 3ZZ7A 1GBBA 1QURH 1DSUA 3KF2A 1PQAA 3VB3A 4CBOA 1GCTC 3FP7E 5ESBA 4O3TA 3QTVH 5C1UA 2G5NA 1GMHF 1KYNA 1WYKA 3RMNH 4AX9H 3CENA 1K9OE 5EU8A 4A1TA 4DOQA 1FIWA 4UFFH 4ZAEA 3TVJB 4OM9A 4VGCB 1W8BH 1EAWA 1TBZH 1SQOA 3OSYA 1FN6A 4A5TS 4AN7A 2ANMH 2BD4A 1BMMH 4GPGA 5FPYA 1BHXF 2IJD1 1SVPA 3KQ5A 4INKA 3OE7D 1G3EA 4H4FA 4F4OC 3MNXA 4CBNA 1S6HA 1H8HD 4IMQA 1DY8A 1AD8H 2CMYA 2AGEX 1KXCA 2A7JA 2P3FH 1W12U 2GV7A 5DO4H 2V7QD 1J8AA 3V7TA 3D65E 4SGAE 4VGCC 2QC2A 4BTIB 3NRLA 1GBEA 7GCHG 3T25A 1YKTA 1AU8A 5GNDA 4LZ4B 4CHAB 1FMGA 1K1NA 3MH4A 2BDBA 1IQIA 4ZROA 4P00A 2ALPA 3MO9A 3TH3H 1ELVA 1C5TA 3EE0B 4I8JA 5C67A 1B5GH 2FWWA 1V2VT 2O8TA 4NIXA 2P95A 1YY3A 2TGAA 2J94A 3LONA 1MAYA 1QRWA 4WH6A 1HGTH 2A5IA 4ABEA 2QYIA 2BD8A 4H42U 1OWKA 1ZRKA 1GBKA 1S5SA 1WSSH 3SJOA 1UO6A 2R3YA 3DSGA 3RXVA 7ESTE 1ZZZA 4FUCA 1UJ1A 3S0NA 3C27B 5EOKA 4FU9A 5GPIB 2AGIX 5C2ZA 4UFDH 1KXAA 3STIA 1C1RA 3R3GB 1GJBB 1UVPA 1T8OA 3MMGA 2OBOA 3PLKA 1S84A 1DICA 2ZWLH 2ZU4A 4TSFD 2RA0A 1EZQA 3GDUA 1C5XB 3SOSA 5K7RA 1V2LT 2TGDA 3SJ8A 1THPB 3DFJA 3HKJB 3EYDA 3SV2H 1NRQH 1O36A 1GHAG 2HVXA 1NFWA 5J4SA 1ESTA 2J98A 4KGAA 3LJJA 1TOMH 1HYLA 5DP9A 1TNKA 5ABWA 2QF4A 1J14A 3A89A 1P2QA 1ZPCA 3SNDA 2VINA 4OS5A 1VJ9U 1JOUB 4ISNA 1XUIA 1TALA 2WPJS 1IQKA 2ZFFH 4X1NU 3AK5A 3TJVA 2XWAA 1ANCA 1B0FA 3F1SB 5T1VA 1TNJA 2J98B 4FU7A 4Z0KA 1DXWA 1TAWA 2ZPRA 3E3TA 1QA7A 2K0QA 5C1XA 3QUMP 1LVBA 1GJ5H 2CXVA 4NFFA 4OS4A 2JDID 4X1SU 1QJ1B 3SZEA 2SNVA 3FKSD 2ZF0H 1XUKA 2IOTA 3O8CA 1RTFB 1T4VH 5HIZA 1YPHE 1BTZA 1V2JT 1TQ0B 2FOGA 3Q00A 1SGTA 3QLPH 4MNXA 4YTAA 4X2XA 2GMTC 2QN5T 1O5CB 1OX1A 1V2RT 3SZNA 1UCYE 4B71A 1MUEB 2SGFE 1MKXK 1NFXA 3PV5A 1UHBA 3NXPA 1UCYH 1YPEH 1T32A 3PMJA 1F5RA 1T8MA 3UR9A 1A3EH 1C5QA 1TA6A 2BM2A 1WQVH 3WWFA 2JH5D 1SPJA 3SU6A 3WWBA 2ZCHP 1ORFA 1KY9A 1LQDB 1WQSA 3PO1B 5HMAA 2ZU1A 4Q80A 1XKAC 1HJ8A 2ANKH 4I8GA 1W0ZU 3EA9A 2ZDVH 9ESTA 5LPFA 1LTOA 3M5LA 3S9AA 3RXHA 2ZHWH 2SGPE 2FS9A 1TPSA 1UHBB 2BD5A 2FPZA 1BTPA 3PRBA 4IGDA 1EASA 1GGDB 3OX7U 4PROA 1YLDA 4ASUD 1W2KH 3PO1C 1Y5UT 1GI1A 2B7DH 2V6NA 4E05H 1LHDH 1K21H 1AI8H 2BLWA 2O8LA 2F4LA 1YGCH 1AFQC 3W94A 2VH6A 1DM4B 3U8TH 3UWJH 5EW2H 1KXEA 3LC5A 3VB5A 1O2OA 2A45B 2BLQA 3ZVDA 1T8NA 1RTKA 7LPRA 3AAVA 4TPYA 1G3CA 1GGDC 4TYDA 2AHME 1PYTC 3K65B 1C1MA 5A8YA 3BG4C 3KL6A 4WH8A 4X8VH 3TK5A 4E06H 2ZFRH 4RT0A 1O0DH 1Y5BT 4JZEH 3EQ0H 2XBYA 3UQVA 1K2I1 1W10U 1GJCB 3A8BA 2DE9A 5JBAS 1GI2A 2BDAA 4D7GA 1IHTH 2BD9A 3LH3A 1C5RA 4K3JA 1C5YB 4Y6DA 1ARCA 1V2ST 2TGTA 4ISHH 4DJZB 1O2UA 2AYWA 1O3HA 4DCDA 1A5IA 3BIVH 1SB1H 2FOFA 1KLIH 3ODDA 3CS0A 1V2WT 2F9NA 4LXBH 2BY6X 3N7OA 1MTNB 2W7SA 1P09A 2HOBA 1O5BB 1SGNE 3BV9B 5FBIA 1C2KA 4FUHA 4FUEA 1UMAH 2A32A 1TGSZ 2HRVA 2ZDKA 1BCUH 3FANA 1BJVA 4XDEA 1P2JA 1QJ7B 4TY6A 4ISIH 2BXTH 3RXSA 3MOCA 1IQMA 1UVOA 5IYTA 2G4UA 1UK4A 2FXRA 1V3XA 1VCQA 1QQUA 1EZSC 2GVFA 2XCFA 4NSYA 1PYTD 4JK5A 2AMQA 1VGCB 1O3KA 1ZMLA 1SFQB 1MMJN 2PKAA 2PV9B 5G4BA 3LKWA 1O2KA 3ZZ9A 2GJGA 3SBKA 3Q76A 3RXPA 2UUYA 4NZQA 2LP6A 4Z6AH 2FI3E 4BAHB 2ANYA 2GTBA 1GL1A 3GY4A 1IQJA 2XTTB 4OS2A 1KDQA 4RT1A 2BLOA 2VB0A 4K8YA 3ZZ8A 4AG1A 3HGPA 1HBTH 1UTKA 2A2XH 2Z9GA 1V2NT 3UQOA 2O8MA 3PLBA 1CE5A 1NN6A 1TGCA 3QO6A 4ABGA 1ETRH 2C4FH 1GI4A 2NU1E 5A0BA 3ENSB 4DIHH 2OK5A 1GMDF 1PJPA 2BY9X 1IQLA 1GBJA 2GGVB 1N8OB 5LPRA 3U1IB 3UREA 2ZPQA 1O3NA 5FL7D 4FUBA 1O39A 4UDWH 3L3TA 8GCHG 1HDTH 1YCPH 2OP9A 4ZUHA 1G36A 1QR3E 2ZFTA 1YPJH 2Z94A 1FONA 1WBGB 3DD2H 5DN6D 5HXFA 1BZXE 1F0TA 1DVAH 4YO9A 1VR1H 1GBAA 1EATA 2ZGBH 1CT4E 1E79D 1SC8U 4CRCA 1O37A 1HB0B 1FPHH 1NC6A 1K0HA 1ELGA 1D9IA 3BEUA 5DP8A 1O33A 1FJSA 1C2IA 4UFGH 1O3JA 2CK3D 4MPXA 3MO3A 1C5PA 4X8SH 3D23A 1YPGH 1W3CA 1GMCG 1WTHD 1JBUH 4UEHH 3FO8D 3SHCH 4TWWA 3EAJA 1KSNA 2P8OB 2R0LA 1AFEH 4JYUH 4NCYA 2FZZA 3GY7A 3A80A 3F2GA 1MCVA 3QN7A 3S69A 5L30H 3VGCB 1O2IA 3U98H 5EJ1A 2ZDMA 4X6OA 4OS7A 1XUHA 1DS2E 4Q7YA 1DUEA 4O3UA 1Z8IB 3GY6A 2H6MA 5TCCA 1FN8A 3VB6A 5AF9H 2KM0A 1H9HE 3QDZB 2BHGA 2P8OC 4NA8A 3SU5A 4U30A 3F3BA 1SGCA 2H5DA 2XC5A 5KEDA 4INHA 5C0TA 2ZTYA 1AWFH 1O3FA 1NU9A 1C5UA 4ZKSU 2VNTA 1UTOA 2Y6TA 3GICB 4HZHA 1KXFA 4YLQH 1HFDA 2HPPH 1E34B 2PGBB 1OWHA 3RMMH 3SJIA 1D3DB 4WMFA 4RKJB 3P8GA 1IQNA 3UFAA 1VKYA 2LNCA 2IPQX 1QCPA 1QB6A 2UWLA 4OGXA 3SU1A 3ZZBA 4YXWD 3GCHB 1GVKB 4AYYB 3M3VA 1NBME 3FVFB 4BAQB 1P2NA 2JJ1D 4RKOB 1CT0E 3OTPA 1TNGA 3OY5U 1TPPA 4M9FA 1QQ4A 4DURA 2ZU5A 2P3TB 2F91A 3D49H 4BANB 1J17T 3BTKE 3A7XA 4XD7D 1E36B 5DGJA 1ZTKA 3B9FH 1V2MT 1V2QT 1SGRE 5GCHF 1ID5H 2CF8H 1FY4A 2GDDA 3FZDA 2R3UA 3OEED 1DWEH 3BTME 4ZHMU 1E38B 2Z7FE 3ZZ3A 1CHOG 3RXJA 3TK9A 3V3MA 2AERH 3UNRA 3MH6A 1AVGH 3SORA 1Q3XA 4JYTA 3Q3KA 3UB0A 1KXDA 1CO7E 1XX9A 5IDKA 4ZHAA 5C5NA 3E91A 4FUGA 3O8BA 1NTPA 1CGJE 2VWNA 3MO6A 3VB4A 2FYQA 2ZTZA 5E2OA 2H9HA 1AKSA 1AB9C 3ZYEA 2OC8A 2JKHA 4X2VA 1ZMNA 3LGUA 4BXWA 4DT7B 3NPSA 1YP9A 1BRUP 1GDNA 1J9CH 1HIAA 1QBOA 2ZGJA 2GX4A 1EJAA 1H8IH 1QRZA 3JZ2B 1UTQA 6GCHG 1P2MA 3RC4A 3SQEE 2TBSA 1TRMA 1SLXB 3T28A 3M36A 2K8IA 3MHWU 5E2PA 1YPMH 3PYHA 3T62A 2A0QB 4DGJA 1C2FA 1GI7B 1W0JD 1Z6EA 1NZQH 2C8ZB 3A7ZA 3WW7A 2XBWA 3PMAB 3RXOA 1NESE 2ZHFH 3GISB 1TABE 3L6PA 3U9AH 1M9UA 5KECA 2BLVA 2THFB 4BXSA 4Q63A 2A7CA 1VCPA 3SU4A 2NU2E 2GCTC 3B23B 1GCTB 1EQ9A 5EODA 2YOLA 2ILNA 3SUGA 4ABAA 1EKBB 4J1YA 3A83A 1D4PB 1ZRBA 3U28C 5B6OA 1MTVA 3OAAD 4XBCA 5DSFA 3URDA 3F0PA 3D62A 1DE7H 1GHWH 1N1LA 2C8YB 4YT6H 5CHBA 4I8LA 3SV6A 1CT2E 1KTTB 2UWOA 1K1MA 3PWCA 2W3IA 3TLOA 2SGQE 3KQDA 2GCHF 1ZJKA 2D8WA 3UPEA 2VIDA 1VJAU 1MAXA 1P2KA 3A7YA 3ZVGA 3NUMA 1RS0A 5EPYA 1C1UH 2F9VA 1O2QA 2WPHS 4QT8C 2P94A 3SU3A 2FEQH 1IOEA 3KGPA 1HRTH 5CMXH 1SGIB 3M3TA 4THNH 1JWTA 2QF0A 1LVMA 2G00A 3A7VA 3MNSA 3MQKC 3Q3YA 1AIXH 5HM9A 5DP4A 1IQEA 5FCRA 3SV8A 1YWUA 1OPHB 3BTHE 1UCYK 1BRCE 1ANBA 2H9TH 4XE4A 5EPNA 3M35A 2FIRH 4FETA 4LZ1H 5JBBS 1K1OA 1SGFG 3RXQA 1L2EA 1DY9A 1G37A 2FLBH 1CVWH 1D6RA 5HKKD 5L2ZH 3ZV8A 4CH8B 4KELA 4MNYA 1TYNA 3RP2A 1ZPBA 2BVXH 5EGMA 2HGTH 1H9LB 1Y3YA 2ZI2H 3RXTA 1ELFA 1OWJA 1O2RA 1ZSLA 1PPGE 2I6SA 3GCNA 4ZH8A 1S6LA 3HATH 4DW2U 5JB8S 1T7CA 4K1TA 3F68H 4A6LA 1ESAA 1C5WB 1AQ7A 1AGJA 4MPUA 4WY3A 1WXRA 2EI6A 4Q2KA 1V2KT 2VH0A 4Q7ZA 2JH6D 3IITA 1DWDH 1BTWA 1GBLA 2EA3A 1GHXH 1SLWB 1F0UA 2CN0H 2L6OA 3A8CA 2ZU2A 1HXFH 1LMWB 5F8TA 5ETXA 2FODA 3E0PB 5LGOA 3LC3A 3PV2A 3SI4H 1HNEE 2ZP0H 5IK2D 3LGIA 1BB0B 2EQNA 3MU0A 1OKXA 2ZNKH 3OYPA 4GLYA 1ZPZA 3BTWE 3SJ9A 2QXIA 3N99A 2L74A 1EPTA 2BY8X 4AC9A 1C5LH 1P04A 4MVNA 1PFXC 4LOYH 2ZDAH 1D3TB 1UTJA 3UOUA 1C2MA 3BTEE 1SOZA 1YLCA 1C5ZB 1Z8RA 3SNCA 5HIYA 3P17H 1SHYA 2CHAC 2ZDNA 4FVBA 5FX5A 2PW8H 4P02A 1O2XA 1CHGA 2BMGB 1P05A 1EAIA 1SG8B 2HNTE 4MQAA 1TMTH 1ELEE 4XOJA 1HCGA 3RXBA 4DY7B 2BOHB 2HALA 2J4IA 2Q1JA 2W7UA 1GPZA 4MDSA 3WY8A 1MD7A 2BB4A 1QGFA 4HGCA 1HAIH 3ESTA 1B7XB 1S81A 1TX8A 4ZXXH 3FAOA 4KTCA 1SBWA 2EI7A 1SOTA 3GCTG 2OD3B 4FUFA 1FDPA 4IN1A 4X0WU 3P8NA 3P95A 4I31A 1MQ6A 3SNBA 8LPRA 2R2MB 2QXGA 3QTOH 4NIVA 3EE7A 1FIZA 1LVOA 2IPHA 1HAZB 3O8RA 2FOAA 3GY5A 4IN2A 1K1LA 2OC0A 3V0XA 2Y82A 2H5CA 4B1TA 1EPTC 4GUXA 3A81A 1O3IA 3CP7A 5GIBA 2GMTB 1TGBA 1LCYA 1A61H 1GI6A 4Y7BA 5L6NH 3AW0A 1ELBA 1MD8A 5DP7A 1G3DA 1YC0A 3MI4A 5C20A 2W6ID 2VIOA 1CGHA 5A09A 1F2SE 4JMYA 1HAVA 4ACAA 1GBCA 1Y59T 2XXLA 2NU4E 1MBQA 2ZHDA 4H6SB 1AY6H 1SMFE 2OCVB 1ELCA 1OWEA 2QIQA 2V3HH 1FY8E 1GWAA 1DWCH 2AEIH 2C8WB 2M2AA 1L1JA 3UAIC 1C2HA 4YOJA 2ASUB 4GCHG 1XM1A 2ZTXA 1O2ZA 4ZKRU 4CRAA 1SQTA 4O97A 4H6TA 2FESH 4YOGA 1LHEH 1P3CA 2TRMA 4FUIA 4X1RU 3QK1A 1GJAB 3PLPA 3NKKA 3W95A 4ZHLU 3SW2B 4U2WA 2JIZD 1EJMA 3QX5H 3T2NA 2UUJB 4NSVA 2W26A 1XUJA 5DP5A 1A0HB 1ARBA 1O3CA 2VIWA 3L33A 1GMHG 1SR5C 1RFNA 1YCPM 2LELA 3M7QA 3DSOA 4D7FA 4ISLA 2BOKA 1YCPK 2ZFPH 4K69A 1AFQB 1SGDE 3GY8A 1NFYA 2YNBA 1BRAA 4CH2B 1AE8H 1GJ7B 1O2MA 3ZVFA 3M5OA 2WSSD 3T27A 1O5GH 3SI3H 1NRNH 5T6DA 2PP6A 3AAUA 4X8TH 1F5KU 1QL7A 2H2ZA 1MTWA 1C5SA 1TFXA 3BG4B 1CGIE 3PM3A 4R8TB 4MPVA 1PPCE 5T6FA 2A2QH 1EUFA 3OEHD 4MTBA 1A7SA 4CRGA 2FI4E 3PB1E 2WZQA 2WUBA 1O2SA 1BMLA 1U6QA 2VWLA 9LPRA 1W7XH 2R9PA 1CA0C 1O30A 1HAHH 2SNWA 3MTYA 2C90B 2SGEE 1FLEE 4TWYA 5E0HA 5HYOA 2ZQ1A 2XBXA 2PKSC 1FQ3A 1GBTA 1ZSJA 3NCLA 4ISOA 3PMHB 1NY22 2KAIA 4CR9A 2DE8A 2GT7A 2O8WA 1GG6C 1LHCH 1GJ8B 4JZFH 1EZXC 3P70B 1IQGA 4IC6A 3SHAH 2EEKA 3RM2H 2FYRA 3BN9A 1SFIA 5EQRA 2QE7D 5AHGH 4UE7H 3GDSA 1O2YA 1GJ4H 2PUXB 1O3MA 1BTYA 1AE5A 2ZC9H 4AFUA 4O9VA 2A4RA 3NWUA 3OU0A 2A31A 1HJ9A 4AFQA 2HWLB 2FM2A 1TX6A 4AGKA 1O2NA 3G01A 4XBDA 1VITF 5CE1A 2WYJA 1RJXB 4WXVA 3RLYH 4JZIA 5GXPA 5FX6A 3TJNA 1ETSH 2KAIB 1DPOA 3TGKE 1A5GH 1NS3A 2G51A 2VIPA 4X2YA 1KXBA 2BX3A 4X1QU 2KCOA 2SGAA 2ESTE 1EOLA 2ZPSA 2I6QA 1P9SA 4ABDA 4I32A 1ABIH 2GV6A 3A82A 4IC5A 3KHVA 1ZR0A 2VJ1A 2IN2A 4ABFA 4B2AA 3T29A 2ZIQH 2A5AA 2BD7A 1FXYA 1EZUC 3AVZA 1O2JA 4ASHA 1O2PA 3ZYDA 3UUZA 4GVUA 1OYTH 2GZ7A 1BMFD 4YOIA 1BBRE 4R0IA 1E1QD 3AW1A 1C9PA 4F55A 3TNSA 2Q6FA 5DKMA 2W6JD 1NPMA 1XUGA 1ANDA 1A1RA 1BBRH 2GDEH 1Y5AT 1ZHPA 1YPKH 1QA0A 1PPHE 2BY5X 2FOHA 2UUKB 1UK3A 2VVCA 4Y79A 1GHBG 1GI9B 1CSOE 2B0FA 1C5VA 4NWKA 3SU2A 4Y71A 3PWBA 3TIUA 3GYLB 1EAUA 2VVVA 3H09A 1L1NA 2BX4A 5FAHA 5GWZA 2Z9IA 3VEQB 1YPHC 1LO6A 5HGGA 3SGBE 1LHFH 2ZFSA 4IS5A 2OLGA 1C2DA 6LPRA 3F0OA 4AYVB 3IWMA 2NU3E 1MZAA 3ZVBA 2A1DB 4FVDA 3RXMA 4ZMAH 1HJAC 1UW7A 1GDQA 2KX4A 2PKAB 2VWMA 4I8KA 1WV7H 4A1VA 5DP6A 1FX0B 2D26C 4AOQA 5A8ZA 2QGRA 3AASA 1DLKB 2JH0D 2WPDD 1SL3A 4K5ZA 3LDXH 2G55A 1O5FH 3RC6A 3ATIA 1KDQB 5F8ZA 2H9EH 5ESTE 2RFKC 1QB9A 2EI8A 1DITH 2AIPA 1W0YH 1WU1A 1V2TT 1YF4A 5EW1H 3JZ1B 3KYFA 2ULLA 5C17A 1O2VA 3PROA 3RLWH 1CA8B 1HPGA 5EXNA 1O3BA 1L4DA 2VGCC 1EX3A 3N7EA 2AMPA 1AMHA 1A3BH 2FX6A 5TJXA 1S83A 4MLFB 1UVSH 1AN1E 3VXFH 1VZQH 4Y8ZA 2XC0A 3A8AA 4B6EA 4I33A 2BYAX 2F9PA 1O34A 4E7RG 1C2GA 3M7UA 3LGYA 4JCNA 5F03A 3DUXH 1AZ8A 2P93A 3PTNA 3RDZA 1GCDA 4WXIA 2FP7B 1D6WA 1FAXA 2FOEA 4BNRA 2WV5A 3ZVAA 2O9QA 4AORA 4DIIH 1BOQA 2TIOA 3TJUA 1Y3WA 2ZG0H 1EB1H 1JRSA 3RMLH 3T5FH 3VB7A 1X7AC 3P8OA 2XNIA 2ODYB 2FOBA 4K1SA 3TGJE 1D3QB 1OP8A 2JETC 3C1KA 2ALVA 1C9TA 4D76A 4K1EA 3M37A 5LPEA 3OFND 3RXEA 3TH4H 1LQEA 4AZ2B 2V3MA 2Z3EA 5C5OA 3H7OA 1BA8B 1GBMA 3A7WA 5J4QA 1O32A 4JYVH 1C1TA 1ANEA 7GCHF 1XVOA 4WVPE 2WV4A 3LJOA 1A4WH 1HAGE 2ZQ2A 2HLDD 2W5EA 4XSKU 3K6YA 3V13A 1RTLA 1QL8A 4XFQA 1GDUA 1TMBH 1GBHA 2OXSA 5H4IB 2R0KA 4ZXYH 3TGIE 1TNLA 1O5DH 4K8BA 1TNHA 3SQHE 1SSXA 2YMSC 3KCGH 4CRDA 2OBQA 1C1OA 1INCA 1N6YA 3GY2A 1AB9B 1C5NH 1DFPA 1BDAA 1WOFA 1XMNB 2J95A 1SLVB 4U32A 1WDIA 1FY1A 1MABB 1GI5A 3DHKH 3O8DA 5JDUB 1QBNA 3VFEA 2QXHA 4B74A 2ZDLA 4BOHA 5FPSA 3BEIB 4X2WA 3CS7A 2O8UA 4ABIA 1JRTA 3E16B 2PTNA 6CHAC 1HAXB 1EP6A 3EA7A 5A0CA 1GVZA 1HV7A 1UTLM 1Y8TA 1SGYE 2FS8A 4FU8A 3ZZ5A 3MU8A 3NZIA 1GHAF 1G9IE 3LGVA 1W0KD 3VXEH 3BTQE 3H7TA 5TCAA 4Z1MD 3E0NB 1O5EH 2QAAA 1RIWC 1TGNA 4ESTE 2A7HA 2GCTB 4YM9A 1V2OT 1E35B 1GBFA 5C1YA 1GI0A 1TLDA 1C1PA 4Y8XA 1AKSB 2SFAA 5L2YH 2XNDD 1FI8A 2XWBI 1F92A 3ZZ4A 2LPRA 2EY4C 2Y80A 2BZAA 1CBWC 1NFUA 1HIAB 1L4ZA 1V6DA 1TRYA 2CGAA 2YMSD 4O03A 1GMDG 4Y11E 5CHAC 1AZZA 1C1WH 3MNBA 2AMDA 2QA9E 1QJ6B 4KKDA 1PQ7A 3P92A 1HUTH 1RRKA 3MFJA 2QXJA 1J15A 2Y5GA 1AUJA 1TIOA 3RXKA 4A92A 1JIRA 3BTTE 2J9NA 3GOVB 5JPMH 2A4OA 1PPFE 2FMJA 3S7HB 4Y0ZE 3SUFA 3EGKH 3TNTA 2XW9A 3IG6B 1E37B 3TPIZ 1P06A 2CV3A 1GJ6A 5A0AE 4ZCNA 1BMNH 1T31A 1N6XA 1GVLA 3A7TA 4IMZA 1O3GA 2ZHEH 1GHZA 1KMHB 3MU4A 1G2LA 2PSYA 3K2UA 5F53A 1XXFA 4DVAU 1EB2A 3FFGA 1LKBA 1QRXA 1Z7KA 3A86A 1FUJA 2Q6DA 3SUEA 2D1JA 5AVDA 1O3PB 1QL9A 1JMOH 1QBVH 2A4GA 1C2EA 3MNCA 1FY3A 1ESBA 2V0BA 4BAKB 4X1PU 1HLTH 3A8DA 3OY6U 4K2YA 1IQHA 4B75A 2OQ5A 3VG8A 1AUTC 4OGYA 2VU8E 4AB8A 4OS1A 3M3SA 1L0ZA 4NG9H 4ZKOU 3W1EA 1RXPA 2ZZUH 2J38A 2RCEA 3SV7A 3S9BA 4Y0YE 4WWYA 5JYIA 2BDCA 2ZGHA 3I77A 1C1QA 3BTGE 1BJUA 2G4TA 3MH7A 3LGTA 4TT3D 3RU4T 3A87A 1A0LA 3ATMA 2ZU3A 2CF9H 1MU6B 4FXGH 2Z3CA 1P3EA 2BQ6B 5SGAE 1FV9A 3RXAA 4X6MA 1S82A 2CHAB 4Q7XA 1HXEH 1T4UH 3BTFE 3E90B 2ZCLP 2BD2A 3ZZ6A 1UTPA 1J16A 1ZYOA 5AFYH 3UIRA 1C2LA 1W13U 2B8OH 5GCHG 4J2YB 2V3OH 1EOJA 2FI5E 5EJLA 4B73A 1GJ9B 5FBEA 3SJKA 4CHAC 3F2HA 1YLNA 1FY5A 4UONA 1IHSH 3TH2H 1NO9H 3A84A 1MZDA 3M7TA 4TY7A 1EFRD 4YESB 1DANH 3F9GA 1Y3VA 2BQ7B 2J92A 2P16A 2ZA5A 3HK6B 1BRBE 2C93B 2VVUA 3M5MA 1EPTB 3SGAE 4B76A 5A8XA 1MU8B 1S0QA 1GI3A 1DSTA 1YYY1 2J5UA 3QZQA 1MKWH 3GY3A 4ABJA 2NU0E 3PTBA 2WV9A 5EQSA 2WYGA 4B6FA 1LHGH 3ATWA 1NBMD 1O2WA 5FPTA 1TBRH 5JBCS 1MQ5A 1BIOA 2RG3A 2V35A 1QIXB 2F9OA 4YZUA 2TPIZ 3KYGA 3KQEA 2KFWA 1SGFA 2KR7A 4IBLH 1OWIA 2BDIA 1P01A 3STJA 1O31A 3RMOH 3ZZCA 1OYQA 1TQ7B 4DG4A 2ZGCA 5C94A 2YNAA 1S0RA 3F6UH 3F2FA 1GL0E 1BBRK 1GHBF 2PLXA 3UNSA 1K1IA 1HAPH 2BD3A 2C3SA 2Z3DA 4GHTA 5EJZA 4NFEA 2QF5A 1TRNA 3MH5A 3RXGA 1S85A 4NWLA 1OP0A 3PRDA 4FOUC 4RSPA 3GYMA 3RU4E 1TB6H 4D8NA 2F83A 3DSPA 1TBQH 4K60A 1TWXB 3LPRA 1Z71A 2F43B 1FAKH 4WF8A 3NK8A 3EA8A 1NU7B 1TPOA 2ZKSA 5HM2A 1HAVB 1LPKB 2GCHG 1A5HA 1LDTT 1F7ZA 1ELDE 1S6FA 3A88A 4BTUB 1TMUH 8GCHF 1P0SH 3ZV9A 3FP6E 4U01A 4HFPB 1H8ED 4AGJA 3E6PH 2SGDE 1H4WA 3FOAA 5EG4A 1ZLRA 1AVXA 3HKIB 1O5AB 2PR3A 1CA0B 2AGGX 1A2CH 1AWHB 2XBVA 3E1XB 1K1PA 3DA9B 2FO9A 3UNQA 3I29A 3RXCA 3RXLA 1KLTA 2PKSB 2RDEA 3BEFB 1GMCF 4NA9H 1BT7A 2XC4A 1DOJA 1QTFA 2Y81A 3HGNA 1W14U 1QFKH 1GG6B 3UR6A 1O2TA 1WUNH 1GJDB 2H1UA 3A85A 3PMBB 1KIGH 1H8DH 2ODPA 5EIYA 1O2LA 1DXPA 1MTSA 2D2DA 1F0RA 2ZECA 2KCYA 5A2MH 1DT2A 2K1QA 4GSOA 2J34A 3BF6H 3ATLA 2P59A 2BXUH 3MU1A 4WJG2 4CRBA 1BTUA 1O2GH 1QB1A 3QWCH 1OSSA 2BDGA 1G32B 1O3AA 1SQAA 3KQCA 1NRPH 3M5NA 1P12E 3SV9A 1O2HA 4F49A 4TPIZ 3F9EA 4ABHA 1PQ8A 1F5LA 1P8VC 1A46H 1OOKB 1Y3XA 2UUFB 4FUDA 3N7DA 3RXUA 2BQWB 3UY9A 1OS8A 1T8LA 2GKVE 1EJNA 4Y76A 4X6PA 2QY0B 3LH1A 2BTCE 1E0FD 4DT4A 3U8OH 5PTPA 3Q3XA 4Y8YA 2B9LA 5K0HA 1DUAA 3ZZAA 5DK1A 3R0FA 2OUAA 2F9UA 2QCYA 3QGNB 4GHQA 4WMEA 5DJ7A 2HNTC 2PHBA 5EXLA 2BVRH 1CU1A 2QV1A 1ZTLA 1O3EA 3UWIA 1XUFA 2KCPA 1NM6A 1KTSB 1MTUA 4YLUA 3DCLA 2F3CE 5LH8A 1Z1JA 1LPZB 1WCZA 1Y3UA 4RI0A 4HTCH 3U8RH 5DPAA 2F9BH 1HAYB 2OTVA 3LT3A 1SQRA 1DX5M 1COWD 1K28D 1QZ8A 1P2OA 3FP8E 1XXDA 5E0GA 1QY6A 2QF3A 3GCOA 5E0JA 1TX7A 1CHOF 2C8XB 2Y7XA 2Y7ZA 1AHTH 4X8UH 4E7NA 2PTCE 2PFEA 4UFEH 3MU5A 1BQYA 4D9QA 1ZMJA 2TGPZ 3M61U 1ELTA 3RXRA 5AFZH 4CRFA 1UVTH 1HJAB 1Z8GA 2G5VA 1ZGVA 1MCTA 3ZVCA 4AFSA 1MTNC 2B5TB 4A7IB 3KIDU 2WPMS 1BUIA 2Z9KA 2ZFQH 4UD9H 3URCA 1ABJH 1FZZA 1V2PT 3KEEA 2STBE 1QNJA 5F8XA 3TK6A 2ZHQH 2ZO3H 1VCWA 1C4V2 1ZOMA 1EXFA 3HPTB 6GCHF 1FNIA 4D9RA 1PPEE 3QGJA 3V12A 5I46H 4MNWA 1BHXB 1ACBE 3LU9B 1UTNA 1XVMA 3ODFA 1UK2A 3KNXA 1AO5A 3CNRA 1YM0A 2VGCB 1TPAE 1MKXH 2FOMB 1THRH 4IW4E 2XOKD 1VGCC 2G8TA 1G3BA 1E1RD 2VBCA 1DDJA 2NWNA 4WMDA 1SGPE 1C4U2 2XCNA 3SN8A 5BRRE 1OHHD 1P9UA 1SI5H 1FPCH 1Z6JH 3BTDE 2ZCKP 1GBDA 3S7KB 1EP5A 1GI8B 4YT7H 3F9FA 1NROH 1GHVH 3ATKA 3TITA 2WINI 1Q2WA 1IAUA 1SKYE 2OQUA 2ZEBA 1V2UT 1JIMA 5EXMA 3F9HA 7KMEH 1C1SA 1P10A 3QZRA 2R2WU 2FX4A 4INLA 3KN2A 2J2UA 3LGWA 1WAYB 1C5OH 1P03A 2WPKS 5I25A 1K22H 2PUQH 5B6LA 1SGEE 1C4Y2 2JETB 5KGOA 2BZ6H 2FTMA 1DWBH 1N8OC 3SYJA 5DP3A 4HG6A 1CQQA 2J97A 2Z9JA 1TGTA 3MYWA 1KLJH 1ZSKA 2ANWA 1NRSH 1DLEA 2CJIA 5T3HA 1PPZA 1JXPA 3VPKA 3RU4D 1QHRB 1TNIA 1ZGIA 2OC7A 3UTUH 3EDXB 3RM0H 2AFQB 4MPWA 2XRCA 2A4QA 4OS6A 2DUCA 1O38A 1O3OA 2GD4B 2AIQA 1F0SA 1THSH 5FCKA 1OXGA 2GZ9A 1BTXA 1H9IE 1Z1IA 1AVWA 4JK6A 4CR5A 5F6MA 2AH4X 3K6ZA 1MBMA 1IQFA 5JB9S 4I8HA 4I86A 3MWIU 3P8FA 3RUOA 3H5CB 4JZDH 3RXDA 1C1VH 2WPLS 1G30B 1ZHRA 4KP0A 2KCAA 4B2CA 1RD3B 2Z9LA 3LOXA 3ZVEA 5C0UA 2YMSB 2Z6BD 4X6NA 2BVSH 4A1XA 2FTLE 3PV4A 5FXLA 2GZ8A 1O3LA 5GDSH 3VGCC 2IJOB 5FHTA 3ELAH 4F48B 2RA3A 1NT1A 4HI3A 1Z8JB 3TJOA 1LVYA 1GHYH 2STAE 5BPEA 1VITH 4JZ1A 3GDVA 1MH0A 2Q6GA 1TONA 1VITG 2BDHA 5E8EH 2Y5HA 3OTJE 4NZLA 1UVUH 3P6ZB 1OP2A 2AS9A 6CHAB 2HVYB 3BIUH 5DG6A 2HPQH 3B8JA 4B2BA 1YPLH 2Y5FA 1C5MD 4AG2A 1P57B 2FLRH 4NIYA 2G81E 4ABBA 3U1JB 1OWDA 5T6GA 1C1NA 3SNAA 1W7GH 3Q77A 2BDYA 3RXIA 4AB9A 1PPBH 1RGQA 1TOCB 2OC1A 4SGBE 2FOCA 1L1GA 3S9CA 1H1BA 3GCHC 2EC9H 3DFLA 1P02A 2W3KA 3SNEA 3T26A 1RIWB 5CDFE 5C3NA 4KTUA 2OINA 4BAMB 1NRRH 1WTGH 1YBWA 4FUJA 1P11E 4AFZA 2PWXA 2RDLA 3U69H 1CBWB 1D3PB 3TU7H 2WPIS 1BITA 1ZHMA 1C2JA 1LKAA 1UTMA 4NGAH 5JBTA 3ZZDA 1A0JA 2HNTF 5CHAB 4LK4A 8KME2 4I7YH 1TE0A 4CREA 3I78A 4NIWA 3GS9A 3GCTF 2VIVA 3HK3B 4BAOB 1ELAA 1BMAA 1MKWK 2VWOA 2FDAA 2ZGXH 4RN6A 1SLUB 8ESTE 1XKBC 1LPGB 1P2IA 4M7GA 1SHHB 2GT8A 2HLCA 1PQ5A 4BTTB 2ODQA 2P3UB 3K9XB 3ITIA 3RC5A 3SGQE 1ZJDA 3BG8A 6ESTA 4GAWA 4Y7AA 2PGQB 3E8LA 2A5KA 1GBIA 2JJ2D 1O35A 3SO3A 2G52A 3ZIAD 4ACBA 1SGQE 3LIWA 5GJ4B 1Q31A 3KQBA 4MG3A 3UOPA 3DT0H 1HAOH 1G2MA 1TA2A 1ETTH 2VIQA 2PSXA 2M5TA 4XBBA 2XYAA 2WUCA 1B0EA 3FZZA 4NA7A 3BSQA 1ZTJA 4MNVA 4GCHF 3RXFA 3SUDA 4Q4LA 3SU0A 2WHXA 2BY7X 2KZ4A 5EQQA 2UWPA 4Y10E 1O3DA 1W11U
chains in the Genus database with same CATH topology
1EAXA 1K1JA 4ZKNU 4KTSA 2GP9B 1BTHH 3ZZ7A 1GBBA 1QURH 1DSUA 3KF2A 1PQAA 3VB3A 4CBOA 1GCTC 3FP7E 5ESBA 4O3TA 3QTVH 5C1UA 2G5NA 1GMHF 1KYNA 1WYKA 3RMNH 4AX9H 3CENA 1K9OE 5EU8A 4A1TA 4DOQA 1FIWA 4UFFH 4ZAEA 3TVJB 4VGCB 1W8BH 1EAWA 1TBZH 1SQOA 3OSYA 1FN6A 4A5TS 4AN7A 2ANMH 2BD4A 1BMMH 4GPGA 5FPYA 1BHXF 1SVPA 4INKA 4H4FA 1G3EA 4F4OC 3MNXA 4CBNA 1S6HA 4IMQA 1DY8A 1AD8H 2CMYA 2AGEX 1KXCA 2A7JA 2P3FH 1W12U 2GV7A 5DO4H 1J8AA 3V7TA 3D65E 4SGAE 4VGCC 2QC2A 4BTIB 1GBEA 7GCHG 3T25A 1YKTA 1AU8A 4LZ4B 4CHAB 1FMGA 1K1NA 3MH4A 2BDBA 1IQIA 4ZROA 2ALPA 3MO9A 3TH3H 1ELVA 1C5TA 3EE0B 4I8JA 5C67A 1B5GH 2FWWA 1V2VT 2O8TA 4NIXA 2P95A 2TGAA 2J94A 3LONA 1MAYA 1QRWA 4WH6A 1HGTH 2A5IA 4ABEA 2QYIA 2BD8A 4H42U 1OWKA 1ZRKA 1GBKA 1S5SA 1WSSH 3SJOA 1UO6A 2R3YA 3RXVA 7ESTE 1ZZZA 4FUCA 1UJ1A 3S0NA 3C27B 5EOKA 4FU9A 5GPIB 2AGIX 5C2ZA 4UFDH 1KXAA 3STIA 1C1RA 3R3GB 1GJBB 1UVPA 1T8OA 3MMGA 2OBOA 3PLKA 1S84A 1DICA 2ZWLH 2ZU4A 2RA0A 1EZQA 3GDUA 1C5XB 3SOSA 5K7RA 1V2LT 2TGDA 3SJ8A 1THPB 3DFJA 3HKJB 3EYDA 3SV2H 1NRQH 1O36A 1GHAG 2HVXA 1NFWA 5J4SA 1ESTA 4KGAA 3LJJA 1TOMH 1HYLA 5DP9A 1TNKA 5ABWA 1J14A 3A89A 1P2QA 1ZPCA 3SNDA 2VINA 4OS5A 1VJ9U 1JOUB 4ISNA 1XUIA 1TALA 2WPJS 1IQKA 2ZFFH 4X1NU 3TJVA 2XWAA 1ANCA 1B0FA 3F1SB 1TNJA 4FU7A 4Z0KA 1DXWA 1TAWA 2ZPRA 3E3TA 1QA7A 5C1XA 3QUMP 1LVBA 1GJ5H 2CXVA 4NFFA 4OS4A 4X1SU 1QJ1B 2SNVA 2ZF0H 1XUKA 2IOTA 3O8CA 1RTFB 1T4VH 1YPHE 1BTZA 1V2JT 1TQ0B 2FOGA 3Q00A 1SGTA 3QLPH 4MNXA 4YTAA 4X2XA 2GMTC 2QN5T 1O5CB 1OX1A 1V2RT 3SZNA 1UCYE 4B71A 1MUEB 2SGFE 1MKXK 1NFXA 1UHBA 3NXPA 1UCYH 1YPEH 1T32A 3PMJA 1F5RA 1T8MA 3UR9A 1A3EH 1C5QA 1TA6A 2BM2A 1WQVH 2JH5D 1SPJA 3SU6A 2ZCHP 1ORFA 1KY9A 1LQDB 1WQSA 3PO1B 5HMAA 2ZU1A 4Q80A 1XKAC 1HJ8A 2ANKH 4I8GA 1W0ZU 3EA9A 2ZDVH 9ESTA 5LPFA 1LTOA 3M5LA 3S9AA 3RXHA 2ZHWH 2SGPE 2FS9A 1TPSA 1UHBB 2BD5A 2FPZA 1BTPA 4IGDA 1EASA 1GGDB 3OX7U 4PROA 1YLDA 1W2KH 3PO1C 1Y5UT 1GI1A 2B7DH 2V6NA 4E05H 1LHDH 1K21H 1AI8H 2BLWA 2O8LA 1YGCH 1AFQC 3W94A 2VH6A 1DM4B 3U8TH 3UWJH 5EW2H 1KXEA 3LC5A 3VB5A 1O2OA 2A45B 2BLQA 3ZVDA 1T8NA 1RTKA 7LPRA 3AAVA 4TPYA 1G3CA 1GGDC 4TYDA 1PYTC 3K65B 1C1MA 5A8YA 3BG4C 3KL6A 4WH8A 4X8VH 3TK5A 4E06H 2ZFRH 1O0DH 1Y5BT 4JZEH 3EQ0H 2XBYA 3UQVA 1K2I1 1W10U 1GJCB 3A8BA 2DE9A 5JBAS 1GI2A 2BDAA 4D7GA 1IHTH 2BD9A 3LH3A 1C5RA 4K3JA 1C5YB 4Y6DA 1ARCA 1V2ST 2TGTA 4ISHH 4DJZB 1O2UA 2AYWA 1O3HA 4DCDA 1A5IA 3BIVH 1SB1H 2FOFA 1KLIH 3ODDA 3CS0A 1V2WT 2F9NA 4LXBH 2BY6X 3N7OA 1MTNB 2W7SA 1P09A 2HOBA 1O5BB 1SGNE 3BV9B 5FBIA 1C2KA 4FUHA 4FUEA 1UMAH 2A32A 1TGSZ 2HRVA 2ZDKA 1BCUH 3FANA 1BJVA 4XDEA 1P2JA 1QJ7B 4TY6A 4ISIH 2BXTH 3RXSA 3MOCA 1IQMA 1UVOA 5IYTA 2G4UA 1UK4A 2FXRA 1V3XA 1VCQA 1QQUA 1EZSC 2GVFA 2XCFA 4NSYA 1PYTD 4JK5A 2AMQA 1VGCB 1O3KA 1ZMLA 1SFQB 1MMJN 2PKAA 2PV9B 5G4BA 3LKWA 1O2KA 3ZZ9A 3SBKA 3Q76A 3RXPA 2UUYA 4NZQA 4Z6AH 2FI3E 4BAHB 2ANYA 2GTBA 1GL1A 3GY4A 1IQJA 2XTTB 4OS2A 1KDQA 2BLOA 2VB0A 4K8YA 3ZZ8A 4AG1A 3HGPA 1HBTH 1UTKA 2A2XH 2Z9GA 1V2NT 3UQOA 2O8MA 3PLBA 1CE5A 1NN6A 1TGCA 3QO6A 4ABGA 1ETRH 2C4FH 1GI4A 2NU1E 5A0BA 3ENSB 4DIHH 1GMDF 1PJPA 2BY9X 1IQLA 1GBJA 2GGVB 1N8OB 5LPRA 3U1IB 3UREA 2ZPQA 1O3NA 4FUBA 1O39A 4UDWH 3L3TA 8GCHG 1HDTH 1YCPH 2OP9A 4ZUHA 1G36A 1QR3E 2ZFTA 1YPJH 2Z94A 1FONA 1WBGB 3DD2H 5HXFA 1BZXE 1F0TA 1DVAH 4YO9A 1VR1H 1GBAA 1EATA 2ZGBH 1CT4E 1SC8U 4CRCA 1O37A 1HB0B 1FPHH 1NC6A 1ELGA 1D9IA 3BEUA 5DP8A 1O33A 1FJSA 1C2IA 4UFGH 1O3JA 4MPXA 3MO3A 1C5PA 4X8SH 3D23A 1YPGH 1W3CA 1GMCG 1WTHD 1JBUH 4UEHH 3SHCH 4TWWA 3EAJA 1KSNA 2P8OB 2R0LA 1AFEH 4JYUH 4NCYA 2FZZA 3GY7A 3A80A 1MCVA 3QN7A 3S69A 5L30H 3VGCB 1O2IA 3U98H 2ZDMA 4X6OA 4OS7A 1XUHA 1DS2E 4Q7YA 1DUEA 4O3UA 1Z8IB 3GY6A 2H6MA 5TCCA 1FN8A 3VB6A 5AF9H 1H9HE 3QDZB 2BHGA 2P8OC 4NA8A 3SU5A 4U30A 1SGCA 2H5DA 2XC5A 4INHA 2ZTYA 1AWFH 1O3FA 1NU9A 1C5UA 4ZKSU 2VNTA 1UTOA 2Y6TA 3GICB 4HZHA 1KXFA 4YLQH 1HFDA 2HPPH 1E34B 2PGBB 1OWHA 3RMMH 3SJIA 1D3DB 4WMFA 4RKJB 3P8GA 1IQNA 3UFAA 2LNCA 2UWLA 1QCPA 1QB6A 4OGXA 3SU1A 3ZZBA 3GCHB 1GVKB 4AYYB 3M3VA 3FVFB 4BAQB 1P2NA 4RKOB 1CT0E 1TNGA 3OY5U 1TPPA 1QQ4A 4DURA 2ZU5A 2P3TB 2F91A 3D49H 4BANB 1J17T 3BTKE 3A7XA 1E36B 5DGJA 1ZTKA 3B9FH 1V2MT 1V2QT 1SGRE 5GCHF 1ID5H 2CF8H 1FY4A 2GDDA 3FZDA 2R3UA 1DWEH 3BTME 4ZHMU 1E38B 2Z7FE 3ZZ3A 1CHOG 3RXJA 3TK9A 3V3MA 2AERH 3UNRA 3MH6A 1AVGH 3SORA 1Q3XA 4JYTA 3Q3KA 1KXDA 1CO7E 1XX9A 5IDKA 4ZHAA 5C5NA 3E91A 4FUGA 3O8BA 1NTPA 1CGJE 2VWNA 3MO6A 3VB4A 2FYQA 2ZTZA 5E2OA 2H9HA 1AKSA 1AB9C 3ZYEA 2OC8A 2JKHA 4X2VA 1ZMNA 3LGUA 4BXWA 4DT7B 3NPSA 1YP9A 1BRUP 1GDNA 1J9CH 1HIAA 1QBOA 2ZGJA 2GX4A 1EJAA 1H8IH 1QRZA 3JZ2B 1UTQA 6GCHG 1P2MA 3RC4A 3SQEE 2TBSA 1TRMA 1SLXB 3T28A 3M36A 3MHWU 5E2PA 1YPMH 3PYHA 3T62A 2A0QB 4DGJA 1C2FA 1GI7B 1Z6EA 1NZQH 2C8ZB 3A7ZA 2XBWA 3PMAB 3RXOA 1NESE 2ZHFH 3GISB 1TABE 3L6PA 3U9AH 1M9UA 2BLVA 2THFB 4BXSA 2A7CA 1VCPA 3SU4A 2NU2E 2GCTC 3B23B 1GCTB 1EQ9A 5EODA 2YOLA 2ILNA 3SUGA 4ABAA 1EKBB 4J1YA 3A83A 1D4PB 1ZRBA 5B6OA 1MTVA 4XBCA 3URDA 3D62A 1DE7H 1GHWH 1N1LA 2C8YB 4YT6H 3SV6A 4I8LA 1CT2E 1KTTB 2UWOA 1K1MA 3PWCA 2W3IA 3TLOA 2SGQE 3KQDA 2GCHF 1ZJKA 2D8WA 3UPEA 2VIDA 1VJAU 1MAXA 1P2KA 3A7YA 3ZVGA 3NUMA 1RS0A 5EPYA 1C1UH 2F9VA 1O2QA 2WPHS 4QT8C 2P94A 3SU3A 2FEQH 1IOEA 3KGPA 1HRTH 5CMXH 1SGIB 3M3TA 4THNH 1JWTA 2QF0A 1LVMA 2G00A 3A7VA 3MNSA 3Q3YA 1AIXH 5HM9A 5DP4A 1IQEA 5FCRA 3SV8A 1OPHB 3BTHE 1UCYK 1BRCE 1ANBA 2H9TH 4XE4A 5EPNA 3M35A 2FIRH 4LZ1H 5JBBS 1K1OA 1SGFG 3RXQA 1L2EA 1DY9A 1G37A 2FLBH 1CVWH 1D6RA 5L2ZH 3ZV8A 4CH8B 4KELA 4MNYA 1TYNA 3RP2A 1ZPBA 2BVXH 5EGMA 2HGTH 1H9LB 1Y3YA 2ZI2H 3RXTA 1ELFA 1OWJA 1O2RA 1ZSLA 1PPGE 2I6SA 3GCNA 4ZH8A 3HATH 4DW2U 5JB8S 1T7CA 4K1TA 3F68H 4A6LA 1ESAA 1C5WB 1AQ7A 1AGJA 4MPUA 4WY3A 2EI6A 4Q2KA 1V2KT 2VH0A 4Q7ZA 2JH6D 3IITA 1DWDH 1BTWA 1GBLA 2EA3A 1GHXH 1SLWB 1F0UA 2CN0H 3A8CA 2ZU2A 1HXFH 1LMWB 5F8TA 5ETXA 2FODA 3E0PB 5LGOA 3LC3A 3SI4H 1HNEE 2ZP0H 3LGIA 1BB0B 3MU0A 1OKXA 2ZNKH 3OYPA 4GLYA 1ZPZA 3BTWE 3SJ9A 2QXIA 1EPTA 2BY8X 1C5LH 1P04A 4MVNA 1PFXC 4LOYH 2ZDAH 1D3TB 1UTJA 3UOUA 1C2MA 3BTEE 1SOZA 1YLCA 1C5ZB 1Z8RA 3SNCA 3P17H 1SHYA 2CHAC 2ZDNA 4FVBA 5FX5A 2PW8H 1O2XA 1CHGA 2BMGB 1P05A 1EAIA 1SG8B 2HNTE 4MQAA 1TMTH 1ELEE 4XOJA 1HCGA 3RXBA 4DY7B 2BOHB 2HALA 2J4IA 2Q1JA 2W7UA 1GPZA 4MDSA 3WY8A 1MD7A 2BB4A 1QGFA 4HGCA 1HAIH 3ESTA 1B7XB 1S81A 1TX8A 4ZXXH 3FAOA 4KTCA 1SBWA 2EI7A 1SOTA 3GCTG 2OD3B 4FUFA 1FDPA 4IN1A 4X0WU 3P8NA 3P95A 4I31A 1MQ6A 3SNBA 8LPRA 2R2MB 2QXGA 3QTOH 4NIVA 1FIZA 1LVOA 2IPHA 1HAZB 3O8RA 2FOAA 3GY5A 4IN2A 1K1LA 2OC0A 3V0XA 2Y82A 2H5CA 4B1TA 1EPTC 4GUXA 3A81A 1O3IA 3CP7A 5GIBA 2GMTB 1TGBA 1LCYA 1A61H 1GI6A 4Y7BA 5L6NH 3AW0A 1ELBA 1MD8A 5DP7A 1G3DA 1YC0A 3MI4A 5C20A 2VIOA 1CGHA 5A09A 1F2SE 4JMYA 1HAVA 1GBCA 1Y59T 2XXLA 2NU4E 1MBQA 2ZHDA 4H6SB 1AY6H 1SMFE 2OCVB 1ELCA 1OWEA 2QIQA 2V3HH 1FY8E 1GWAA 1DWCH 2AEIH 2C8WB 1L1JA 1C2HA 4YOJA 2ASUB 4GCHG 1XM1A 2ZTXA 1O2ZA 4ZKRU 4CRAA 1SQTA 4O97A 4H6TA 2FESH 4YOGA 1LHEH 1P3CA 2TRMA 4FUIA 4X1RU 3QK1A 1GJAB 3PLPA 3NKKA 3W95A 4ZHLU 3SW2B 4U2WA 1EJMA 3QX5H 3T2NA 2UUJB 4NSVA 2W26A 1XUJA 5DP5A 1A0HB 1ARBA 1O3CA 2VIWA 3L33A 1GMHG 1SR5C 1RFNA 1YCPM 3M7QA 4D7FA 4ISLA 2BOKA 1YCPK 2ZFPH 4K69A 1AFQB 1SGDE 3GY8A 1NFYA 2YNBA 1BRAA 4CH2B 1AE8H 1GJ7B 1O2MA 3ZVFA 3M5OA 3T27A 1O5GH 3SI3H 1NRNH 5T6DA 3AAUA 4X8TH 1F5KU 1QL7A 2H2ZA 1MTWA 1C5SA 1TFXA 3BG4B 1CGIE 3PM3A 4R8TB 4MPVA 1PPCE 5T6FA 2A2QH 1EUFA 4MTBA 1A7SA 4CRGA 2FI4E 3PB1E 2WUBA 1O2SA 1BMLA 1U6QA 2VWLA 9LPRA 1W7XH 2R9PA 1CA0C 1O30A 1HAHH 2SNWA 3MTYA 2C90B 2SGEE 1FLEE 4TWYA 5E0HA 5HYOA 2ZQ1A 2XBXA 2PKSC 1FQ3A 1GBTA 1ZSJA 3NCLA 4ISOA 3PMHB 1NY22 2KAIA 4CR9A 2DE8A 2GT7A 2O8WA 1GG6C 1LHCH 1GJ8B 4JZFH 1EZXC 3P70B 1IQGA 4IC6A 3SHAH 2EEKA 3RM2H 2FYRA 3BN9A 1SFIA 5EQRA 5AHGH 4UE7H 3GDSA 1O2YA 1GJ4H 2PUXB 1O3MA 1BTYA 1AE5A 2ZC9H 4AFUA 4O9VA 2A4RA 3NWUA 3OU0A 2A31A 1HJ9A 4AFQA 2HWLB 2FM2A 1TX6A 4AGKA 1O2NA 3G01A 4XBDA 1VITF 5CE1A 2WYJA 1RJXB 4WXVA 3RLYH 4JZIA 5GXPA 5FX6A 3TJNA 1ETSH 2KAIB