1K9VF

Structural evidence for ammonia tunelling across the (beta-alpha)8-barrel of the imidazole glycerol phosphate synthase bienzyme complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
MRIGIISVGPGNIMNLYRGVKRASENFEDVSIELVESPRNDLYDLLFIPGVGHFGEGMRRLRENDLIDFVRKHVEDERYVVGVCLGMQLLFEESEEAPGVKGLSLIEGNVVKLRSRRLPHMGWNEVIFKDTFPNGYYYFVHTYRAVCEEEHVLGTTEYDGEIFPSAVRKGRILGFQFHPEKSSKIGRKLLEKVIECSLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural evidence for ammonia tunneling across the (beta alpha)(8) barrel of the imidazole glycerol phosphate synthase bienzyme complex.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Amidotransferase hisH
total genus 60
structure length 200
sequence length 200
ec nomenclature ec 3.5.1.2: Glutaminase.
pdb deposition date 2001-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00117 GATase Glutamine amidotransferase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1k9vF00
1GGJA 1Q7RA 2AD5A 1BXRB 1PV2A 4ZDKA 3UGJA 4L8WB 1CS0B 4ADSG 3OT1B 5IP5A 1KEEB 1I7SB 3SOZA 3R74A 3ZR4B 5LIRA 2VKTA 5SYAA 1T0BA 3F71A 4ZDIA 4OIFA 5BV2P 3TTTA 1GGKA 1PDVA 1QDLB 2H2WA 3F5DA 2ISSD 2ZUSA 4JQSA 1GGHA 1WL8A 2OR3A 3PQ6A 2VPIA 3B36A 3BHNA 3ER6A 4MGHA 1P81A 1P7ZA 1R9GA 3KKLA 1IPHA 4WINA 4I4NA 2NV0A 1K9VF 3WFZA 3UK7A 5DFAA 2VRNA 3EZGA 4L8YA 4P34A 4Y0NA 5E9AA 3L3BA 3TTWA 3PQ3A 4OQ4A 3NOVA 4UZSA 3TQIA 3PQ8A 1T3TA 4GUDA 4MTCA 3UOWA 4ENUA 4I2NA 2ZUUA 2YWBA 3SF8A 5JZMA 1P80A 4L78A 4Y1RB 1QVZA 4BIMA 3OT1A 4Y1GA 4B31A 1G2IA 1S1MA 3TTVA 4RKYA 4Y1RA 4S0ZA 3P9PA 1QF7A 2R1TB 4I46A 4B7AA 4HCJA 3B38A 4ENSA 3EJ6A 1C30B 4LGYA 4WXYB 4UCFA 3R76A 2AB0A 2ZUVA 3TTSA 2ABWA 2D7JA 1OX5A 4Y1FA 4K2HA 3TTYA 1P7YA 4GE0A 3EWNA 4B40A 4BTEA 1QVVA 4QYTA 2R1UA 2RK4A 1JVNA 1IZZA 1GPWB 1O1YA 2YWCA 1OX4B 5SY9A 4UNIA 1ONSA 2RK6A 3L18A 3NONA 1OY1A 2NV2B 3L4EA 2GHRA 3NORA 2R1VA 3FIJA 2VDJA 4Y1EA 2V4UA 1KXJA 3L7NA 4OGGA 1KWKA 1KWGA 5SY4A 3CNEA 1KA9H 1J42A 2VXOA 1L9XA 4E5VA 4ENPA 4OJYA 1GGFA 1U9CA 4QYXA 4E08A 2R1TA 1VCNA 2R1VB 1CE8B 1JDBC 1VHQA 3NOOA 4L8FA 3UMMA 1GPMA 4P5PA 4AJ9A 3TTUA 1N57A 1SOAA 4P36A 4UOZA 2IUFA 2W7TA 3CZ9A 2RK3A 1OX6A 3PQ4A 3SF8B 4PXYA 4ENQA 1CF9A 1C3OB 3TTXA 4P2GA 3UJNA 2XF2A 2LXNA 3PQ5A 2YWDA 1IZYA 4LRUA 4XLLA 1PE0A 4L7QA 4R7GA 2FEXA 1VCOA 4OGFA 1GG9A 2ZUTA 3P9QA 4B2YA 1OI4A 4AUNA 3PQ7A 4MNTA 4N12A 2WJZB 5K4AA 3CYFA 4ENVA 4ENRA 3NVAA 3ZJ5A 3PQ2A 4RKWA 3NOQA 3P9RA 3M3PA 1M6VB 1T36B 1OX4A 4L95C 4AULA 4BFLA 2ZUWA 1Q2UA 4ENWA 3ZJ4A 3FSEA 3MIIA 1GGEA 3GRAA 3CZAA 3D54D 1I7QB 4N0MA 4ZDJA 1UCFA 2A9VA 1PDWA 3VU3A 3CY6A 3N7TA 4D1YA 1I1QB 3EN0A 4AUMA 2YWJA 1QVWA 3MGKA 4OFWA 3RHTA 3BWEA 1FY2A 4UOQA 3B3AA 1FYEA 3EFEA 4B5KA 3P9SA 5SY6A 4AUEA 1VCMA 1SY7A 3R75A 4ZGGA 5JZOA 1A9XB 1P5FA 4GE3A 4ENTA 2GK3A 1QWSA 4P35A
chains in the Genus database with same CATH superfamily
1N3LA 4QT0A 5LQSA 1NAHA 4JZKA 4RJIA 3W6UA 3UMYA 5H16A 1T9GS 2VLBA 4GMDA 2VYCA 4QWMA 3LTEA 4XH9B 3W5SA 2Y1CA 3E53A 2GF0A 4MP6A 5JAZA 2LVBA 3RM3A 3MJRA 5JJIA 1UWLA 4OIFA 3RAPR 3KJNA 4RVUA 4RZ3A 4FMDF 3FMGA 3FYSA 5FWAA 1DJOA 3V1NA 4FQ8A 1H2BA 4QM6A 3IIMA 1A69A 5GIPE 1U8CB 1NVVR 4FEEA 3QEBZ 2E4VA 1H0RA 1U4OA 3ETCA 1R4AA 1S8OA 1RPJA 3JAWB 4BJ5A 2WKPA 3JD3A 4RHFA 2D13A 8ADHA 1P91A 1I1HA 4OQPA 1KDRA 4FS8A 3BFPA 1D04A 3LUKA 4G6ZA 4ZZ2A 3E2IA 3SC2A 4D0GA 4YRZA 2IUEA 3D7RA 3GR6A 2FOXA 1XAIA 2NUTB 3RRBA 3G0BA 1VBKA 4MUGA 4ZZIA 4QXAA 2G1AA 3TW8A 4MVJD 3R44A 4I0WB 4EK9A 3QW4B 1VA5A 5IJ0B 4FGWA 1O7JA 2RGUA 4KI7A 2WSLA 3GCDA 3CFYA 2XAAA 5FH9A 4S0ZA 5J43A 4LJSA 5AKJA 4IDNA 3DV2A 5IKPA 1YJ8A 1QE0A 1MVOA 1KDPA 2RAVA 4G5XA 2QIOA 3DWIA 1U2QA 3GFRA 1ZBDA 4HEHA 1E2QA 1UZAA 4WD3A 3C7DB 3BIXA 4A6XA 1MJFA 2FPSA 2XNDD 4QYTA 3UXYA 3EFBA 4PX9A 5CFZA 5JS6A 2YXEA 3E3LA 5DT2A 5B1EA 1FZTA 3UAXA 4WK4B 3M89A 4QFMA 3KSZO 1UKZA 4R0MA 1K5DA 1WMEA 5E6RA 4AJOA 1M3SA 3ZE9A 4CLDA 3HO8A 3IUBA 4R8VA 2JA1A 3FDFA 4RD6A 2WQ7A 4FKZA 2QBYB 3CSSA 1X7XA 4PAGA 4DQXA 2XRFA 2UVQA 5D1NA 2DBZA 3OEYA 5D01A 2BAGA 1E6CA 2JIMA 1A8QA 1X3SA 1OIXA 1ZIOA 2VJQA 3D6HA 3G7SA 1UINA 3OH8A 4IVPA 2IBSA 2H85A 2IE8A 1OILA 1XKQA 4MMXB 4TS4A 4M1MA 4RYLA 2VYVA 1IBLB 3C5CA 1OR8A 1OWNA 2HV8A 2IHUA 2OAQ1 3PEWA 1W25A 1CVLA 2CW5A 4Z1MA 3GROA 4MO9A 2FEXA 2CDRA 2CVZA 3Q5DA 2KE5A 5HKLA 4UAVA 4EMBA 4FP9A 4MV4A 1W29A 4ZDWA 3RG8A 4AUNA 2PUEA 4UTZA 2NMVA 1T2DA 2DY1A 1Y80A 4PEVA 3P19A 5MFPA 1Z0DA 2ZJ0A 1OXXK 1WW8A 4NE2A 1FFXB 1TQHA 2DJIA 2IYUA 3FFAA 2PKYX 3LP5A 3K6RA 3CBGA 5FUWA 3EEFA 4J1TA 4E46A 5IDQA 2C95A 4L3VA 4JUIA 5LYJA 3LOPA 4B45A 2XECA 4LQDA 4EX7A 1TO1E 4GHWA 1LJ8A 1LNSA 4HF7A 2YWJA 3RSZA 5H1YA 2HCTA 3CEJA 1GYQA 2JLSA 5P8WA 3ADCA 1ZONA 2AGVA 5JXJA 2QW8A 2C5EA 2I76A 1EVKA 3A1SA 1HEUA 1IZ7A 3L4SO 3R4VA 1NVKA 4HNQA 1QR2A 4R4JA 3M3HA 2OLEA 2GK3A 3A1NA 4BLOA 4IL5A 1I6MA 2AOTA 4J7CA 5FLXA 2C1XA 2J3HA 1DEKA 4FDLA 1XPOA 1QG0A 3OOEA 4WBNB 1HE4A 3EEIA 3ENQA 3IOCA 3Q7RA 3WGNA 3KVVA 5K4HA 1P2TA 4ZOAA 5DWDA 3CVXA 3AEQA 4YLGA 1X7YA 2GPTA 3G8YA 1DC7A 1V11B 2FPWA 4Q1VA 4CN8A 2Q2WA 2QV7A 2EFEB 2FSHA 2XZTA 3DL2A 3PFNA 4BLUA 4EJ2A 4JC5A 4UMVA 2W00A 4FINA 5C5EA 5HRAA 4H7JA 3AYZB 3FGOA 3BRQA 1DIHA 3L1KA 3LKZA 1Z5ZA 2QLLA 3F5QA 4R9UC 3DZKA 4MV1A 1R66A 4D5EA 3NAGA 2GBGA 1WULS 1FX1A 2ZSEA 4K6FA 1MEEA 3ASVA 2ZRGA 1LI4A 2WG0A 3FCEA 2FWBA 1MHTA 3DNPA 4BASA 2XTNA 2V5AA 4I2NA 4JLDA 3UUEA 2XKJE 4JA2A 4LK2A 4H3KB 2O7NA 1YCGA 3OT1A 1ZJZA 2QRPA 4IYJA 2VJLA 4J0HA 3KEOA 1RI2A 1C0KA 3MS4A 4KWIA 1N4AA 4EF5A 1U0FA 4DPMA 1KO7A 3HY6A 3HKDA 4COOA 1FYWA 1ZSNA 1S0UA 5BNTA 3ZGLA 3V8NA 1AUOA 2CJXA 1JJVA 3C6ZA 2JIZD 2O1XA 4ZI7A 1PR6A 1SQ0A 3DZBA 3INNA 4DMGA 1NBOA 2NT3A 1QZZA 3QEKA 4WNIA 2O8DB 2I4MA 3MUNA 1M2VB 4AWAA 3S7TA 4DCVA 1N4DA 3N75A 1C3VA 3L7NA 2YY6A 1QH1A 1MIOB 1KDOA 5LSAA 4OMUA 2ZT8A 5TXGA 3ZQ6A 2PLWA 2CZQA 1YDEA 1X1QA 2D5LA 4FLEA 3RFXA 1FYDA 4PX2A 2B4KA 3PPYA 1QO0A 2OY0A 4TN5A 1G8SA 3FGZA 3NATA 4F3RA 1RC0A 1QFJA 1ECBA 3ELBA 4E88A 4F4CA 2J0UA 3CH6A 2XYRA 5JHHB 4TYNA 4W9MC 3VR0A 5B37A 1FE8A 2NTVA 3S5JA 3F0TA 5ALPA 3O5AA 2CVPA 4EI7A 2V5UA 4XYGA 4NKRA 1H3FA 3OQHA 2ONJA 2HUNA 1QDEA 4ZVLA 2I3DA 4YT4A 5L3SB 4L16A 1XCLA 1X0XA 3HJBA 5DCUA 5JNRA 5KWJA 4G9BA 2I87A 1M33A 3GLKA 3OD1A 2IYNA 4XJSA 2QOEA 4DF3A 1TCAA 1XGKA 5LWQA 2WDPA 3AF1A 4ZVKA 2CNNA 3TFWA 3AVPA 3IP9A 5C8DA 1WXEA 4MGEA 1VL2A 4WZAA 3JARA 2HHJA 3OIFA 2AN4A 2GPNA 5L3QB 5AOVA 4DCOA 5EVJA 2OBYA 1NY5A 4N41A 1U80A 4OSPA 3N53A 1NJSA 3V55A 1OZ0A 4TTPA 3LKBA 4JI6B 2IWHA 1FRQA 3T38A 3FMVA 1MZVA 1WBBA 1N1MA 4XOIA 4RDIA 3TLCA 4C30A 3A4YA 1E1MA 1LFAA 5JZOA 5ETJA 3GEMA 4EAAA 1KEPA 1YBFA 2H1SA 3G5LA 4KIUA 4KC0A 3WLLA 3CPHA 1LC0A 3FNBA 4C14A 3SJUA 5BV0A 1Y6RA 2QJRA 2FOLA 3LF2A 4HH3C 1QGED 1MLDA 3WBKA 1JR3D 2O3TA 1HGXA 3SQXA 2BKVA 2CXTA 2ODNA 2IHKA 4JUFA 4ERNA 3H4VA 1Z12A 3G8AA 5BV2P 4OL9A 1M7BA 4C0QC 2KX7A 2D1YA 1QAMA 3H9BA 1TPYA 3MUFA 3UXHA 1XMVA 2HSJA 3VSDA 1WL8A 1RAFA 3UN1A 3H0EA 4N8SA 1Z6YA 4UHKA 1UQRA 5EQTA 3IAM6 5J1SB 2J5RA 3R09A 1CUHA 1YNOA 5B1HA 3U7FB 2VBGA 1KOJA 2P62A 3BDVA 2ZYRA 4WNCA 5D1HA 2C03A 1DAIA 4PTZA 3W7AA 1UEXC 3FCSB 2CLLB 1RM5A 1T9ZA 4UDOA 5B4VA 3NZEA 3DM5A 4ENUA 1XXHA 2DG2A 5I01A 3IURA 2PL3A 2QRVA 4YDSA 4CM6A 2G88A 4B6RA 3N2ZB 4IILA 1CJKC 4B75A 3RC7A 4TSFA 1D07A 3FOEC 1N92A 3IELA 5JAMA 4N5LA 3E5RA 2IDZA 3GOQA 3WYCA 4TWBA 1BGWA 2H0QA 3W8NA 5LJIA 3LL7A 1JU9A 3DCJA 1HLDA 1P9NA 5K8UA 3PEEA 5J59A 3K0HA 3AP2A 2XJ4A 1NOKA 4G97A 4K6OA 3WNVA 3GEIA 4Q9LA 5DPMA 4R5MA 2HRQA 2A33A 3W2GA 5CX4A 4ZO8A 5ALVA 1BRMA 3USES 4UDYX 5EE9A 1FYXA 4X24A 1KKLA 3SIPA 1M74A 4JH0A 2C5SA 3R7NA 5A62A 5EP4A 4KX3A 2R0QC 5EHNA 2GTHA 3HBNA 5TGTA 2FMXA 5EOVA 3RVPA 2AF4C 2FPKA 4M1TA 3ACDA 4LRQA 1QZ3A 4C3OB 2NYUA 3EF0A 1RADA 2JLUA 4F8YA 1U3UA 1Y3FE 3W9BA 2CSXA 3ZQJA 3K0CC 3EBPA 4JASB 4U5QA 1T6XA 5U4XA 3WI7A 4JEUA 1JDVA 1M9NA 5LD2C 3KUXA 2J1LA 1QYCA 5FORA 1GL7A 4BP3A 5ES4B 4I1OA 5I5GA 3M5WA 4UHJA 5EE0A 2W4IA 1FLAA 2NYVA 2PYDA 4YUVA 2XZLA 1VIDA 3F97A 3R0XA 1M54A 5MN5A 2P9HA 3CLVA 4WXMA 3Q7TA 1COWA 3OQJA 5K4AA 4E30A 1GU7A 4RKWA 2FZ4A 2W71A 3TZLA 4DCCA 2D2IA 5T67A 2V6BA 4J9UE 2ZUWA 3RDPA 2QU8A 3R5XA 4G8CA 5BT8A 1Q19A 4I5FA 4QVIA 2VOJA 2GN6A 4GG1A 5D6OA 2LZ0A 3EMKA 3ILSA 4JX8A 4PTYA 4ZQFA 2FJPA 4UOEA 2NQ8A 3NTXA 2QVXX 2WJ3A 3K0FA 4DJFC 3QE2A 1FUYB 2IUYA 2GSDA 4TYPA 1NL3A 3A1CA 3OPYA 4J3NA 5INTA 2VUHB 5FDFA 4TYMA 4PPNA 4AAYA 2JFXA 1IHPA 3FKSA 1DQPA 2GASA 2NSHA 1RKQA 3O91A 2M1XA 5D86A 3INGA 4JI4B 2CLOB 1JN0A 3TRIA 1CY0A 4MYHA 1QOPB 2OM6A 3GFPA 3I04M 3WLJA 1F0KA 4L8WB 4N76A 3DM9B 3DAOA 1DWUA 3BCUA 1TT7A 4EB0A 3AB3A 4YV1A 2JFFA 4ND7A 4TLLB 4Y7CA 1R0LA 1T3LA 3EXEA 4TV9F 4F9EA 4HYYA 2ODPA 3D7MA 4FHDA 4J43A 2PS9A 5EIBD 3VH1A 1SZCA 3KKNA 4EMTA 5AW6A 1DJLA 1FZQA 1NWCA 1VRWA 4EELA 3EZ2A 4U5XA 3B70A 1N6KA 1OJLA 2ZRLA 1UM9A 3V4OA 1AMNA 1XVVA 4MGHA 3ROQA 1ML4A 1Z0ZA 2JI9A 2CLEB 2CK3A 4EEXA 2UXBB 1GZ3A 1WQ3A 3OCJA 3VMFA 4EW6A 3V8PA 1UPBA 4J03A 2P35A 3AVTA 3DFMA 1EVZA 5H4GA 4IVNA 1ULBA 3T4PA 1U2TA 1W2HA 3L6BA 5B6PA 2X6RA 4PYLA 2OYCA 3DS8A 4RHCA 2NNWB 2ZYHA 3O8OB 4Y9RA 5JWRA 2YNMD 4F8EA 2Q7OE 3A1VA 2I4TA 2FZ5A 2F3UA 1Q1ZA 4FNAA 2BBTA 3WSWA 1N77A 1CR2A 2Z9BA 5CIWA 1ZH8A 4NCBA 3PYMA 2HM7A 4GI1A 2MDTA 1NLMA 3EQ8A 2LE0A 1GQYA 1HYEA 1ZI8A 4DANA 4I5GA 2JCBA 4BNWA 4Q4JA 2XGOA 4E14A 4OX9B 3LFHA 3MSCA 2AVDA 2QRJA 3SYRA 1ZK0A 3KPVA 1NQUA 4JBGA 3A1UA 4LHWA 1ONNA 4B3GA 1UJ6A 4WY8A 3T5DA 1ISPA 4HOYA 2VDOB 1LEHA 1I3MA 1IEXA 4FBLA 4XW2A 4BWGA 1XP5A 3GLUA 3FKJA 4ZKDA 4GMKA 5EHZA 3OUUA 3K5IA 4HD8A 2P2NA 3ZE8A 5MGNA 4JJFA 2PGLA 2BI8A 4XASA 1XZQA 4TM8A 3WY9A 2R1TA 5DTRA 4KXWA 3FCYA 5KTKA 1KARA 1XNJA 4CCWA 3KR2A 4L8FA 4ZVSA 1D2MA 1L4FA 1VPVA 4RTPA 5L6MB 2GUWA 1NI3A 1Y5IA 1HDZA 3ME5A 4G1VA 4N39A 4UBMA 5G53C 2PUCA 4POAA 2XWSA 2FR8C 3KAQA 4PZ0A 1VSBA 3WSVA 3G7UA 3MWGA 5T4EA 2PXXA 3CIOA 4J9VA 4EABA 1E6UA 1MTOA 2JF0A 5EJ2A 4MWTA 4JP5A 4FVTA 3ZZNA 4BKUA 2RGBA 1OXVA 3SBDA 3WGZA 3GLIB 2OHFA 2GEBA 3JRNA 1OC4A 1D2HA 1K75A 4HN2A 5C1OA 2J41A 4NAVA 4OQYA 1J49A 3Q2IA 4AULA 2VPXA 4DIOA 5KC8A 5ED0A 1GDDA 2PBLA 4CMEC 2EEPA 5CJ2A 4Y6GB 2GWHA 5HBRA 4QLOA 1QFXA 3VU3A 4DA8A 3K0SA 5GJVC 2G72A 4IIGA 2A5DA 1XVUA 4WFQA 1CF2O 1UANA 2F55A 4JJ4A 1MX3A 4L0CA 4FMPA 4JL5A 4NCNA 5AW9A 1EAYA 3PLRA 2WWWA 4PXAA 1T5OA 1AQ6A 1G9SA 6REQB 2ZXUA 3HV0A 1CY7A 4KO8A 3O92A 3EBLA 3OUZA 4G86A 1RE1A 4JUBA 3DYVA 1QU3A 2OBFA 4R2IA 1U3DA 2R47A 2AG5A 3KJXA 1AXGA 3C5VA 3CNQS 4QZVA 2GCEA 2VEOA 3M6AA 1X7DA 2X15A 1YZUA 4BNGA 4KO4S 5K8CA 2UU9B 5DSZA 3F71A 3LT5A 5FRDA 2JRLA 2B8EA 4Q4HA 2WW8A 1C14A 1Z4KA 2OHGA 3B5EA 3EFOA 3UH0A 2POCA 4MRAA 3T12A 1DBQA 2C77A 1DDGA 4PGHA 3I52A 2M98A 4KN5A 3CPSA 1EFVB 5KOHB 3JQGA 3KZCA 1SZPA 3LPCA 4LQ4A 3UCFA 1VM6A 3HKBA 1I0ZA 3SC2B 5JBNA 3LRXA 3WFZA 1TCBA 2QPOA 5BN3A 4KNYA 2V0GA 4YDHB 5ALUA 4NFHA 3KETA 1SJ9A 3HBAA 3LSYA 1OAKA 3E9NA 2YVUA 3PHLA 3PIDA 4FFSA 4O2AF 3WRYC 4ZREA 4Y2UA 1D2NA 2H17A 2I78A 5CDUA 4GP6A 1UC9A 4RPGA 1CYEA 4MDEA 4U8HA 4HO1X 1H85A 4IXWA 1A5TA 1F6DA 4DJAA 2ROQA 1R3DA 3H0KA 4RHYA 1LD3A 3RKRA 5BN3B 5CW1A 3OJFA 4KWHA 1IM2A 4G0MA 3AJRA 5CA1F 2JDID 4PLWA 1THZA 5B7NA 3E4DA 1LV8A 1QC5B 3I76A 3QLTA 3W2FA 1F6WA 3ZIAA 3VDXA 4KIGA 4YRDA 2PUGA 3SI7A 1G7SA 3DDUA 4B6GA 1OWLA 4PPQA 4OH7A 3P1JA 1T1SA 2ZVQX 2E89A 3O3CA 4KGZA 2FE4A 1ZMBA 2WWIA 3K8OE 3DAFA 2RI6A 3DOHA 4RFLA 3TMYA 4U4AA 1U8AA 4EFLA 3QOFA 5UKDA 1XVIA 3Q4GA 2GLXA 4PZUA 3D3QA 2BYTA 3T1NA 4BMDA 3QX3A 3RAJA 3OZFA 1YC5A 3C6MA 5LQJA 5TVKA 4AS1A 2QUJA 2J3JA 3JU3A 5KYVA 3TDMA 1UBEA 3OCYA 3PE6A 1HT1E 4JJ8A 1UPUA 2Q5OA 1Z74A 3CW9A 4HYTA 2XI4A 1HBJA 4F3NA 3SCZA 4YRGA 2A78A 1PV4A 5ESWA 4HNGA 1EX6A 1QRSA 4ZAVA 4PN7A 1QB8A 2O52A 2XQKA 5F77A 4AJ9A 4C1NA 3BE5A 3LDFA 4ZCTA 5AW4A 3KXDA 2VSFA 2C61A 2F9LA 1Q20A 2XF2A 3NNSA 1RPTA 1Z18A 4GPIB 2Y2VA 5LWHA 3CM0A 3IPAA 2GS9A 2VOEA 3NEYA 3URKA 3UFXB 3PVSA 1DAHA 5ALGA 3EQ7A 3ZLUA 3G6WA 3JTMA 3KXPA 4XSVA 2WM2A 3V1TC 4RZXA 5F35A 4OOFA 4WE3A 5GJWC 4CHGA 2WAMA 5ADHA 1BH2A 2A6PA 1KMHA 2M32A 5EZ6B 4CTKA 5ICCA 4LZOA 1ZRHA 3ZI4A 2QMOA 2JJYA 3UOAB 5JNSA 2CEKA 3M33A 4RCZA 4B8ZA 5EAIA 3F47A 4Q47A 4ZFNA 1CUJA 2XT9A 1QIFA 1T8TA 1H93A 4IDBA 3SHTA 2CKDA 3LZ6A 2PAFA 2X40A 1Y8AA 4IUDS 3U5TA 3TUIC 5DB4A 1ZN8A 2EWWA 4QX6A 3D6NB 5BSGA 4KR7A 3KX2A 3B3AA 2DCMA 3TM4A 4HPJB 4YFVA 3P7MA 4PGGA 4ZOLB 1E4EA 4KOEC 4AY5A 1TQ4A 1VC2A 5KINB 4JYMA 5C52B 3BKXA 2HLHA 2AZXA 4FW9A 3V1LA 1CQPA 5BOVA 3H75A 3K0KA 3UJDA 4NOKA 2Q41A 1P2DA 3OJLA 5E6RB 1E2UA 2O1WA 3QJYA 4I3HA 4CLHA 4F2PA 1O87A 4H7PA 4D8WA 1T0BA 3ECCA 4B6OA 2OCYC 3M6VA 5BVHA 5FT9A 2F43B 1IN7A 4Z0HO 1KVUA 2KB0A 4YCMA 1ZQ9A 3WLQA 2PKCA 4CODB 3AHFA 4IZ6A 1J09A 3ZLTA 5I9LA 3W4JA 2F7SA 1XZPA 1A8PA 1T9BA 4YRIA 1X1RA 1Y5MA 4E94A 4YRAA 1GVHA 3ORHA 2QJOA 1A88A 3KR0A 2X3UA 3Q6MA 1DHRA 5CM9C 3WK6A 3PFGA 4YRPA 5LU8A 2PUBA 1OA1A 1ULUA 3LY8A 4MKRA 4PFSA 3TKLA 1W1UA 3VSEA 2AZ4A 4HWRA 1EFDN 3C24A 2X1HA 2YW2A 3OHPA 4Q24A 4QVGA 2VLIA 1G8GA 2P0YA 5BUCA 4H16A 1O95D 3KHKA 3W3ZB 3OM8A 5FP0A 1WA5A 1CNEA 1GDHA 3E3MA 3VNQA 3QK7A 1Z7GA 4QTXA 2H0AA 3BMNA 2EL7A 1OAOA 1C2TA 4IIJF 5MDHA 3KWMA 4P22A 1ACJA 4K2HA 1NT2A 5DZSA 3TTYA 2ZU6A 4UVGA 3I3OA 1PHRA 2VHUA 3CC8A 3UFXA 2DC1A 3QPCA 3FR7A 4HRYA 4IJMA 1JEOA 4NOLA 1W0KA 3CX7A 2DU8A 1PK7A 1NPDA 2B9VA 2P7IA 1ISIA 3GGOA 2WZCA 3HHEA 3W1WA 4BNMA 4OXIA 3UT5A 2HNBA 3JZAA 3HKCB 2HAEA 2OE2A 3QELA 1GFZA 1L7QA 2ATXA 1QFZA 2QD3A 4FR2A 3GLFB 2F3QA 3CRQA 4DAOA 1AMUA 1DARA 2J9RA 3EZLA 4P5PA 5BWNA 3ZD7A 1L6RA 3QWBA 1PFVA 1E6MA 1QHHB 3EUEA 4DW8A 2QG4A 1JFRA 1G2QA 1CYDA 1A8IA 2SCUA 4G9GA 1EM6A 1SUBA 1H1TA 4GLBA 3WYBA 3MTGA 4CL8A 4ZHQB 2H6EA 1FFHA 4IGIA 1FPQA 2W2KA 2JS7A 3ON5A 2JFOA 4BVGA 1MQ8B 5KHOC 1UT8A 4QGBA 2WSBA 1UL1X 2GD2A 2ZR9A 3E3OA 5CT5A 1BU5A 1DWOA 4BUZA 1DWPA 1Y7TA 1YGYA 2QX8A 2Y1GA 5PNTA 5FTLA 1ZA1A 1JFSA 2MR5A 4JLOA 2PG3A 4XDHA 3VO1A 1Q22A 3QEAZ 1BRTA 4FFMA 2P40A 2H8GA 4YRJA 1DEHA 4MRMA 1ZEJA 2Z8YA 4ESHA 3ZTYA 3VYUB 4E11A 3QWHA 1FEZA 1I10A 2GN4A 2JLZA 121PA 4CG2A 2Q29A 1E6KA 1UT5A 2XB4A 3MTDA 2PH3A 2WYOA 1QQ6A 4QELA 3U7IA 3TNFA 4YUXA 5IKOA 5IT4A 2FSUA 3FSRA 4J1TC 3DOUA 3T4UA 1O0CA 1FP1D 3RTAA 3H4IA 2HJRA 3K53A 2GMWA 1LFDB 1XDSA 4XVUA 1MG0A 4KDCA 2ETXA 3OZRA 1HLGA 1AZTA 2XMGA 1SVNA 1TJ5A 3C97A 4N0MA 4PLGA 1QWSA 1U11A 2P9GA 2WF7A 3VHXB 3W5VA 4BGEA 4D9HA 2EW2A 2FG7C 1LZLA 3MQFA 4Q4CA 4NG4A 5AW3A 1NJ5A 2PVPA 2LKCA 1K8QA 4TSRA 3C6KA 1OZFA 2C31A 5GAJA 1TZMA 3EVAA 821PA 3TG8A 1XTZA 4TTSA 1M76A 3JSXA 4O08A 2O5CA 4X8LA 5FNVF 3VPSA 1ID1A 3A6PC 4M1OA 5DBFA 3EYAA 1G98A 1PL8A 1E89A 1OXKB 4MJ3A 3TQSA 1P7ZA 2VT2A 2VJCA 2P1DA 2O0MA 4RMHA 1M6EX 3L7AA 4OU5A 4HGRA 1MX9A 3G82C 4Y0VA 5IFKA 3FIUA 3LM8A 1PKXA 1PT7A 3MNFA 1V45E 1XZKA 5JARA 3Q11A 1M1YE 2P65A 2EG9A 4G85A 4OV6B 2A7XA 2ZBFA 5LZ5A 4KX5A 4ERXA 2CD7A 2OZLA 4RDXA 3VGPA 1NG1A 3EQ9A 2ORWA 4GR5A 2Z09A 4DNXA 2J9XB 1MB3A 4LGCA 3G0GA 3LVQE 5IVPA 1RU3A 3VR1A 4DFDA 1P73A 1QMGA 2OBLA 3EGCA 5JI2E 5JNUA 2O3SA 1Z8NA 5C35A 5C5CA 5KTOA 1A8UA 2FNAA 4IHJF 4MKGA 4NONA 2YZNA 3V7NA 2N9UA 4WK6A 3EIHA 3H7AA 1EGAA 2VSNA 4WKNA 4IINA 4E5PA 5HJEA 4EHLA 1SVMA 4A36A 4FMDB 4ETMA 4GL2A 1NW7A 4I8XA 4IDHA 1X7XB 2ACKA 5AVOA 3KQSA 2EKDA 4TV9B 3ZKAA 1KSJA 3L93A 2YN2A 3KD3A 1I2DA 3LSTA 4DLBA 4JDUA 1ZI9A 4EJ6A 1YUMA 3UM9A 3MWDB 1J70A 4MW5A 3IQXA 4PQRA 1T2VA 5GADl 4B71A 2OESA 4OMFG 5IYZF 4ID9A 4REQB 4Q9JA 1LPOA 4GRAA 3HZRA 3LS2A 3QNMA 5JCOC 4RNCA 4J90A 5CA0A 1I5OA 2GETA 3CZ9A 3B2EA 5CT4A 4M87A 4ENQA 1CULC 4UBIA 5IHXA 4UNNA 2NT4A 4TZKA 4EKIA 1B3RA 4YDQA 1HA3A 1XTBA 4RMGA 4PIVA 4QA9A 1U5BA 1H65A 2JAXA 421PA 1O97C 2P41A 4Q9KA 3DP9A 1URPA 2Q1XA 4R1QA 4D46A 2V7TA 5DK4A 1C9NA 1XJCA 1EDBA 2ZKIA 1FTWA 1PSDA 4PIPA 2OV8A 4ZTZB 3U9SA 1L5QA 4YT8A 2XMCA 4KO3S 4MARA 3RUFA 3BWDD 3RODA 4J0GA 4P4LA 5JWHA 2O50A 4L15A 3SSNA 2W4QA 4RJTA 3DE4X 3HABA 2FF5A 3BSWA 5KOJA 1QHGA 3N05A 3J7AC 1EWKA 4FX5A 1ST3A 4E15A 1K86A 2Q6OA 4AUKA 1C0IA 2GZ3A 4XGRA 5B2FA 1PYOA 4DR1B 1PR2A 4M9SA 3WIBA 1Y4AE 3AKYA 4WLUA 1JVSA 4AJKA 4G0UA 2GZ1A 1WRBA 3DKPA 3WHPA 3DMNA 2QR5A 3MJ4A 3CGWA 2B8WA 3GFTA 3JQAA 1R8YA 3P4YA 2ZYIA 3F5SA 3PA6A 1QYWA 1UZLA 3L7LA 3D8RA 4YUAA 3IBTA 1GR0A 2GD0A 4QAQA 4RZ2A 4RYDA 2IPMA 2PSHA 4G01B 3EXEB 5AKKA 3LOQA 3AVQA 4WPGA 2E6UX 1NPTO 2ILTA 2PGXA 2R6AA 3LHKA 3VNAA 1U9YA 1BDIA 2FQYA 3VZRA 2C7VA 2HT6A 4HAXA 2ZRDA 2EDCA 2WRZA 1TM2A 2F6RA 2QS9A 2Y3IA 3CRRA 1TI7A 3KYCA 1GGKA 3W6NA 3SLRA 1BNCA 3CMCO 1C0LA 2WMYA 1AN0A 1NE7A 2QRMA 3GF4A 1TM1E 4JAVC 4KAJA 2ZUDA 2QTNA 1C30A 3ROPA 2H5EA 1C1DB 3NTVA 1FP4B 1I33A 3KHTA 3AJDA 1R16A 5DHTA 5LBUA 4G0NA 1OMOA 4EGJA 4WFJA 3BE6A 5DFAA 4YI5A 1ZHOA 3ZWDA 2OHOA 1YRWA 2BMDA 2WVGA 2JHPA 2LP4Y 3EEQA 3PKIA 2WTXA 3DJYA 4MI6A 1L5VA 5G1PA 4EZEA 5IPFA 2BTQA 1FFYA 4J7XA 4L22A 5FWXB 1RD4A 5C46F 5J2UF 3GN1A 4M55A 1CZHA 1C1DA 2JLCA 1IPEA 2OCPA 4HEJA 3W5AA 2JGIA 1P0QA 2EJBA 3JATB 5TQ0A 3SZ3A 1YB1A 1WXGA 1GFSA 1GQQA 2X2PA 4QBIA 1CEXA 3QYAA 5DCWA 1E3QA 3OWXA 1CZUA 2VJAA 3L04A 3OFJA 4F2WA 2OT3B 1QRRA 4Z99A 1BE0A 2NO6A 1DKRA 4YBZA 1X8XA 5EJGA 5JCZA 5I4KA 3A1EA 1EWYA 2WD7B 2REXB 1VECA 4UAJA 1A8SA 1XL0A 2JZOA 3BUSA 3L18A 3CW8X 2PCJA 1QCZA 1UMDA 1KH1A 2I6SA 4QHSA 1K4MA 3ZCQA 2WIJA 1XDDA 2H3HA 1PN3A 4X1KA 5I4CA 2P90A 1V6AA 2Q9CA 4XOUA 4IZHA 1WCWA 3RU3A 4DCUA 4Z6KA 4BAZA 1IXYA 5J2UB 1WVMA 4AKSA 3H2GA 4D82A 4DNQA 3NJ8A 3UMVA 4OQXA 2VDQB 2FSPA 3E81A 3JPWA 3QITA 5C8VA 1GTMA 5CTAA 4HZUA 4XPIB 1C4XA 1E1QA 4X1KB 2EXXA 3VSBA 4R2JA 4KMMA 1EFKA 1ADFA 3H6KA 1DCTA 4CCYA 3OKPA 4KQEA 3IQHX 2AR9A 3FWPA 3GYBA 2X9GA 3OLCX 4LAFA 4NJMA 1MJGM 1U7HA 4MKFA 4PSDA 5H5JA 1Q5PA 1KDVA 4ITUA 4HJXA 3B9PA 4PN3A 3C0KA 3OZTA 1N34B 3DBOB 2PIDA 1JEYA 1BCSB 4IMRA 3LZCA 1D5CA 4P3PA 4GLLA 2F17A 2ZXFA 1VJDA 2ZWAA 3FF4A 3JASA 1LTKA 3QKUA 4MPJA 1K7FB 2H08A 4NZYA 4BMCA 3Q6IA 1YULA 4Y2VA 2WWXA 4CM9A 1TQ6A 3HSKA 3FCOA 4AO7A 3N2LA 3MG9A 5H70A 1ZM3A 4H18A 4YAOA 2FFAA 1TFRA 2JIDA 4RVSA 1EEHA 1G8AA 2ANCA 4AYTA 1TUIA 5JZ9A 4HNUA 1NIJA 2HKIA 4GKKB 4N4AA 1JBEA 1FS4A 1EK5A 3JTEA 4FGKA 2Y92A 4Q0MA 2P9CA 2ZRHA 3IT2A 4JNKA 5JSQA 2H07A 3RC3A 2JHCA 1W4CA 5ITVA 1KJWA 3SVLA 4RLSA 3T7KA 2V9CA 3UGJA 2GR9A 3GLFA 4ADSG 3CH5A 1C7JA 2EKLA 2QTFA 1Z33A 2XHZA 4TZ6A 4OP1A 4AZ0A 1OBVA 1UJNA 3IERA 4RQUA 5K9ZA 1P72A 2DECA 2WILA 4OG2A 4Q9IA 4YHBA 4EHDA 1PZGA 1MORA 2ONZA 3F4LA 4GPEA 6GPBA 1GL6A 2Z58A 4HMPA 5E4TA 3AL3A 3HJGA 3WGQA 5CIYA 3OJXA 4K03A 1RQ7A 2WNHA 4XCQA 1XTPA 3BA1A 4BEBA 3I6QA 4HGOA 2P9YA 2AZDA 2DETA 1Z4NA 2OB1A 4HFJA 1MIHA 2MT9A 2OVFA 2V8BA 3H99A 2FF7A 4Q02A 3RF6A 3K05A 3U17A 1C4OA 4N6NA 3WIDA 4E32A 1GRRA 1H6CA 4WACA 1C1HA 2VSQA 1QGOA 3REOA 4FHCA 4UVHA 1EP1B 4YCSA 1FLDA 5EJ8A 1F4VA 1KVSA 4RA6B 3K0EA 1XLWA 1X6VA 3QE3A 2O2SA 3IA7A 3WGMA 4GX0A 5F4ZA 2A9KA 3I58A 3S8EA 1HZZC 3NVKI 3EGWA 2ZT6A 3V97A 3M9WA 2C4VA 3ASUA 3K2IA 3UENA 1U7XA 3KBOA 3MD9A 3ZWQA 1O95A 1CCWA 3EGVA 1P9RA 3PNVA 2CE2X 4C2AA 4DXDA 4NDNE 3E9QA 2V3VA 3ZWCA 3KB6A 2ZIXB 1IYZA 2PLFA 1T13A 3EG9B 5EIAA 2E4UA 2QAGA 3DGEC 4R69A 1OB2A 2RAFA 5SY4A 1J0EA 1JNYA 1D1QA 1JDUA 3NTRA 1ZINA 2CXHA 4CLEA 5D7NA 3K5HA 4Z53A 4DLXA 4M0UA 4GKJB 5AVKA 4L5BA 4EYKA 3IDFA 3N5CA 3OTIA 3OX4A 1Y3BE 4XXHA 5DWVA 3S27A 4CRWB 4U7TB 3TIVA 1BA2A 2FW1A 5DP2A 4KAFA 4XKJA 3I8XA 3W04A 2PUVA 2VI5A 3HCBA 1XU7A 2VBCA 3P71T 3RUAA 3UCEA 4B32A 4N8EA 5LMUB 1B0PA 3ZV3A 3CXRA 4DYDA 4J0CA 1YIDA 3YASA 3GC6A 4OHPA 4GM1A 5GZ6A 5TJHA 4AYXA 4XJVA 3GCXA 4PONA 1N33B 2P78A 3F67A 4IGAA 1HG1A 3P5SA 4G8JA 4QEZA 4PQEA 3ZK9A 1LDNA 2WF5A 5IVKA 1ULAA 3MLBA 1QVAA 3UMJA 3BICA 4IIDA 4DGQA 4L1KA 4CE6A 4UXHA 2R6GA 4J3JA 2NTEA 3D4PA 1ZGGA 3OBIA 3HZHA 3LECA 1VFPA 1VE3A 2BKEA 3G9ZA 2V7EA 1G291 2E48A 2X4GA 1DZIA 4JWTA 5BQOA 4YR9A 2VAPA 1N75A 3QPDA 5JJBA 1DEAA 4CKEB 4JXJA 1R6VA 4MVJM 4BFVA 1L1FA 4E5UA 1HMYA 1ORRA 2E37A 2OD2A 2YRXA 1PJ3A 4LHXA 1U81A 3ZXUB 1GA4A 4CIVA 1A9XB 1E1RA 4CMJA 2I2FA 2ODTX 4R7TA 1GWNA 5H9WA 3LYUA 1X92A 1CDZA 1Z3IX 4FFBB 3B51X 5GJCA 2NPFA 1QPBA 1T0JB 3H2IA 1YR1A 3OLVA 4G4JA 4JUCA 4K8OA 4LNUB 4Q7JB 1AZSC 2F43A 1G16A 1M10A 3ZDDA 1T4GA 3N8DA 1SWVA 5EL0A 1U2RA 3KT3A 3JALA 1Z4LA 4RD2A 2TMKA 2H9YA 2O0LA 2X58A 2ZDGA 3GLSA 1OAAA 2LCQA 2ZUSA 4A8JA 4ARUA 4B7CA 6CHYA 2NACA 3C8MA 4JSYA 2B0JA 2Q4TA 1H6DA 2ZJ7A 2M6RA 3ER6A 3LQ2A 4DSOA 5KNDH 1HORA 2ZG6A 4EL0A 3T9AA 3F5FA 3W1VA 3COWA 4B4OA 3SWWA 2WG2A 6REQA 4P53A 1DFIA 1PZNA 4L6IA 4WGFA 1J8YF 1NYLA 1SIOA 3COZA 3JQFA 4NBKA 5B1DA 1J39A 3IE2A 2B98A 5AVTA 2GXAA 1ORTA 2IZ5A 3J81k 5DTQA 4C5CA 3GUVA 1OFUX 3KXIA 2O3UA 4YV7A 3QHAA 3MT7A 4B6JA 1OKKA 2X5OA 2BJVA 3FOWA 4GPBA 4HQFA 4HCJA 1JFLA 4LVNA 5CB4A 3QSGA 4RGYA 3PR3A 3SHWA 2CLCX 3ZZTA 4BTVA 5LFAA 2GN0A 5IUKC 3KQLA 1SCAA 2FETA 3I5MA 3P32A 4JLUA 3I04A 4TS3A 2OCAA 2WINI 3AR7A 3EGIA 4ID3A 5F64A 1QVVA 3NCTA 2X8AA 5TNXA 3WHLA 4XFDA 3THRA 3EZ6A 4M7PA 1DOZA 4TMZA 3KZNA 1GKUB 2I62A 1JZSA 1L4BA 1NP6A 3FYUC 3OY2A 5IJXA 4C4XA 4CQLB 3NHSA 4P0QB 2G3YA 2Q1SA 3KYBA 3AONB 2Q8NA 2WMNB 1C3OA 1UWCA 4CCAA 4MZDA 5IH7A 2H1WA 4AJPA 1VTKA 4LYYA 2HTFA 2UV8A 4CN9A 2GK4A 1C2YA 2YICA 1GRVA 2R25B 1U1GA 1U99A 2NZJA 4R1MA 3VZSA 5CYOA 4BV2A 5D5HA 3TX6A 1VJTA 1Q95A 4CMAA 1YVPA 1U5AA 1Z5NA 2NVOA 3IJPA 2EKQA 2GOYA 4NMLA 3TXAA 4INJA 3VR2A 4EG8A 1Z7EA 1O3YA 4PC7A 4PR3A 5JPIA 5TPWA 4XDYA 1T5DX 1GA1A 1U0LA 1C3OB 1E9CA 1L5YA 1UJBA 5HIAA 3UJNA 4Z4IA 3DC7A 5H81A 1NNEA 3ZY6A 3O73A 1Q1NA 3G2JA 4DWVA 1ZOIA 4BVEA 4TVSA 2DFDA 2DT5A 3AW9A 3EHDA 4K9PA 5TSDA 2OENG 4IDDA 2F8LA 3CZCA 5C4GB 3QBVA 2E55A 4N18A 1D8TA 2JCGA 4JR1A 1J90A 5EXPA 1U94A 1QQ7A 4IEFB 1Y98A 4C0KA 1W5FA 3N28A 4RDHA 5AVUA 3ZCSA 3MOIA 3NTLA 2PXHA 4KSCA 3ZUPA 2C9MA 2HADA 1VPLA 2AX4A 2ALJA 2C9BA 2E5FA 1BAPA 4EMUA 4IUBS 4IR7A 2QUIA 1NAIA 1LZKA 5F9FA 4TWAA 2YCLA 2QVBA 3TBHA 1FFDA 3G1TA 4F2GA 3CISA 3D8UA 3G0CA 1HQDA 1WD7A 2WK1A 3VOBA 1K27A 2OO3A 5IKMA 1HTWA 2CNKA 4TXMA 4PGAA 4D5GA 2YNMA 4KYIB 1ECFA 1U6KA 3TL3A 2XTJA 4BO0A 3ADDA 5JJLA 4II3A 5KOHA 4IJKA 1AZLA 4IGKA 2OV3A 1I14A 3R6GA 1YL6A 5JS7A 1MKYA 4RTLA 4PYOA 3VJKA 5SYNA 5L7WA 4RHTA 3UPTA 3N6VA 4LXUA 2AOTB 2OZKA 1LJUA 3DWEX 3NDRA 4A5SA 4ZDIA 1A7KA 2BFMA 1GGVA 1CQZA 2Q3DA 1P33A 2WIGA 5IAEA 1TZKA 1DTWA 4NK5A 5JCPA 2LIPA 4Q16A 1V9CA 3LDUA 3G88A 4C6TB 3CW2A 3DYBA 3IAS1 4N48A 2OSBA 2REQA 1KR5A 4YS6A 1NQXA 4HB2A 4C1BA 3P8ZA 5C37A 1ZMRA 1GUZA 3D0RA 3DUFA 4GMGA 3QXGA 2QVCA 4HATA 1XP8A 2QWXA 4KQWA 4BP1A 2HCRA 3P9IA 1IN8A 1F9AA 3PQEA 5E1BA 3D1JA 5IAGA 3R8CA 3SG0A 4JL6A 2CV0A 1YQXA 1YQDA 2YHIB 3HA2A 4K3UA 5MN6A 2NTYC 3AF2A 4DUGA 2HH9A 1SURA 1P61B 1HI9A 4UEKA 4AN1A 3F9RA 2IXEA 4P38A 4Y6LA 3PB3A 5K03A 3CCFA 5D85A 2A5GA 3B1XA 3Q3HA 5YASA 5CK5A 1P2UA 2IHZA 5JZSA 3I62A 4LKRA 3T1HB 4U2KA 5BOSA 2EBUA 2HPAA 2GN8A 3IEKA 1YE8A 3FDZA 3RFVA 3WTBA 4BV3A 2QR2A 4A7PA 3NC4A 3UOGA 4FOTA 1PHPA 1EHIA 1U4SA 1E1NA 3QVMA 2PKRA 1G8MA 4NE9A 3IBFA 4H1HA 2IK8A 3E2PA 2IHTA 4Z9AA 3EE6A 4KH1A 1F8UA 2VDJA 3KB8A 3LK7A 4MR8B 4Y1EA 5LA6A 10MHA 2VT6A 2HYIC 3ZOKA 1J2EA 4WOKA 5MGBA 4NZMA 1F51E 3UK6A 4LPKA 5I8PA 1KAHA 4G1UC 5C1PA 1IAQA 1TCUA 2DWPA 4OHZA 3QU4A 1EUDB 1XC7A 3ZPXA 5BMVF 3DHVA 4C4TA 4JQZA 3C1UA 4QT4A 4DSTA 3CSDA 1ISRA 1QV7A 1WS6A 1YKSA 3H86A 4LYJA 5IJWA 3DEAA 4MHTA 4D74A 3QLJA 4H27A 1BHO1 3BPSA 1XFAA 4NU8X 2NTJA 4YIKA 1ETHA 3T1TA 4S2UA 4MIKA 5K45A 1E1QD 1RMTA 1TF5A 1KI4A 1GO2A 1IOZA 1CZKA 1QVRA 1VMDA 4KVAA 2CJWB 3U3MA 3CF6R 3HYSA 5CIQA 3MIZA 3EIFA 2NUTA 4A5OA 3RSOA 3PXUA 4Q3LA 1KYXA 5EE5B 1CEQA 2IDMA 4MI9A 2VUTA 4ZOLA 4ZYYA 5BR7A 5HKAA 1PK9A 2H0RA 4OK3A 1JFFB 1WTAA 1CZLA 1J1ZA 1X8KA 2C96A 5IDYA 5JXIA 3HE3A 3CN7A 3P94A 1N8KA 4R0NA 2HY7A 2YIMA 2IPNA 3VDMA 4ZHQA 2V7VA 3DOJA 3MWLA 4TXNA 1Y4DE 3P2KA 4XYLA 4CT4B 1K08A 4LSWA 1T5BA 3OOJA 1E3MA 2DBVO 2QNBA 1E2NA 1QPZA 2WUDA 1LUAA 2XE6A 4XJTA 1ZNWA 3GGSA 5I7EA 2C2OA 4PX3A 3PVCA 2JARA 1U90A 2R751 3R6DA 4UUPA 4G5FA 1OGIA 2NW6A 3MWDA 1Y0BA 4DS3A 4RIIA 4KAXA 3HCFA 3KKOA 5CR9A 1DQNA 1UBNA 2GYYA 2I2WA 3C5WP 3AY6A 3NS7A 3EDMA 2C5HA 5BOSB 3MCAA 3WAKA 1PDVA 2QW0X 5LYJF 3MMSA 1XRQA 2OA0A 3OTWA 3UUFA 2R66A 5JSUA 3TGWA 4OI2A 4R2WA 2ZRPA 3EZNA 1RJWA 4HGNA 2C83A 4N7RA 2IITA 1EEXB 5LQRA 2I22A 3OCVA 5JR3A 1X1BA 4UMDA 1WHSA 1RP1A 2BKUA 3A3KA 3STUA 1TNDA 1RBMA 3PNYA 4JJKA 1RI3A 3BULA 4N5IX 1ZW1A 4A23A 5KTYA 1T3ZA 3EGDB 3IPYA 3K16A 1QGUB 2JJ2A 5A03A 3KQVA 4FN5A 1EB9A 3GH3A 5TV2A 2XH8A 2XKKA 1OTXA 1NXVA 4JNCA 4B7AA 1NPYA 3GGGA 3GEHA 2CBGA 2CLHB 1XCMA 5H3LA 5HOQA 3RPEA 5KTRA 4OHKA 1E5VA 1H2EA 4L0DA 2QLBA 3BC1A 1B1CA 2GAFA 1QHEA 1VBMA 2CZGA 3ESBA 2PZBA 5FCDA 2OXIA 2X0DA 3PXBA 5KOJB 3JAMA 2HEIA 2LKDA 4IXMA 3M6WA 1DAFA 1R15A 1J99A 3D4NA 5BO5A 4HDRB 4PU0A 3C3JA 4BPBA 2WIDA 2AV6A 2JB9A 3BH6A 1BMQA 2II6A 3O4FA 5K0BA 2FU5C 1V96A 2V4UA 2WSSA 4OGGA 1IBKB 2FVYA 3GO4A 2Q3BA 2YJNA 4X62B 1KA9H 4O0MA 5B3LA 5HQJA 2A5YB 3QHQA 4OJNA 4BBZA 5GINE 3O8QB 4UD2A 4FYPA 1LGYA 3IBYA 4IO1A 1PNQA 3I28A 4L2IA 4MAFA 2FWJA 1Z25A 2ZK7A 3MSXA 1BVHA 1V0JA 1X7WA 3QVUA 3PQ4A 1KE1A 4N5DA 4EVQA 3EVEA 4EYOA 2VH5R 1NF9A 2OZVA 3RKUA 5FUVA 4R31A 3OURA 1DIRA 5K0NA 4R7GA 4S2EA 2C5BA 1K2WA 1XD2A 1TC2A 4G4GA 2VCHA 3T54A 1JAXA 4B84A 3R5FA 2V54A 1CR4A 1JH8A 2A9QA 1ZM7A 2J6IA 4ITRC 5GONF 4CDGA 2ZM5A 5BSHA 3O2JA 3JWEA 2Y9PB 3TI7A 4E7OA 2B7BA 4MW7A 1S96A 4KFSA 4BMVA 4EY4A 2GYUA 3TD9A 3GJ4A 1P4JA 1V2HE 4WCFA 1NFRA 4R54A 4BZXA 2L69A 4J94A 3I5YA 2CYAA 1A7JA 4P3XA 5FWNA 3IUEA 3NHBA 3EZ7A 4X44A 4DLWA 3C6QA 3GLFE 3PDIA 4RV9A 3VPBA 1PJRA 1YJAA 2D2EA 1WWKA 1WXHA 2ZTUA 3KQMA 3VZCA 1UK7A 4KW7A 5KBYA 2J31A 1ZXXA 3LVBA 1NW5A 1Y1SA 3JZFA 4WCFB 2QUHA 2PRKA 5DHFA 4S1PA 5IF9A 3NBZC 2EYUA 2HRCA 2P2CA 4J6EA 3RWMB 1QK4A 3PI7A 1U3VA 3O3MB 4YJHB 4UU1A 4X54A 3V6MA 5FYQA 1T5TA 1BXKA 3CTPA 2W5UA 3CLRD 3EIXA 4OI1A 1MQ9A 1RRKA 2CCKA 3GCGA 2H1CA 1MJ5A 1U0SY 1W5AA 4BQFA 1W49A 1CVRA 1A3CA 1TGVA 4HLUA 3HVJA 4HZIA 2CFRA 4OQZA 3DCNA 1F2TB 3PXCX 3TRKA 4YJHA 3EAFA 1JILA 2IYWA 1OLXB 4F3KA 4GU5A 4A10A 2OECA 2VF8A 1P2GA 1O6CA 3FY4A 3MQ4A 5BN5B 1W0KD 3CRNA 3HCNA 2F48A 3PITA 3M4JA 5EI5A 3DT9A 3OE4A 3MA0A 3GJRA 2XMQA 2IXBA 3TNJA 3T06B 1NN5A 1VJRA 2JFPA 1EESA 1QUFA 4LOIA 2OFFA 3I2HA 4LUCA 2VWGA 2JVJA 4I50F 4PHCA 5E3IA 3O8QA 2WWFA 5JH7B 4E2YA 4WRRA 1CY4A 2BELA 3U4MA 3FRHA 3L43A 3Q7QA 2WNIA 5SZHB 2YC4C 3HXMA 4W7HA 3DZGA 1Z3CA 3QGMA 2XA1A 3I05A 2A9RA 1P0FA 2OWEA 5FUBA 1TJ4A 3TCKA 4K26A 1LPMA 4WNAB 3WWYA 3ZDQA 1SOUA 3W2TA 1JXQA 2W6IA 3N6RA 3E9DA 4D41A 3FTPA 1OKKD 1RWVA 4R9RA 4UVDA 5TARA 2SNIE 1G2PA 1O1YA 2P0EA 4B6FA 2X23A 3UYKA 4CKZA 3QTLA 4JC8A 4DABA 3MAGA 3NDBB 3LU1A 2HZBA 2UXDB 4P86A 1U9IC 1X9GA 2C7GA 2C9YA 2B4QA 3R24A 3HQ4O 4R7ZA 5T41A 3OFNA 2BFAA 5DX0A 2E85A 2EIXA 2YV5A 1MO6A 5FWXA 3ZXXA 6Q21A 1TAUA 1ZO8A 5FLYA 2VPYA 4I19A 4NPCA 1GNVA 1TO2E 3O82A 3ODGA 4QOFA 4MV3A 4XARA 4LEIA 2A30A 5EP3A 1GEEA 4E13A 1XO1A 2QTMA 2XQGA 1CWUA 3C7CB 3ND9A 5ALLA 4IJ6A 1U3WA 1U6IA 1PO7A 1SOAA 3ZV6A 2GBLC 5AM5A 2KYRA 3ZWWA 1FUUA 4HT3B 4KITB 1YR3A 2VUIB 4URWR 1JQEA 5HJ7A 3H18A 4TX1A 2RIPA 3DAHA 1AA9A 4MRPA 1NHGA 2GJKA 3U0VA 1SXGA 4GX1A 4C43A 3P2JA 4NV3A 2WV7A 1LB1B 4MMYB 2G8NA 3L1UA 4PICA 2DMRA 1DBIA 1XZDA 3IX7A 1YDMA 5KX5F 3VRHA 4H3SA 3AR2A 3VR5A 1NMXA 3QEJA 4FOPA 1TF7A 3BXHA 2CEAA 3MZ0A 4B0OA 3ZJ5A 2WKSA 2CWDA 1WTCA 3DJFA 2OZEA 3ZDYB 4D99A 2I7CA 1XXHB 1YQ9A 4OLFA 2J4CA 3DFZA 2OC4A 3EOBI 3T3HA 2Y66A 1FTQA 2ZUFA 3HUEA 1M8FA 3PWKA 3ZVRA 5AI9A 2X6QA 2A9VA 3GRPA 3OPYB 3H17A 1CB7A 1TYEB 3IJEB 5GGXA 5HKBA 1JX6A 1NMYA 2QTGA 4LQCA 3ORQA 4WZZA 1LX7A 4OI4A 5GJBA 3EH2A 4HZUB 4XPIA 5KVQA 3V32A 3LIIA 1NSFA 1RLJA 3L0CA 2H7CA 4RJLA 5K3SA 3VNUA 3NT2A 2OXTA 3N0VA 1GT6A 2YVQA 3A0RB 4IPTA 2BR3A 2GM3A 3VYWA 3R75A 4BB9A 4FXPA 1DTSA 2P3QA 3VPFA 2DYKA 3L40A 2WB4A 1EFUA 4IJ5A 1IDOA 1HKHA 1L5OA 2JGJA 1S1CA 4I1IA 4KP7A 5DCYA 3PQCA 5BWOA 4O2AB 1BXGB 2NYAA 3NR2A 4RTKA 1Z47A 3PD0A 2QAGB 3PSAA 4WH0A 1CLUA 3TLAA 1P0PA 3ENNA 5DTEA 1N32B 3AM4A 5ER6A 2XYPA 4MJLA 1JFTA 3EAQA 1Z7YA 1KYQA 1F2VA 1A82A 3F4BA 3H7IA 3OOSA 1JSZA 2IZ1A 4OXXA 5FL3A 4DMHA 4ZU6X 2O0JA 2W11A 3D7NA 1FW8A 5GQSA 1JNXX 3KJZA 4EG6A 3OLWA 2DFLA 4H9GA 3DXXA 1Z2AA 1WF3A 4RH1A 1WU8A 3GP3A 3HCRA 5DLQC 3IQWA 2R87A 1R12A 3HPRA 5TQ0B 1Z0SA 5CYFA 2XTZA 1P6QA 4JI5B 4BNUA 3ZXIA 2WTAA 4RVCA 4UZSA 2RH5A 5FBRB 4E5YA 3LX5A 1P75A 1Q7GA 5AM0A 5BSTA 1PYGA 1IN5A 3ZNQA 4LWZA 4C7XA 3P9XA 4R1LA 2MHCA 2PSJA 3LVRE 4INPA 4E2WA 1RKXA 2Y76A 3MXTA 3AHHA 1UOQA 5BQFA 4TMTA 3HU5A 2FY8A 2FKNA 4U2GA 2GRAA 3CNBA 4XSHA 3LA6A 3ZVLA 1Y9JA 3O1LA 4XR4A 3VDQA 1BE1A 5CEEA 3WDLA 5AXAA 2YJTD 3OUTA 2MSEB 1VQ1A 1Z37A 2O3QA 4KWCA 1U0EA 4TL9A 3UKJA 5HGJA 2OUKA 4MW9A 5DBGA 5DX1A 1Z0UA 3TMAA 4F2DA 5F9HA 2Q0QA 4IOKA 1QYXA 3OZAA 3RVDA 2Y27A 3PQFA 5BRAA 4Y2SA 5F5LA 4TT8A 4A0HA 3PI6A 3N8KA 3LPDA 4EPTA 2O8EB 2LTAA 1ZWLA 1WP9A 1MHPA 1UXHA 1YRAA 2IYSA 2WYIA 3DWGA 1U9ZA 1TA9A 1T91A 1O89A 3CUKA 4OO3A 3REQA 1UWVA 3VR6D 5FWYA 1EIZA 4KR9A 3EB9A 3KZ1E 3L0YA 4GSYA 4RXTA 5HZKA 2O4CA 4MQFA 2C92A 4ZP1A 4N9QA 4K9QA 1IM5A 4PHTA 2IH5A 1QFMA 1E5DA 2P11A 3CEPB 3BWYA 3OX1A 3IVMA 1LF0A 1JPJA 3Q41A 1AX9A 3ZU3A 4CNBA 5JHGB 4RK0A 5EMMA 1ONPA 1ZS9A 3CNHA 4DCNA 4LJ4A 4F4DA 1KH2A 2EFHB 3MCUA 1WB5A 3OIWA 3UXMA 3TUJC 5DLDA 3QPUA 5ANRB 2N3ZA 1XZ8A 3U62A 1WQ1R 1RXYA 3KZOA 5HIIA 1BE8A 1GGNA 4EJMA 1NUSA 4LMPA 1WD5A 4CETA 3ZD6A 1QWOA 2VZ8A 5J5VA 4ZRMA 2AUTA 1MUUA 1TE2A 1U7UA 4FOSA 5L4LA 1I7QB 2D5CA 4PWZA 2RCNA 2EZ9A 5BQ3A 1VMEA 2AI2A 2F1OA 2QMQA 2XY4A 4AMZA 1VGQA 4KPYA 5HJ2A 3DBHB 4LE1A 5KEIA 2BIFA 3QW2A 4HH0A 2FSGA 3U3ZA 3ZCRA 5BMOA 2IEDA 2FP4A 4HDCA 4QOGA 3UKOA 1C7RA 4O4JA 4QUHA 3SXJA 1OC2A 4QJ4A 5IJ9B 1NP3A 4JEMA 3HDGA 4BKRA 2JVIA 5BV7A 2YIJA 3QA3E 4B3BA 4WECA 4CLRB 4YTEA 5ALRA 4C22A 3IOBA 2COUA 4YO8A 1TKRA 2BW0A 2ZJYA 4HVAA 5I9BA 3B6MA 4YQFA 4BP8A 3C85A 3L6DA 2AEFA 2VNKA 4C89A 2H5LA 1DB3A 1KEVA 4WGGA 1A04A 1A27A 2H2FA 2XB8A 3F5DA 3PJEA 1RQPA 2D59A 2BZGA 1N25A 4MWGA 5KDLA 4YMLA 4H2DA 2FK7A 1SPBS 1Q7BA 1VB3A 1USUA 5KPDA 4GQAA 2BJWA 4Q3CA 3WRWA 4A8JC 5A3QA 3DMPA 5LJLA 2HA0A 3HO6A 2ZVPX 1F0YA 2ZJAA 4BNNA 5AJVB 1BHSA 4Z5XA 5IULC 2CJPA 1P3Y1 1K6EA 1DDIA 3RSLA 2OORC 3B2QA 4RENA 3TRDA 1N5KA 3WQSB 4R2KA 3EXG1 1J7JA 4XWYA 4ZEVA 2D4HA 4IDOA 1YA6A 2FN7A 2ZJ3A 3L84A 4D8VA 5I7UA 1X7HA 3BOSA 4EHHA 4PS1A 4TTJA 1FDRA 4BGVA 4GGMX 4PYQA 4XB2A 4D79A 3ITEA 5CH8A 1N9KA 1N5MA 4LV8B 1PJLA 2G1JA 3LCCA 1NXOA 1PGPA 2APJA 1C9MA 1Y63A 4O29A 3Q7IA 1RWKA 1OF1A 2D7JA 2QP4A 2Q46A 3G2LA 4KDRA 1VHWA 5HF6A 1DFHA 1L7VC 2QL9A 3HEMA 1Z08A 4H3HB 5BSEA 3IPRA 3O8RA 1LBHA 5TQVA 1L5RA 4V0ME 3E1GA 2PGJA 5HCIA 3QVWA 4D4HA 2RMKA 1DAEA 3AR9A 5LZ4A 1R50A 2FDRA 4Q4LA 2PLAA 2WLTA 2XZPA 4YI3A 4HNAB 5FLKA 1IJBA 4GPTA 2X4LA 4D4LA 1QLJA 5EZYB 1SVWA 5K3EA 2DKNA 5E1MA 3ZE6A 4B2PA 4F5WA 2WE8A 3AU9A 4X61A 1AXEA 1VLQA 4Y98A 1HDOA 2FDCA 4FFDA 4XQEA 3VYRB 1CEYA 2RB5A 3HYLA 3LI2A 3QWIA 4PQGA 4OK6A 1XZEA 3RBXA 4CFZA 3A2KA 5EYPB 4RPCA 4M46A 4W5OA 2PEYA 3DBHA 4EY8A 2G1PA 5CB4B 2XDWA 4IX1A 1CKEA 4OA8A 2W37A 3T15A 3WC4A 3ZGXA 4CKBA 1YZLA 2IDKA 1JXOA 2VCEA 2ECPA 5F76A 2CXNA 4BNVA 4HDNB 1ISJA 2VH1A 1V4BA 2JH3A 4CZ2A 1FDTA 2GBCA 3JQGB 2OTCA 5EMHA 3DT8A 3I32A 3PC8A 4Q9AA 3RU7A 1YF3A 2JH8A 1M2WA 5F52A 4MVJG 4D9NA 1Q6ZA 1CIJA 2CJWA 5HFNA 3B9RA 4B8WA 2GBIA 4AQ7A 3AFMA 2NIPA 4JBWA 4ER0A 4CIDA 2O8FB 1AQNA 2AN1A 3ZE1B 5L53A 3ETDA 4CKBB 1J0CA 3NLLA 2XKBA 1HQCA 3EG5A 4BNKA 4HDNA 1V11A 2JI4A 4H1TA 1XXLA 2ZPTX 1DUIA 3N0RA 1WHTB 4QXOA 3UV6A 4UBOA 1ULHA 2WJHA 4U7PB 4BE9A 1PWHA 1QH9A 2G4CA 4JXKA 3EN0A 4HPWA 4RNDB 4MGIR 2AMVA 4RCYA 1IQRA 3IRVA 2VTBB 5E6UA 3IMCA 4M0PA 2FSSA 1U02A 1XBTA 1MO2A 2OGWA 1EDOA 3FNGA 4IIEA 4FQ5A 2Z1MA 3DD1A 1GAQA 4Y67A 3D3WA 1Y3AA 3DFKA 4ZWNA 1NN0A 4JFRA 4AP6A 3OJOA 3DHYA 4JJ7A 5B3AA 1NNUA 4P35A 4Y2RA 2IYZA 1P4HA 621PA 3EZYA 2EKBA 4GVXA 6YASA 4I36A 1ZDMA 3VZPA 4AURA 5HX7A 4J7UA 2WJIA 2PNFA 2GN1A 5TS3A 2WWRA 3IAFA 4QTZA 4GMHA 3WK4A 2WJ4A 2GX6A 2XMRA 3PEUA 3GJ0A 5G1NA 2FZVA 1BS1A 3PSHA 2G0TA 4UUBA 4WSOA 2WV9A 2VL7A 3ZGYA 2ECKA 3DAPA 4W1QA 3RVKA 3HKDB 1PQ4A 1UC8A 3I73A 1PEKE 1Y6QA 1M2EA 4HI0E 1LDBA 3PGLA 2XUGA 3RSGA 4DDMA 3NHZA 2PBFA 3ELUA 1E5XA 3Q98A 4DR5B 2F9MA 2ZBUA 3B8HA 3VKHA 4V39A 2WJWA 3G79A 3ZD9A 4CL0A 3IB3A 3RJ5A 3HCWA 2RKBA 3HVHA 1P0IA 2QVGA 1E1CB 1I24A 1I4DD 1VKRA 3E03A 4MRSA 2O2XA 4TRMA 3RUIA 4BDTA 4QOJA 2XUFA 4CUJA 4IIYA 4UW9A 3LUPA 3U4DA 3C74A 3KQKA 2QNRA 1YK0A 1NONA 1ZRSA 1O5IA 5AVWA 4LPSA 3AR6A 3RJZA 1ZJ5A 1KERA 1LRJA 5C9ZA 5CGQB 1P31A 1BQ4A 4WBNA 4II7A 3UY4A 3ERCA 2FSVC 1II0A 2RHRA 3BSYA 3BWCA 1U0GA 3ROZA 2OHJA 3ELYA 5FWDA 4OL0A 3DZFA 2O8EA 2CYCA 4Q3DA 2X42A 2IYVA 4CR6A 3ADBA 4OFBA 2WYVA 3LCVB 3A06A 3VI3B 1SVSA 3T3PB 1RZ3A 3ZKWA 2WT9A 5A3JA 1ZUWA 5EHGA 3IOMA 2VAMA 1JIKA 3K9FC 3D02A 5CFPA 3A04A 3QLEA 3DD5A 2VH2A 1I2BA 2PWAA 3ZUGA 2SCUB 3HBJA 3U7EB 1E2LA 1HC7A 1Y37A 3Q0IA 4H15A 4BJ3A 3EQZA 3JARB 1GTZA 2HBYA 5BR1A 1NNSA 4XIYA 1HG0A 2OD9A 4QBTA 3UA4A 4KU4A 4LSMA 4QPNA 1YK1A 4RVNA 4RZQA 4KSBA 1LTHR 2CNLA 2WHRA 2ZI4A 4PCLA 1N8NA 2F8MA 1COWD 1GPYA 4KI0A 5CA0B 1NF8A 3RREA 2KBFA 2DRIA 1J8MF 4FI3F 4BZWA 4U7FA 4Z7OB 4D3DA 4IGEA 3U13A 4N12A 4K5QA 3DEJA 4AK9A 2IKSA 1A1VA 1LBTA 3C3WA 2ATCA 1G6HA 1PJ4A 2J9FA 2ZI7A 1M2OB 2NO5A 4IJWA 4Q5IA 3QFTA 2G70A 1AGNA 3F4KA 4N0QA 1PGQA 1CLEA 4DA9A 2VZ9A 4JITA 4F5EA 3ZHOA 4CMIA 1C7FA 3NFYA 5KJ1A 1FFXA 1YBAA 2WHPA 1TZJA 5JT1A 3C3PA 4OI0A 2GCOA 5FULA 5C3MA 1BWQA 3ICCA 2JBHA 4DJJA 2J0QA 3BMNB 5AJHA 2G0NA 1GG5A 1BMDA 3PICA 3VTFA 1OXUA 2A7QA 5LYYA 1DTWB 3PWSA 1ISFA 3W2IA 2Q5EA 1ZEMA 1Y3CE 1E1CA 5K20A 4WASA 4BNFA 3TBFA 1CY2A 1LV7A 2BVNA 5CFMA 1OU4A 4YAEA 5ALXA 4V1CB 3OM1A 2WWVD 1UBLS 3KLOA 1J97A 1XWFA 2GFIA 1TTPB 2GXQA 2WFLB 4LZNA 3VOSA 3DMDA 1J8QA 2NYRA 3T35A 1GPUA 4N7BA 2J48A 3FROA 1RXIA 3N6XA 1ZK2A 4LRWA 5FD8A 4Q9NA 2H3EA 3GDOA 4WW0A 5BSKA 3K70C 4ZPJA 1SU7A 5ARDA 1YRQA 4I3FA 4YJDA 3FOCA 2I1LA 1WCIB 4UE6A 1N2GA 5K8LA 2CV2A 1VYHA 3USCS 3VHLB 1FRVA 2I6FA 3C3EA 5JSZA 3M34A 2SHKA 2E0IA 4M53A 1Q7TA 4UUMA 1XDWA 2FE1A 3HYTA 1GZDA 4U7JA 4ZKEA 4YUYA 3IEMA 1ODJA 1IQUA 1Z0FA 3EQ6A 4IDEA 4RSHA 2P75A 2GYVA 2PRYA 4NZNA 1NKTA 2FPGB 3PPWA 2YUTA 4BBPA 1FU4A 2J08A 4ME6A 4MRMB 3VR2D 1BS2A 2CNWA 3UJCA 4A2PA 4L5IA 1KR2A 3A6HA 2DR0A 2RJ3A 3U3XA 4KLAA 3NEPX 2J6HA 1DKNA 5DI3B 3AU8A 3D6TB 3EGXB 3G59A 1Q0RA 2OOSA 4MRNA 4RY8A 4KN8A 4YO7A 2BGUA 1T5SA 1E5QA 1WB6A 2IYFA 2X0IA 3C48A 4BQOA 5JS8A 3EVFA 1V37A 2EP5A 2QZ4A 1M1YA 2RHMA 3LY5A 2OLKA 1NI4B 1FDVA 4YJGA 3DEIA 2ADFA 1Z6QA 1OFTA 2XCLA 3VV3A 1XSEA 4UDXX 3ZTTA 4BGDA 1KWGA 2ERCA 2FW0A 1GTVA 3ESYA 4XGNA 1J42A 2OCXA 4IZIA 1IPFA 1V9LA 2A3NA 3GB9A 1BWRA 3ZHCA 2BRUA 4P33A 3WGKA 4FE4A 4G25A 2IYRA 2C58A 4GW3A 1H2WA 2WHPB 2QTVA 3I1JA 2XQIA 2ZB7A 2GGSA 1N6RA 2AQIA 1M5TA 1JSRA 3V4VB 1IUPA 3FG9A 5K0ZA 1D1SA 5BYJA 1OXBB 3RS3A 4MO2A 1OFUA 1JJ7A 1TM5E 1UFVA 2X41A 3AOEC 3V42A 1PR5A 2R6HA 1LXCA 2DSTA 2JASA 4Z2YA 1PDOA 2P79A 3I1IA 1WW3A 1D2EA 1FK8A 1P7WA 3LC7O 4EPYA 4ZC8A 1QV9A 4ZAWA 5G1OA 3UJ6A 3WNQA 1MH1A 4EUKA 3B1KA 4LF7B 4DDWA 4L57A 1JLRA 4ABYA 2OD7A 2C9CA 1UM8A 3D64A 4LGMA 4CV0A 3QX8A 3RVRA 1QTNA 4AJ4A 2B8NA 4PE5B 1LBIA 1TM4E 1UCFA 4L4YA 4BCBA 5JQWA 4U2FA 4Y2YA 2CLIB 4FCTA 3QPVA 4US0R 1I9CA 4JMLA 4NLLA 4F4UA 1YFKA 5LZ8A 3RKSA 4DQUA 2XUQA 5K51A 5K01A 2HU2A 3DCIA 4GSKA 3OX2A 2XX3A 4ZOEA 4OAPA 3NUZA 1XEWX 1XD2B 2LDBA 1L5ZA 4YWHA 3U3JA 1MFPA 2AK2A 5K0LA 1RQRA 2B37A 2OHXA 3ZR4B 4UUQA 5E3HA 4JQCA 1F60A 4JKIA 2WUVA 4CM8A 1ABBA 1BH6A 4BFYA 8OHMA 2R8OA 3HLTA 1PGNA 4UAGA 3JQ9A 3C7KA 5FI5A 1LPPA 3L4BC 2CVHA 1PQWA 1ZAKA 2HA3A 3GEPA 3LKVA 4QGFA 1XZJA 4RY0A 1V5EA 2FMUA 2HK6A 3EGXA 5A4JA 1KGSA 3DVSX 4HK4A 5B1SA 2DHDA 2NZWA 3QE0A 2VDPB 4E09A 4OD0A 4M76B 1DMSA 1SD5A 5FUQA 1IHDA 3K2BA 1TB4A 4TROA 4EYGA 3DQQA 2FFRA 4BLSA 4XEUA 1DAKA 1E0DA 2C5GA 3I01A 2RH4A 2PS0A 1LQTA 3M6XA 4INOA 4OQ4A 1BMFD 3RUEA 4XDGA 3WL7A 2ZR8A 2ZXEA 6LDHA 2FMFA 1GITA 2FZKA 2JDIA 3PUHA 5LQNA 4UBNA 5IBQA 4DLZA 1QTQA 1JWAB 4QUBA 1H5QA 4Q82A 3QNUA 3JWPA 4ZOBA 5JVDF 4IH9A 2PO7A 3FA2A 3PUIA 4RKYA 3Q1KA 1IMOA 2R1TB 1KMNA 3HN2A 2Q0XA 3I6YA 2WM9B 4M86A 3WQRA 2CXOA 2HWYA 4NY1A 4U6QA 3E9RA 3JRXA 2Q2NA 3BZUA 4KNWA 1P6UA 2VPZA 3EF1A 1D9ZA 3QXSA 4RW0A 2WB2A 1QRUA 1FMFA 3KT0A 1RJDA 2OFXA 4QBFA 1OXSC 2FUEA 4RXMA 3QOYA 5AI4A 3STYA 4LG1A 3JPYA 5C2JB 3AKDA 3E48A 1VKHA 4G0PA 4Q00A 3NT4A 4E5NA 4C7OA 3HI4A 2OGZA 1I4OA 2Y1OA 3PG5A 4TRNA 3VKVA 4WN9A 4AIRA 1W46A 3FYHA 1A96A 4ALKA 4YAFA 4D81A 2FSFA 3A9SA 1RT9A 3MJCA 1CF4A 4O63O 3X44A 1SHTX 1A2KC 1E3DA 1LWNA 1RHQA 2Q3MA 4QU5A 1MRNA 1T1RA 4EIWA 2VWHA 2A1TR 4ZCPA 4TYQA 4RD0A 3D8BA 1YH3A 2QTBA 2VK2A 2WAYA 4IMPA 4MYRA 4FNOA 1JMKC 3WYFA 6AT1A 5AVSA 1XCPA 4B3RB 5HNKA 1DG3A 1NWHA 3NKFA 4E07A 3QXCA 4IS2A 3UC5A 1XQ1A 1RBYA 4Q7QA 1GQOA 3FKQA 5FPPA 3FCAA 2YWDA 3GT4A 4I55F 5BURA 4ZTBA 2ONCA 5B64A 1T8SA 4JJEA 4ATNA 1JR2A 3TD2A 2VHJA 1WUTA 3THSA 4LF5B 3WLSA 2WTEA 5DVZA 1R3UA 2D5IA 2LCIA 3JR3A 3SMVA 3GJ7A 1JBQA 1LPSA 1CERA 2JKVA 2QQ0A 3CJRA 4OB8A 1JDSA 5DE3A 1S6YA 3AB8A 5FOWA 1AO0A 2NZUG 3OECA 3OQIA 4XI9A 1ETUA 1LY1A 4UZFA 1ZVQA 2A67A 3ZY3A 5U1PA 3LPNA 3MAAC 3RTDA 2PTHA 1ZIXA 1J9EA 4ZDJA 3AI1A 2QMYA 1REQB 1X87A 4M0LA 3R7WA 1DU4A 2Q45A 3D6VA 3KNZA 2HXYA 4DBZA 3OAAD 2EJVA 2QRNA 4LZAA 4O4JB 4YPOA 4FDMA 3OZSA 2AJTA 4TKMA 3B1ZA 1T6YA 4ZT7A 3WIEA 5AK4A 1AF7A 2C2BA 1V8FA 4PQYA 5K4GA 4C0XA 3OCCA 5B57C 5LZ7A 2G9NA 2G9VA 1AV6A 2QROA 2JJ2D 2CLKB 2AG0A 4LXYA 4AZ0B 3Q3JB 4D7AA 5ENDA 4YHHB 2Q3CA 3DUWA 4M8LA 4PLZA 4C06A 3RC1A 4HZGA 3THOA 1MBZA 1QIGA 4C4AA 4Y2HA 2R60A 5CW2A 4B3IA 5KQGA 2RONA 2XWPA 4A92A 4DB2A 4K9OA 3HLYA 4LNUA 3PQ6A 1SU4A 5IH3A 5KQMA 2F1RA 4LOLA 4GICA 1PLLA 1SXHA 4WJZA 2Q9UA 4WV3A 4DLAA 2Z4RA 1SQ5A 1K97A 1P74A 3SN6A 1I3CA 1IFXA 1K3UB 3PUKA 3VTAA 3L0PA 1S8NA 2WSSD 1RXUA 1BEUB 3PHCA 3Q5EA 2C5LA 2ZI9A 3TFOA 5GZ3A 3I9NA 2IV3A 4CMKA 4QU0A 1NVUQ 1YAHA 4YALA 5EJAA 4GC5A 1JAHA 3IEPA 1JDNA 4NG5A 3U61B 5F7XA 1GZVA 1AH2A 4G8DA 5CGZA 2A5LA 4MS1B 5AVJA 2AC7A 4I46A 4X1YA 4OJTA 3FJ1A 3WBFA 3F7NA 3O0TA 2W6OA 1B0UA 4J07A 2XUOA 3EDCA 4M83A 4C05A 1O95C 4MKXA 1C8LA 5EHQA 3QVKA 3PHJA 2R8RA 1WR8A 1X8LA 4MEAA 2E49A 3IP3A 5FTJA 2CXQA 1EGHA 1VA4A 2UVPA 3F73A 5IEJA 4NU6A 1W5BA 2O3RA 1T4BA 1NKSA 3G0HA 3TOSA 3U3KA 1QIMA 4EQZA 2HA2A 3UHFA 2A1UA 3AF6A 3CBQA 4DPKA 1SHJA 3SZOA 2XYVA 3ECAA 3KZVA 1SG9A 3UGQA 5F73A 2FMHA 4RY2A 1YS9A 1VCNA 3W9SA 5CDGA 1OYVA 2A5FA 2AHOA 2OG1A 1MABB 2VQFB 1LQUA 2CLDX 2BGKA 4KUEA 4EFDA 4FMCF 1EVYA 3DW3X 2R00A 2R4UA 4UFPA 3OZUA 1A9SA 1KZGB 2GM9A 3UMGA 2FN3A 5DYWA 2O8NA 2QN9A 5HDQA 1PZXA 3OT5A 4HY3A 1E7RA 3R9IA 3P9QA 1GPNA 3EPJA 4WNYA 3O4GA 1DL5A 2CJYA 1EX9A 3WL3A 1Q50A 4RIGA 2AX3A 2NQTA 3FBGA 1OLSA 3SEZA 4CG0A 2ZLBA 4ND4A 2PYIA 1GZ5A 3BERA 2BP7A 2RCYA 1DG9A 4D9IA 2BOVA 1TTTA 3FSEA 4C0BA 2ZETA 3R3WA 1NQOA 1PR1A 2ODQA 2FX5A 1RVDA 2ZRIA 2IQIA 3PGVA 4R51A 3RSQA 1XNRB 3AM1A 2FRDC 3TQRA 3P0JA 2QPTA 3CY6A 2E4YA 1XYYA 4O2AA 4RZHA 4XSGA 5DJ5A 4YXWA 2HA5A 3ZH2A 5C51B 1LSSA 4S1OA 4OFWA 2CZCA 4DQKA 2QDXA 4QREA 4BX8A 1A2BA 1I3OA 1YJXA 4FJ0A 4UOQA 4DM3A 3A58B 3PDJA 3PS9A 5T4FA 4AMYA 2OPBA 1Q1GA 2PJUA 1YA8A 4MUFA 4G3XA 3VR3A 3LBAA 5EHXA 3VU0A 5CFRA 2BMFA 3D4OA 5FBVB 1NASA 4L6CA 3WRXC 1Z73A 4NYIQ 4ZO7A 3D2BA 4OYLA 1SCQA 4X60A 2ZWVA 4HNAA 1JS1X 4XVRA 4YQYA 4CLOB 8ATCA 1KPHA 3QMVA 3B5IA 3GFSA 2BGNA 4FZRA 4FTWA 1ZW6A 2KSQA 3DL4A 2BM8A 4MWCA 2CDNA 3II6X 1TK2A 4KE9A 3KP1A 4DCJA 2QN7A 2EZ4A 1Z5UA 2FXIA 5LP6B 2BSXA 4G37A 1HLPA 4HXYA 3AERA 4CT0A 1K9VF 5F5NA 1GNSA 4O8ZA 4V03A 4XIIA 2OEPA 2QPLA 4JQYA 1XDUA 2HQRA 3DL7A 5E0OA 3TCNA 3M4ZA 1MV8A 1G8PA 1IXRC 1YFZA 1QLWA 4GUDA 4P4GA 3VO8A 3THXA 1T3HA 2YFHA 4BIMA 1F3OA 1PS8A 3EXHB 4PBTA 5D00A 3SQMA 1WPGA 5LD2B 2O8CB 1L7MA 4U39A 4NDZA 3FETA 3NV9A 3ND7A 1FFWA 3VC3A 3RANA 2GPYA 1IOVA 3TSAA 1XVAA 2AC4A 3HJNA 3D6UA 1YE5A 2ZZMA 1IN1A 3EWNA 1NATA 1IULA 1R8XA 1XTUA 3QJGA 3QG1A 2H2IA 2QQGA 3ZJYA 1BJTA 3VNVA 5F1PA 1KXZA 4YRBA 4Q3OA 1ZESA 3Q87B 2IHNA 2NP6A 1O97D 2P4SA 3NORA 4Q1CA 1ZN7A 5L3ZA 3FNFA 3CUUA 3HGMA 3VU9B 2UVDA 2GEVA 3CNEA 4EHIA 1EFRD 2QP9X 2YXBA 1U7OA 3GOHA 5KNCH 3E8SA 4BVAA 1G55A 3A3YA 3S1SA 4HDSA 2ZREA 2XCSB 2AOVA 1UQTA 5HR5A 3DF7A 2BV3A 1PJAA 1OPRA 2QZJA 3BDAA 1YQEA 2X13A 3ETNA 4JC0A 1J2RA 3NHLA 2W6NA 4NCKA 4RPKA 1DJPA 1KI6B 4MA5A 2OO5C 2YJGA 1L8QA 2WKRA 4P2GA 4A8JB 4DV7B 3ETEA 1UBSB 2ZYWX 3HMQA 1R0YA 1RWNA 2G7ZA 3RTBA 4ARZA 1RTKA 7ADHA 3QU2A 4EGQA 5B58T 4FYHA 1WCXA 4Q39A 4MNTA 2HQBA 2ZWMA 1LLDA 2GT1A 4DWJA 4AZSA 2MOKA 5K1ZA 4DXHA 4UNPA 3EARA 4JLKA 1OX4A 1AG9A 2HDOA 4J6FA 4L95C 5K3DA 3WO1A 2OAP1 1YO6A 3PJDA 3MGGA 3RNOA 5JWOA 1CBUA 2ZT7A 3HH8A 1P2FA 1IWBB 2O2CA 4GEGA 4C5BA 2RGRA 2GCOB 4TS1A 3OOYA 1E3EA 3BTVA 3RYCA 3SYMA 3QELB 3HR7A 4V3CA 2O14A 1QO7A 1XDZA 3K09A 2AFVA 2AE1A 3QMWA 4GOXA 3VV2A 4AO6A 4G0WA 4O8CA 4UTOA 1FFSA 3L7OA 3WK8A 1YDWA 1WQ4A 1P7PA 1QHHA 4MIOA 2VJNA 1WKCA 4Y6QA 3SIWA 1AKWA 1NBEA 4BNJA 4D96A 1B7GO 3JAWA 5EIWA 1P5FA 2VQDA 5CURA 1HDRA 2FWNA 3GG9A 1NUQA 3GRVA 3UHJA 4F6LA 4PC3A 3QXJA 2VQ3A 3ZHSA 2ZIUB 4P4UA 4ZVVA 1FUEA 4ZXPA 1BOOA 1I7SB 1DC3A 2J5QA 3L7DA 1L5GB 5ALFA 4WCDA 5JIBA 2JGNA 2PUWA 3HADA 4R0VA 3K9GA 3LPMA 2O2JA 1HRKA 2ZTHA 3OM9A 4MS4A 4Q48A 1J7KA 4OREX 1Z68A 4JP1A 4NICA 3WJAA 1WHTA 2ZBGA 2IHJA 5FV7A 4ALNA 4YLEA 1TL7C 5KYTA 1ZOSA 3KOYA 1NFFA 5G0VA 5THXA 3W34A 1WDMA 3NASA 4C7VA 2GKOA 5KSWB 1KI9A 3IALA 2BEJA 3KQQA 4I7EA 3UK7A 4AS3A 1V7PC 4I1PA 3GA7A 2YN4A 2Q7XA 3ILYA 5B3KA 1DXHA 2ZSFA 3QY9A 1FUIA 1IBSA 2A9JA 3ZV5A 1CDEA 3IO3A 1P4GA 3M3DA 3TQOA 1GEGA 3I30X 3JYHA 3TAXA 4DDHA 1H42A 2NU6A 2V03A 1N5RA 3GVIA 3L1JA 3V2GA 1JYEA 4F12A 3WVNA 3P9ZA 4YJ2A 5FEUA 2BEWA 1VJGA 4RWEA 1AUVA 1C4WA 3VVCA 3ZG6A 4RMNA 3IBGA 3BXXA 1TADA 5JY1A 3FPFA 1M2OA 1M6YA 3C98A 1EXDA 5EZYF 2YIVX 3UQZA 4CTOA 1EX1A 3UANA 4PGFA 2CB0A 1PFUA 4JB3A 4TMWA 2B5WA 1E2DA 2GCIA 1P7YA 3BRWA 5EY5B 2P3SA 2YWGA 4KCGA 5EWJB 3DLTA 4ARCA 4H0FA 4YJ2B 1R27A 3FCUB 1SXPA 3JVUA 1VB5A 4W5JA 3KEGA 1NLYA 2XWBF 3ICOA 5KDDA 4RZUA 5KWEA 4ZGBA 1JMYA 4H6XA 2LWIA 4KQCA 4OKNA 3ANTA 4HDRA 1YVDA 3ML1A 5I9TA 2HDNB 1H5UA 5AVRA 4HGPA 1Z39A 2HBZA 4R2XA