1K9VF

Structural evidence for ammonia tunelling across the (beta-alpha)8-barrel of the imidazole glycerol phosphate synthase bienzyme complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
MRIGIISVGPGNIMNLYRGVKRASENFEDVSIELVESPRNDLYDLLFIPGVGHFGEGMRRLRENDLIDFVRKHVEDERYVVGVCLGMQLLFEESEEAPGVKGLSLIEGNVVKLRSRRLPHMGWNEVIFKDTFPNGYYYFVHTYRAVCEEEHVLGTTEYDGEIFPSAVRKGRILGFQFHPEKSSKIGRKLLEKVIECSLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural evidence for ammonia tunneling across the (beta alpha)(8) barrel of the imidazole glycerol phosphate synthase bienzyme complex.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords Amidotransferase hisH
total genus 60
structure length 200
sequence length 200
ec nomenclature ec 3.5.1.2: Glutaminase.
pdb deposition date 2001-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00117 GATase Glutamine amidotransferase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1k9vF00
1GGEA 1UCFA 5SY9A 1O1YA 3CNEA 2GK3A 3CZAA 4E5VA 4BFLA 4B40A 2OR3A 4P2GA 1I1QB 3GRAA 4ENQA 4ZGGA 2XF2A 2WJZB 4ENPA 4AUMA 1R9GA 3FIJA 1IPHA 1CF9A 3CYFA 3B3AA 2ABWA 2NV0A 2LXNA 2YWDA 3BWEA 3L3BA 3PQ6A 3EJ6A 1BXRB 1KA9H 2VDJA 4Y1FA 1OI4A 1P5FA 1OX4B 2GHRA 2V4UA 4Y1RA 4P35A 4D1YA 4L8FA 1N57A 2R1TA 3PQ4A 4UZSA 4I4NA 4GUDA 4QYTA 1JDBC 1C3OB 2ZUVA 1IZYA 4RKWA 3ER6A 3R74A 1VCNA 3R75A 3TTWA 3SF8A 1Q7RA 3PQ3A 3UK7A 2AD5A 3TTSA 3TQIA 1JVNA 3M3PA 3VU3A 1P7ZA 4UOQA 1GGFA 5SY4A 3PQ7A 1CE8B 3CZ9A 3F71A 3OT1A 2NV2B 3CY6A 4ADSG 4ENVA 3B36A 3NOQA 1SOAA 4OFWA 2VXOA 5SY6A 5LIRA 1T0BA 3PQ2A 4R7GA 5K4AA 4MGHA 5JZMA 2VPIA 4OQ4A 1PDVA 2ISSD 2D7JA 2YWBA 3R76A 3P9RA 3ZR4B 1SY7A 1ONSA 1P80A 4OGGA 3NONA 4L78A 3RHTA 1KWKA 4B7AA 1P81A 4GE0A 5E9AA 1CS0B 1FY2A 4ENSA 1GPMA 2ZUUA 3PQ8A 4PXYA 1WL8A 1OY1A 3L4EA 2IUFA 1PV2A 4QYXA 3SOZA 1GG9A 1OX4A 1KXJA 4ZDKA 3OT1B 3EZGA 3KKLA 1VHQA 4UCFA 4L95C 1GPWB 2ZUTA 1A9XB 1KWGA 1Q2UA 2RK6A 3N7TA 3TTVA 1PE0A 1QWSA 3MIIA 4JQSA 3F5DA 3SF8B 3UJNA 4WXYB 1C30B 3UMMA 3BHNA 2VKTA 4XLLA 4BIMA 4UOZA 3TTXA 1QVWA 1VCOA 4MTCA 1KEEB 1OX5A 3NVAA 4P36A 2R1VA 3TTTA 4OIFA 4N0MA 4P5PA 4N12A 4AULA 4AJ9A 1P7YA 1QVZA 4RKYA 3NOVA 4B31A 3L7NA 1VCMA 3EFEA 3FSEA 4ENTA 2R1VB 4B5KA 1I7SB 4LGYA 4E08A 2YWJA 2FEXA 4Y0NA 3D54D 1OX6A 4MNTA 4P34A 4OGFA 2H2WA 1K9VF 2AB0A 2RK4A 3NORA 2R1TB 1S1MA 1G2IA 1PDWA 4I46A 4BTEA 4GE3A 4L8YA 4UNIA 3L18A 2RK3A 3ZJ4A 4AUEA 1I7QB 3EN0A 3NOOA 4ENRA 3MGKA 1U9CA 2ZUSA 3P9PA 5SYAA 2W7TA 2ZUWA 4OJYA 1GGKA 2YWCA 3P9SA 3UOWA 4ENUA 1QVVA 1QF7A 2VRNA 4LRUA 4ENWA 2R1UA 4Y1RB 1IZZA 4ZDJA 1J42A 3ZJ5A 1T36B 2A9VA 5DFAA 1L9XA 1QDLB 1FYEA 3TTYA 3WFZA 1GGHA 5BV2P 4K2HA 4HCJA 4L8WB 4Y1EA 3TTUA 1T3TA 4ZDIA 3UGJA 4S0ZA 3EWNA 4Y1GA 1M6VB 5IP5A 4I2NA 3PQ5A 1GGJA 3B38A 3P9QA 4L7QA 4B2YA 4WINA 4AUNA 5JZOA
chains in the Genus database with same CATH superfamily
2JNWA 3WK9A 5E9JA 3IKLA 3EBPA 1BA2A 1RAGA 2OKCA 4F2PA 1U0RA 4UXJA 2BKUA 2KPOA 3OLYA 4PRKA 1JQDA 2QRHA 4D4GA 2WDPA 1FYVA 1G8FA 1QZTA 2EKLA 3D4OA 4LCEA 4QGHA 4I3HA 3KB2A 1XTSA 4ARZA 4D9GA 5KSWB 4N1AA 3EXAA 3MWEA 2A3NA 2LIVA 3KV1A 3FCUB 1ZD1A 1YOBA 4W1RA 3LDGA 4NXNB 1U63A 1AIPA 4ND6A 4MUYA 1DT3A 2FX5A 1UUFA 2YJNA 4UNPA 1CU1A 2RC6A 3N8NA 3CLSD 5IVKA 3M5DA 1NATA 1AKWA 4I66A 1OXKB 4Q05A 3I9KA 3N6RA 1WEHA 5G4KB 4IZOA 4WZAB 4D3ZA 3ER8A 4XUEA 3ZOKA 1H4VB 4I4TA 2R68A 1M5RA 1IATA 2DY0A 2YMLA 1DOAA 4FFDA 3OZGA 5LQAA 4MV4A 2QRMA 3B53X 4OG2A 3D6AA 3S3TA 3TOVA 1YL5A 4GLBA 4XYMA 5JH7A 1RZRD 4HLDA 2V6FA 3KP1A 1G63A 2JF0A 2VWPA 3GRFA 4M9ZA 3QXHA 4HRVA 3UH0A 4MPRA 5L4SA 4J43A 3K0FA 3TXYA 2I66A 2P6PA 1MAUA 2Q9CA 3LQFA 3O1LA 4B75A 4P0TA 4XRGA 5C8DA 4D9IA 3ROZA 1QG4A 1E9BA 1KMNA 4LQCA 1CZKA 1N6LA 3U5ZB 3P7MA 3SWWA 1DBQA 3KKMA 4NBNA 3ILVA 4BZQA 2IQ5A 2C61A 3DKVA 2OY0A 3OQHA 3O8OA 4HUJA 3NW9A 1Q7BA 3W1VA 5EMJA 1N3LA 3ZWWA 2XCTB 1PGQA 2Q7DA 1DARA 4KUGA 2WP8J 2CLIB 1JU4A 2XCIA 4NLLA 4IVPA 1M76A 1ORWA 3DLIA 3HKDB 4R41A 5E3IA 4ZVMA 4BFUA 3TLZA 4EL5A 5BT8A 1V47A 1KP2A 2WP0A 1E3IA 3DVRX 4C04A 1E98A 1JWBB 3HDVA 4MQ5A 2EW1A 3JZFA 4YJ2A 1LI4A 4AI6A 2R8OA 5AK5A 5ENVA 4XDGA 4A6EA 3B1VA 2C7OA 1R6UA 2YINC 1DC4A 3KOWA 4UTRA 2HM7A 1MAAA 1EQ2A 2X1MA 1Q77A 1TUBB 1EEHA 1KH3A 4PZDA 4LF5B 4R2XA 2ZULA 3QA9A 4WACA 3AY0A 2J3DA 1KI6B 3NXKA 2PUEA 4OGFA 4QXOA 2RJOA 1SPXA 5EE3A 1SZDA 2JI8A 3KE8A 3NHZA 2GNAA 2YJ4A 3E9CA 4AG3A 1KAEA 4BWGA 1IN4A 4ZZIA 4GPIB 3WI7A 4A16A 4GE3A 4W5OA 4LSMA 1ZMOA 1GPLA 1WHTB 5IHPA 5IKPA 2ZUEA 4YO7A 4NIMA 5ALMA 4EB6A 2XBMA 3VR2D 4UUAA 4LUCA 2VAMA 1OILA 1EWQA 3QH4A 2WTBA 2VDOB 4IIXA 5DCWA 2DQ4A 4W82A 4OH7A 3FGNA 3WFZA 1HSOA 4AJ2A 2FQWA 4HAWA 8LDHA 5B53A 4R84A 4TKVB 2QZ9A 4ZEXA 1SIWA 1KY2A 1FMCA 1P0FA 2EHDA 4Y6PA 3DBHB 4JP8A 4JV5B 1L5MA 1II8B 2BEWB 4MWEA 5HKKA 3R3YA 3COZA 3P9QA 3Q2OA 4YO8A 4XWKA 1XEAA 4JB0A 4WXEA 3EZ2A 5CA1F 1J09A 1FJHA 1XROA 2UVQA 3KVOA 2AK3A 4CPDA 2C29D 2O2IA 2ZU0C 1E99A 2Y93A 2XMPA 2QX9A 3AJ9A 1OUMA 2GOYA 2W6ZA 1DTEA 2CKMA 2JAUA 2ZIXA 3LXXA 3S4YA 4IGFA 1L5HB 4Y8VA 1T2VA 1HM5A 1Y9EA 1SCKA 3H04A 4HF7A 2XF2A 3TDKA 5M34A 3A27A 2E82A 3A0UA 1JEYA 1KMQA 4QXQA 1UJ5A 4OJQA 7YASA 1GPBA 4RF5A 4EUFA 2ZTSA 5IXJA 2W6JD 4C87A 3N2YA 4AXBA 1J00A 1SCDA 4QICA 4TPKA 4Y1RA 1DAKA 3VPFA 4AT1A 1EX9A 5KS2A 1QX4A 3PQ4A 2C5BA 3RK4A 3HE3A 4DLPA 4Z7QB 1JLSA 2BSAA 2A67A 2I8CA 2J1LA 2W2NA 4R2MA 2Y0EA 1S3IA 3C4JA 4DXDA 4D25A 2JGKA 3NETA 3WRVA 1RHRA 4XIIA 4O2RA 1O8CA 1SXJB 3TNJA 5I47A 1O0SA 2IYNA 1WCXA 3LCRA 2R47A 2EDCA 4GGPA 3OT5A 3D4IA 3I9NA 1P31A 2I4LA 5K8IA 1BX0A 2YVQA 4YP6A 3SC2A 4JEIA 3WYAA 1BYIA 4GZ3A 3F71A 1MOZA 1SXHA 1QKKA 2OPHA 4FYVA 1MDFA 5HKBA 3TRIA 2XUPA 2M2IA 1OROA 4FGSA 3V7WA 4LDZA 3WJ1A 4D8XA 2C5GA 3T0FA 3K6SB 1FP4A 4XCQA 4WJZA 1RXEA 1ZSNA 1GYPA 5J59A 2G1UA 3U40A 1I3NA 1A5TA 3ZH9B 3ZNNA 3ORSA 1QKJA 3HXKA 4YAFA 1GZSA 2Y0PA 1G5QA 2QR5A 4HX2A 5U9CA 3A1FA 3V2IA 3K2QA 1GL6A 4KDRA 2IBMA 4YONB 3WYCA 2GK7A 2IOYA 3TGWA 2BHLA 2C82A 4R69A 5AUOB 3U4QA 3V7YA 1XKQA 3U4MA 2MINA 3CTMA 4JP1A 4U2BA 3SYKA 3TQSA 2B8WA 1LPBB 4ACBA 5CB0A 1K7SN 3WL7A 1C30B 4RKEA 2IDZA 5JSHA 1GNRA 1WCWA 1VCOA 2PD6A 3ECAA 4KQKA 4LYFA 4RSRA 3VR5D 4BNFA 3ZGZA 4U2FA 3DKRA 3ROKA 4Q4CA 4NAHA 4ETWA 2GRJA 3VYSB 3E5MA 1P60A 1KI6A 2BC9A 3K9BA 4YP1A 4RD4A 1KAOA 1W36D 1E92A 2ZJ3A 3DQPA 3GFQA 4HATA 4ER3A 1E3WB 4QFBA 2Q0SA 4RY0A 4EY3A 1JAXA 3KC2A 4JLDA 2B4AA 1S1MA 1OLSB 4WFJA 1C0LA 3SPXA 3MHPA 4FYXA 3DBIA 1CUUA 3PDIA 4ABTA 1MVLA 2PMEA 1M2GA 3B1YA 5EJ8A 4U2KA 1KYXA 2D2VA 1ADCA 4TS4A 5DV9A 3EIEA 1L8AA 1ZEMA 2C2MA 4MS4A 3A1UA 4CN8A 1P17A 2ZI3A 3R5TA 2ZREA 4NMXB 1Q0QA 2A58A 4IJMA 1ECJA 4C78A 1RQ7A 1XJQA 1O95C 1ESEA 4R9VA 5EXSA 3RIXA 2N42A 5GONA 2WIDA 4A3SA 1A8SA 4OP2A 3R6TA 1V8BA 3PPIA 3PZRA 4QGFA 5DX0A 2WRZA 1UBMS 4FKZA 5CEJA 1M6VA 3LQKA 1FCJA 3ZD8A 2EIHA 3IE2A 2XTJA 3EF3A 3F1KA 3V1LA 1GAXA 1ZJ4A 3OU2A 3I32A 1RVV1 3MELA 2KQUA 3QLEA 5I4BA 4G1CA 1SIOA 2RAUA 4PPGA 1BH6A 3V48A 2WZBA 3CA8A 4JLNA 2YNMC 3L8ZA 4FN5A 2VP6A 4OXKA 2YV2A 2VF2A 2D74A 1EDDA 4S1PA 3O7MA 4OOEA 5CYOA 4RIEA 3TIIA 1XEXB 5CYFA 4C3OB 4PLHA 3CX3A 3CX4A 3FRIA 5K8CA 1NUPA 5ICGA 4P0QB 2C5AA 1YQTA 2NSDA 1CWUA 3A28A 4B32A 2Y99A 3DQZA 4W8GA 3BWVA 4PC6A 2O8CA 2C4KA 3P2MA 4CQLA 1L7XA 3SR0A 1RRKA 3ZGNA 3O0TA 4B4KA 2YWEA 1E0SA 4YCBA 4KPUA 5ALNA 3TXXA 1CR0A 4DLUA 3TZKA 3PXUA 4EO7A 3HDQA 4KN8A 2ZZKA 4AL4A 2BSQA 4QD3A 3I9V1 3ZNQA 2GCOB 5F35A 2B21A 2WB4A 1M10A 2YS7A 4UARA 1U9IA 1E9EA 5JZ9A 3FWKA 1ZN8A 4A2QA 1SG9A 2H29A 4Y6SA 1XMXA 3C5EA 5JRZA 4GO1A 2BFNA 3D4PA 4TMXA 3OFSA 1B93A 1OY1A 5KU1A 3RTDA 1KXZA 2M1ZA 2FCAA 2Y2VA 4NBKA 2RGEA 4LRYA 1WW8A 2YR0A 3ZIAA 2JCYA 5FL7A 2W98A 4CHTA 2VJMB 2DZDA 3LL4A 1A8PA 1TZ2A 4YRTA 3EAFA 2PKQP 2QB5A 5JAHA 2IPLA 4V2UA 2JD0A 1E62A 3IULA 3SJCA 3ZHZA 5C4MA 4LSGA 5HTKA 3TTXA 3I9JA 4LPSA 4EMTA 4CLOB 2DQKA 1A82A 4D98A 4PZLA 1NXWA 3MFQA 4ZODA 6NULA 8MHTA 1ORDA 3L8YA 4DGQA 4US2R 4FE4A 3A1EA 2QV7A 4FMDB 4OJKA 4QLOA 2VVTA 1ZJWA 3OKCA 4G81A 1EAYA 3K5IA 2JGDA 4Q0MA 4X97A 1DAOA 4P4SA 1E4YA 3ND5A 4EHBA 1VRCA 1W25A 1XYYA 1Z0FA 2ZW9A 3CF4G 3RLFA 4D80A 5THKA 421PA 2R8ZA 4O4JB 3W9YA 2QE7A 2JBAB 2WM3A 1Z83A 4GR5A 2XUFA 4JWTA 4OHWA 4YROA 1O08A 4BFCA 2JIBA 5G0SA 5FPPA 2NX2A 1RWBA 1L4FA 3W3AH 4EW3A 5A4MS 3F9RA 1SVNA 3ZE2B 1E1MA 1M74A 1RZVA 4IWNA 1VIMA 3PHIA 1QF7A 2QENA 1SZPA 2D00A 1M7HA 4MVWA 4IQFA 3TVTA 5K6RA 5HVNA 3E9DA 2G4CA 1UMDA 4GZ5A 1D7AA 1YZKA 3E48A 4H4DA 4HPWA 1QIIA 4JYPA 3D4BA 4I5FA 5IUNC 4FZRA 1YTLA 3EQ6A 3LECA 3NBAA 3GO4A 4L5JA 3QMVA 1RM3A 3DDZX 4QOGA 3K53A 1K7YA 1TOAA 1DXYA 1HETA 4WY8A 5CP8A 4YEDA 1IJFA 3MAGA 1FDWA 4BVHA 1CG6A 2H1SA 3OVMA 2I7CA 4B9AA 4BVFA 1E66A 2HRRA 4AN0A 4QDJA 1HFWA 1AN0A 1MRZA 2VYVA 2CV0A 3VUFA 3M6AA 4UHFA 4RF4A 5A4AA 4BKMA 3IX7A 2JS7A 1G20B 2IZOA 1E1QA 1NA5A 1DTWB 2PXXA 4M22A 3GNQA 3WO0A 1L0BA 1ONOA 2I3BA 2Z8YM 3QELA 1T2EA 4IY1A 1T8YA 2ZUDA 4A9AA 1I2ZA 3QKIA 1YS7A 2JFWA 1P91A 1DV2A 3O3OB 4JLWA 3T3OA 1E7QA 2ZI9A 1P6XA 2Q5EA 3KU1A 3HP7A 4QPNA 2QL7A 3QUCA 4KV7A 2WF8A 1TJ4A 4QTXA 1GDTA 3GLGA 4PNHA 1PJRA 2PMFA 3HA3A 5AOCA 3DLCA 4KU4A 2J5QA 3UMFA 1Q21A 3QVXA 3VNSA 4ZJPA 4JX8A 3OCCA 4M9XA 1GZVA 3V6MA 4WBXC 4KXQA 3FCAA 1K1EA 5F1KA 4C3VA 3KQLA 4J76A 1N5OX 3WSWA 2Q29A 1W85B 1EUCA 1HYQA 1AUPA 1H9BA 3OQJA 1OR8A 3FMGA 3NMUF 1BX3A 1OLUB 1OT3A 1P1IA 3MCAA 2RGAA 2Z56A 1E2PA 3REFA 4WN3A 4W99A 1I3KA 4GS5A 4EEZA 4IQ4A 2LD4A 2O05A 1RBYA 4JQZA 1WUKS 5CVJA 4ALMA 4BLQA 3E15A 2C20A 1P2FA 2RGBA 1JBKA 1SCJA 3FN4A 5C9ZA 5CEFA 4WBNA 1XRLA 4Y2RA 3IEIA 1NMSA 4XFDA 4ENSA 5KSPA 1P3JA 4LXUA 3F8SA 5HP4A 1FUEA 2IF0A 1XUOA 2QVLA 4IUBS 4D8TA 3E70C 3PD1A 1NVTA 4BOYA 1ACJA 3WWYA 1XU9A 2VDMB 5KYWA 1U8EA 4P1ZA 1GPWB 1KJ8A 3F6YA 3MTDA 2M98A 3WP1B 3IT1A 1P3Y1 2X7HA 1GNSA 3C6QA 3T8YA 5EZ6B 4PZAA 4TMTA 4AKTA 4EDHA 1D1SA 1H2BA 1SC9A 5F51A 2ZYAA 3OA0A 4AD8A 3N5CA 4NARA 2GJ4A 1UZNA 2BFDB 2YHSA 2Z5FA 2B1IA 4AJ9A 4L9SA 1GVNB 1NNUA 3C6KA 2P9ZA 2UUPA 1N5KA 1BVYF 4FFLA 4BB0A 3EEIA 5AK3A 2PBFA 1M67A 2I4IA 3JWGA 3OQPA 1MVOA 1OC2A 3BEDA 4NENB 1XWWA 1DSSG 2C8JA 3NDIA 2AN5A 1OBCA 1PT7A 1T10A 3B6ZA 4UCXA 5DSXA 4BCDA 3RAEC 5B2FA 1NSFA 4PZCA 1KIFA 2G4LA 3G82C 1VSQA 4I14A 4QXMA 1HDYA 1NTOA 1LX6A 2Y1FA 3K4HA 3ND7A 3IMKA 2GTPA 4S1NA 1E4VA 5A71A 3DKIA 1K66A 4Q7JB 1Y7HA 3KPVA 1OXUA 3DFUA 1I30A 4R81A 2NXWA 1JEOA 4WCVA 1T36B 4O1IA 5H0IA 2I03A 4QNRA 3PXDA 5CTJA 4HLUC 2X8JB 4RNDB 1DV1A 1RAHA 1LD3A 2JCXA 3TUIC 5BV2P 2VBFA 3WL8A 3LC0A 4KN5A 3RJ5A 1XU7A 5KJCA 4YECA 3STUA 4QT4A 2FR8C 5U4XA 1EVYA 4M0UA 3DAHA 1J24A 2PHZA 3L4SO 3ENZA 1Y8QB 3QFTA 1KI7A 1L6RA 1G20A 1OV6A 1PDOA 3ABIA 4GQIA 3C43A 5EPOA 2JIMA 5FBLB 2IX3A 1YIDA 2CVFA 3OKAA 2H7CA 3IALA 4H77A 1X7XA 4RQBA 3G9TA 4V0QA 5DRYA 1U0NA 3OPMA 1U0GA 4KQGA 3SBEA 3VO9A 1GA1A 4FWTA 5EEGA 3IPXA 4G3XA 1AG9A 2PGDA 4DYVA 3UAZA 4ZCMA 1CXZA 3RPEA 1E63A 2XQKA 5TQJA 3U3OA 2F4VB 1EWKA 5FI5A 1TMOA 5HM8A 4NX2A 4OLHA 2JLCA 1B14A 4LK3A 4W9RA 1YFZA 3TJRA 4A15A 1KDTA 2PEYA 7GPBA 3GN2A 2XF8A 1SQFA 4HH1A 1KIAA 2XQIA 1KPIA 2UAGA 3VU9A 1LC0A 4JL5A 3M6XA 4LGMA 1LPPA 2FPPB 1N3IA 1WKVA 4WASA 1GFZA 3NAZA 1T9DA 3NPAA 2UU9B 3KTFA 1JPNA 2OG1A 3G17A 5JDCA 1FX1A 1XCMA 1KZ7B 2UZ1A 3AY3A 1C9YA 1RI1A 1ZIYA 1H3FA 1Q83A 1W1WA 2B69A 2QD2A 3C8UA 1SQ6A 1LRKA 3N6VA 4ALLA 4EGCB 3L6DA 3CH5A 1W76A 2FFQA 3FI9A 2KX7A 3KXLA 1ZONA 5BWCA 1ZOIA 3VM6A 1QH8B 2VTDA 3PL5A 4IIBA 3FMOB 4RZXA 5AXCA 1Z39A 2PNJA 1QDEA 1WDMA 3ENQA 4HC4A 2W6ID 4M37A 4MRPA 5AKZA 5HE9A 4EB6B 4YRNA 4C21A 1OXXK 4MQMA 4NP6A 5B2EA 4EW1A 7ABPA 3QLTA 3FYTA 4TMKA 1B1AA 1E8NA 5BSUA 3I52A 3HJAA 3TS1A 4B7XA 4F4FA 4Z54A 1LZKA 5TC4A 4JT4A 4IMPA 3T7IA 3KDPA 3AZQA 2Z9CA 3V00A 4FEGA 1F4VA 2HMYB 3N2EA 4P36A 1IZ7A 1E9AA 2IV7A 4P5PA 2EWVA 2QRNA 4B79A 1YMVA 3DAGA 4RKYA 1P0CA 5K03A 3OEEA 1EFPB 1PKEA 2FZ5A 1OU4A 3IAXA 1ZM3A 3A6FA 1MQSA 3A1SA 2ZR8A 4OIMA 2H2HA 4GLJA 4S1WA 2CV1A 1A2KC 3ODGA 5KYXA 1Y3AA 4L72A 5H59A 2XLBA 1N77A 1YKSA 3L2OB 4L5YA 4LZOA 3TPCA 1O96B 2O8FB 5LR6A 2XVAA 2GPNA 2F3QA 1L1RA 2NZ8A 2PQ2A 3I73A 2XSZD 1MJGM 2QPAA 3W3AD 4X66B 5LXTA 3QX8A 1QIGA 2C9OA 4TV9A 2SNIE 5CK5A 1XO1A 3ESRA 4ALIA 2P8JA 3ROEA 1P2BA 2NZUG 1E1LA 2PTGA 3FFBA 4AG6A 4R8LA 4LJ8A 2CL0X 3V4OA 5BORA 4BVBA 5DHTA 3HKDA 2ID7A 1S3GA 3SHTA 2W5UA 2ZBFA 2QGZA 3TW8B 4YI5A 1QVRA 3UVEA 2WIBA 4N8SA 2FAXA 1V8DA 5HE8A 2HXSA 1V7CA 2OMEA 1ZU4A 3OTHA 2GKGA 2BFFB 4UEQA 2WSBA 2JL1A 3NBKA 1JIXA 1Z2NX 4F4IA 3LTEA 2QVGA 3L06A 4NKRA 2FW6A 1PK7A 2PH3A 1JLMA 2VYVD 1TEXA 3GF4A 4Y3UA 3FDZB 3N8IA 3P9NA 3PICA 4JUCA 3GARA 3GY0A 5C1BA 1TRKA 4QECA 3BXFA 3EXG1 4CIWA 4YTEA 4FYIA 4MJLA 1JFRA 4AZSA 5KOYA 1DX6A 2WR8A 1XNGA 1L7VC 1VJRA 1QCCA 2R97A 1DEOA 3EJ6A 4KN6A 2OGSA 4Q7KA 5LIPA 5AI6A 4P35A 1V2HE 3A10A 3G7UA 3UJHA 1MHTA 3EY9A 2OSVA 1YZTA 3QU2A 1U1DA 3T7TA 3WOHA 4IQ0A 2MINB 3RVDA 4RKWA 3TD9A 2C2ZA 2Z57A 4FGKA 2YIMA 2JARA 2GF0A 1YVRA 1NM5A 1FE8A 1XWFA 1RP7A 2TMDA 3GEMA 1CIJA 3QKSB 4R1UA 4RIIA 4ZQIA 3RSQA 3NTLA 4EFKA 1YZLA 3LHKA 4IJUA 4NZYA 1DC7A 3LQ1A 1C0PA 4I55F 2UZ1B 5FBQB 2VH1A 3IC5A 4L3WA 4Q9AA 5KYGA 4IH1A 4YRLA 3TZLA 3WY9A 4RTRA 3ELWA 2EG5A 3T4EA 2BZ1A 4W5HA 1B0AA 2SKDA 5CNIA 4C5BA 4D3XA 3H16A 4D97A 5BPFA 2JFHA 3HKEB 5HCNA 5CX1B 3RC3A 1Q7TA 3ND9A 3QFRA 3REOA 1Z2OX 5F3WB 3NYQA 5I7SA 1YA6A 1VM6A 2YL2A 1XX6A 2X4GA 1K5GA 3E81A 4HWTA 1A71A 1MV5A 3PYMA 4JMPA 4R3UC 5DGCA 3WIOA 3ZE8A 4DLBA 4EA9A 2ECPA 1CJUC 1TC1A 4ZFNA 1SUSA 3PA6A 2C3YA 3IKMB 4TUYA 2JIRA 3BD8A 3PKIA 2O5EA 3OT1B 2ATEA 3NV9A 1DXQA 1N5IA 3ITNA 1L4HA 4O8ZA 3ICCA 1FNCA 3GEPA 1U2RA 2B5VA 1A0OA 1QQ6A 1YMQA 4ATNA 3M2TA 3LWZA 1DKUA 4QUJA 2GVZC 3T0GA 1F0NA 3BN3A 4BMCA 3Q8LA 1G17A 5ARDA 1EFPA 1JLLB 2OC9A 4DMLA 1FFXA 1SVMA 2F1RA 3F5QA 3ICPA 1QE0A 1QTRA 5AHKA 3JQPA 3TLXA 3EPKA 3OJOA 1ZZEA 1XCBA 4LE0A 4L3VA 5CT6A 1Q7GA 4NPHA 3JYNA 1H6BA 2J9FA 2Q8PA 1QORA 2RB4A 5E6UB 4A8JA 1W47A 3UM9A 3DM9B 4CLXA 1SB9A 2YHBA 3TMAA 3SIXA 2WWWA 3S70A 3ED5A 3E0QA 1Q95A 2A94A 1U3TA 2RIPA 1TM2A 4ZANA 2UZ4A 3PX7A 1TO6A 3ED1A 1TKBA 1FTSA 5IAOA 4HDNB 4F5DA 2JASA 4JN6B 2HPZA 3GJ0A 3UJ8A 3O26A 2OM2A 5BOVA 4CLDA 2R1UA 3U4DA 4HFRA 2IYAA 3OCUA 3D02A 2JIDA 1C7JA 3HDYA 3RF6A 4YJ3B 1TAUA 2BFFA 1NN1A 3IV9A 1EJ0A 1XAJA 4AG5A 1FTQA 4F3RA 1C30A 3NTQA 3O1HB 2NUBA 3IQHX 4UUMA 1IY2A 4EG1A 2OZPA 4XH9B 1A2QA 2A84A 4FDUA 5AVRA 2VJBA 1K8QA 1S2NA 1VHJA 4KQ9A 4XWGA 3WGGA 5DWDA 3G5UA 4PQYA 1JHQA 4AKGA 1E4OA 3NFYA 3CNEA 5AVUA 1GLVA 4N3CA 4DHEA 3P52A 3IQXA 1ZK4A 2B2NA 2V98A 3V8QA 3CNQS 4Q82A 2PSEA 4JI0B 3UT6A 2CFIA 3FUVA 3LQRA 1IPEA 2PZLA 5CDGA 2HBRA 1POXA 4L0MA 3QMMA 4A10A 1XL0A 3PJFA 1YIOA 4LGCA 4TTTS 1E1RA 4UTNA 1CUXA 1CRLA 1U65A 5DYTA 4L7VA 5JJCA 1SHLA 1Z0ZA 2DFKB 1EDZA 1Z4IA 2E89A 4GI7A 3P0HA 4JITA 1BWSA 2Z1MA 2WWRA 2YXDA 5INTA 4PLPA 1PG0A 4ZOLA 5H9WA 5DM70 2GTIA 5IAJA 4J4HA 4IFBA 1S01A 2C7QA 1U0BB 4XDZA 4MAFA 1EP1B 5FBZA 2J3QA 1WUTA 4HO1X 1NGSA 1ULZA 1WO8A 3G59A 2I80A 4J9UE 5AWFC 3SKYA 4JASB 3KPUA 3NOQA 2VTBB 1CR4A 1T3SA 3O83A 2H0RA 1XMPA 1AK1A 4ZAYA 3WQHA 1OXBB 5TNXA 1Z88A 3SHVA 2HIMA 2WVGA 2C83A 1ND5A 2W48A 3UAOA 2FXVA 3ESZA 2JKZA 3UHFA 2YASA 4JBYA 4GGOA 2B6HA 3U3XA 5BRAA 5EG5A 1A9XA 1YRBA 3EIUA 1LK7A 4MQFB 4WECA 4REQA 4ZOBA 3HLYA 5AKEA 3BMXA 3LL7A 4LZAA 4KL8S 4FFWA 2NU9B 1DKQA 4D57A 4RLFA 3TPFA 1LLQA 1Q2UA 3A4YA 2VZEA 5FBWB 3RSSA 4AKIA 4J3NA 5LQRA 2ZSDA 4EHNA 1DJQA 4Q3OA 5TVGA 4LDAA 4IUCS 3NI2A 2CHUA 1Y98A 1OLOA 1XQYA 3ZDDA 3EWAA 5C7YA 5JFOA 5ITZB 4UU8A 2DFDA 1PU2A 3OLWA 1U28C 9ABPA 5ALIA 3T54A 5LYJB 2C7RA 5JS6A 3OWOA 3VR6D 3FXAA 4XI9A 2NYRA 1ODLA 3QLVC 3W34A 4C88A 4R51A 4KXYA 4P5DA 1Z8NA 3DMFA 3EUAA 2VTKA 5EUQB 3TK1A 3ZVKA 1X1CA 1QQTA 4AJOA 5BWMA 3F3YA 1FJGB 1L5RA 3N0XA 4BKPA 1Z75A 2P78A 4YB8A 1RXIA 3PFNA 1MABA 4Q15A 3A11A 5EP3A 4ZV9A 2RAFA 5DEIA 2ZJ7A 3SSOA 1W5AA 3AHGA 1O87A 1IN8A 1IZZA 1KRWA 1YL7A 4EG4A 1DADA 1SQ5A 2YVAA 1ZUWA 2O7VA 4UJ5A 1DO8A 3W9BA 1LRLA 2Q0HA 4AF6A 1TJPB 4B3SB 3ME5A 1YI1A 1U2ZA 1R6XA 4FKMA 4B33A 4EHHA 5A4KA 2HEGA 2CB9A 5FLEX 3KJXA 3NLLA 1N6PA 2JFZA 3QKRB 3V8NA 2Q3MA 4KR3A 2JKVA 4G26A 4GBJA 1OIWA 1PP4A 1TU3A 3DZCA 3WLRA 5T3YA 3CJTA 3L8FA 3F97A 3OOEA 4S3MA 3X0DA 2Q45A 3PGKA 5I48A 2R4QA 4DFDA 4JSRA 4DNXA 1WSBA 4NZ9A 3KTOA 3ZJYA 1V16B 2EFYA 1ENZA 4RL6A 2BEUA 2ISQA 3OM0A 4N9QA 1N6NA 3K9QO 2BL4A 4QYMA 1NY5A 1Q0RA 5T6BA 2VK4A 3TLGA 1G3UA 3NTUA 2HLPA 2QNBA 2ZTLA 2AOTB 4HFJA 4DCGA 1B2RA 3KZOA 5CM9C 1FTYA 1JAIA 3L0IB 4JBXA 1T2FA 5G40A 3X1WA 2E5WA 4E14A 5CNJA 2PUVA 3R5SA 1W93A 1L7EA 4DT1B 5F7XA 3KALA 1K4MA 3GJTA 1PJ4A 3IAEA 4KO8A 3PEYA 4R9UC 3UY4A 5E8RA 3KD2A 3JAMA 3UMCA 1U5AA 2PT7A 2ZM5A 4HDQB 4R1LA 1UEIA 5JDCC 2DSTA 5EJFA 3ZWAA 3GRCA 1ZNQO 4YBZA 1ZAKA 2QK4A 1CCWA 1E96A 3UPTA 4ZI7B 3H17A 3DQQA 2ONYA 2OZEA 4ZZ1A 1ZXLA 4E6PA 2D2FA 4R2KA 1PFGA 2FMHA 4X54A 4LY0A 1V1JA 3T7KA 1H0HA 1WSDA 3I6ZA 4PZUA 5K4AA 4MGHA 3HTXA 5F9FA 3LCMA 3OZTA 3W0LB 2GJ8A 1RXUA 1DIBA 3A4MA 5HQ3B 1J0DA 1SAYA 1E6EA 1MA3A 1SHUX 2V59A 2VQDA 4EI7A 1U7ZA 2QDKA 4QSHA 1LVUA 3GDGA 1C3VA 3CVXA 1G1MA 4N5HX 4H7KA 4M54A 5H16A 4QRHA 4EABA 2HWKA 2XNSA 1ZBDA 5CFLA 4RKQA 2F6RA 3LGSA 4DREA 3TLBA 4G2NA 4M6WA 2JJ2A 3AQIA 3URKA 2G08A 2J08A 1H3NA 1N5DA 4JQSA 2F1JA 1HKUA 1ZIDA 2HO5A 2NG1A 2GLUA 3LT2A 3M4NA 2GBGA 3VH2A 4YLGA 1KGDA 4MPPA 2JJMA 3FNQA 1N4AA 3DP9A 4DCSA 2RG7A 4BVAA 5JQGF 3UT0A 3L93A 4AX8A 1SQ0A 2I8AA 3HXLA 3MQ2A 3BH7A 2FHPA 1MW8X 5GIOE 4Q9KA 3I6IA 1JYSA 2MSLA 3VNAA 4UU0A 4TRRA 2GCNA 3G8BA 3DKKA 3TSWA 5HCUA 3PHCA 4KIUA 3DPUA 3G1WA 3PTZA 4UNIA 2H31A 5AKYA 1Q7CA 3E5NA 3ISJA 3NOOA 5CX4A 1J49A 4OJYA 2A0YA 1T24A 2GHQA 3E7PA 3OO1A 1EK1A 1XQWA 3AHHA 3ANXA 5B1SA 4FC6A 3UUEA 4KFSA 2FMIA 3HR4A 4Z5XA 3KFLA 4NECA 3RU7A 3ZY5A 4C89A 4K6FA 3RRFA 1RTTA 3CJRA 4BASA 5F33A 3I5YA 1FDOA 1BE0A 5FD8A 3U3ZA 1JH8A 4DLWA 4FD2A 1XN1A 1MJNA 2BFDA 4HQLA 1DBPA 4JA2A 1NDHA 1AS2A 2JAOA 5DM2A 5ESWA 1AMOA 3D64A 3PEVA 5KWVA 1FTWA 4UVIA 1CT9A 3A3OA 2GBIA 3F67A 3EXHB 2AI2A 4TQUS 1EXDA 4XX0B 3PBKA 4C7VA 3AM5A 2HDNB 3AF4A 3M82A 2CL6X 2I54A 5BV0A 2ZT6A 3IQGX 1DS6A 3LBAA 4RE5A 5MDHA 1H2AS 5DBOA 4M38A 1QH8A 1Z2AA 4RD2A 4R2WA 4TKMA 3WK4A 4ITVA 4K81B 1MC1A 1Y6ZA 1EVIA 1Q0SA 3EIXA 3EQ9A 2XOEA 3ORRA 3W5IA 1FDSA 2QX7A 4MRSA 1AHHA 3BE6A 4D3FA 5AI8A 1YQQA 2BISA 2C2BA 5HFNA 1HFEL 5HR5A 2B2XA 3N05A 4AJNA 3CR7A 2QQ5A 2CSXA 5KTNA 2UKDA 1MRSA 1YQGA 2WF6A 1PFKA 3Q0EA 1KDVA 2FHSA 4QOEA 4V3CA 3ZY3A 1QBKC 1IQ0A 3ZV5A 3HS3A 4B43A 1CUFA 3IIMA 4KZKA 4RV5A 3WSVA 4HH3C 2N3ZA 5K3EA 1G8YA 4UNNA 2QTAA 2XH8A 5E1OA 4ZHQA 4ZVUA 1ECLA 3C97A 3IPLA 4A73A 1ONSA 5IABA 1KWKA 1IUPA 1GQOA 2OO7A 1UMDB 5BQ3A 1FJXA 2GAIA 1OWNA 3JR3A 3MTJA 1W4AA 3A58B 1UJCA 2B36A 1DDOA 1CBUA 3DFMA 2C4NA 3GJQA 1BN7A 5JWOA 3D6TB 1ZICA 3LGXA 2GDZA 5IJ9A 1QUEA 1VLMA 2J5BA 1UPCA 3AKYA 2ZETA 4CT4B 2E3JA 3DR3A 4XARA 4Y2JA 5KYYB 4LFBB 1RWQA 2WD8A 1SFRA 4H7JA 3TMYA 3F96A 3IOYA 4CT0A 5EE5B 4BNKA 2XVXA 1NBHA 3ENKA 4M3NA 3CZRA 1SBHA 4MYTA 2GJSA 4COOA 5C8YF 5B3JC 5JD4A 2X3YA 2XB2A 4QAQA 2HOQA 3V8RA 3AMVA 4I5GA 5GZ3A 2I6TA 5L45A 3RIMA 4I1SA 1I7SB 2YC4C 1X7WA 4NJMA 3FF4A 4P81A 1NSTA 4QG7A 2ZDHA 1Y37A 3DEKA 1AHIA 2XB9A 4FGUA 5DEOA 2J87A 2XCOA 4ETNA 4CL8A 3O3NB 1GNPA 3CURA 2WU3A 4DR3B 1EU1A 1V1MB 1Q3TA 1CQZA 1NBAA 3EH1A 4ILEA 1NUQA 3BBPA 2XUHA 3ZW9A 1IVYA 1EUCB 4ZN6A 1I5OA 2IPAB 2Z5VA 3H6HA 1JJFA 2UZ3A 3NIFB 3CUSA 1U8ZA 3JQQA 4IDDA 3G2IA 3LC2O 1UWKA 4YCAA 1GGHA 3NVMB 3NTOA 1K98A 1YJXA 1VMAA 3UJCA 3CPSA 4KQFA 4LY9A 2BM8A 5DI9A 3RGGA 2IYFA 1QG2A 4S0ZA 4TKLA 4DIUA 5FHQA 3EWNA 3JQRA 4NHOA 3TLCA 4YS6A 3AINA 2ZAMA 3DLTA 3U19A 4BNVA 2ODBA 1P5ZB 4ZI3A 3R3HA 2O0HA 4LCBA 4F3CA 5I9TA 5TJHA 4D9CA 2VK2A 1E6MA 3K5HA 3EVFA 3GMTA 1ZS9A 5EHQA 2QTGA 3OI7A 4XB1A 3ZYZA 2Z2ZA 3SDZA 3B2NA 5JXWA 5JSZB 2O3UA 1I32A 2Y67A 3LDFA 4CEHA 1JDSA 1XMSA 1OE0A 1FS6A 4AXXA 4W8HA 4U9IS 1U90A 2JW5A 4HRAA 4BQRA 5AI0A 4LOKA 1DT5A 3FVRA 2BV3A 3EGVA 5EWJB 3AR8A 3X1YA 1EJ2A 3IUQA 4BNXA 4C9BA 3UWSA 3VU0A 1WBBA 3K0CC 2RHMA 2VTEA 3VR4A 1L7NA 3PQEA 3E1GA 1IEQA 1QLJA 4D46A 4R83A 2WJIA 1E1NA 3EGCA 1OH6A 5F9HA 4G24A 5EL0A 1K6XA 2OV8A 3K2IA 5K3DA 2QD5A 3UMBA 2VBGA 3ETLA 4JX9A 5CXSA 1OZ0A 3LBIA 1LRJA 1Z07A 3M4YA 3VO1A 2BTEA 1MO3A 4NYJQ 1UDRA 5JVDF 2I5PO 2FPLA 1QOPB 3LCCA 1UPUA 3WNDA 1UINA 3VPCA 4E5PA 1EFVA 5CNKA 5BQXA 1S2OA 5LB2A 4KKXB 1JTEA 1XEWX 2CJYA 4NDZA 4B3MB 3CLKA 5K3OA 2FW9A 3PNSA 3KSZO 4IEIA 5KNDA 1LTQA 4C3UA 3U1BA 4DY6A 2ZYRA 1BFDA 4FX2A 2VG8A 1V5FA 5K8VA 2G70A 1ZM7A 2VP0A 4B4VA 2O2XA 3SOZA 4Q00A 1I2BA 2IP1A 2QVBA 3GDHA 4RVDA 1UF9A 3MJDA 5IN5A 3JV7A 2XGOA 2Q49A 4EMUA 4OA5A 5JUWA 3DOFA 4JLAA 1H2EA 1F0YA 5FORA 4JELA 1HOTA 3ZKWB 1OFGA 1XBTA 2O3RA 3B1WA 4HTFA 3TR6A 1Y9JA 3LH5A 5K2OA 3R5JA 1KEVA 1T0UA 4QFCA 2EJBA 2IP4A 4KGVA 4ZO4A 3P5SA 4C30A 4R0MA 1JUDA 3KB1A 1I4TD 2Z2IA 3G2QA 5KINB 2V7PA 4KMMA 3JQFA 1ODTC 4E08A 2WEKA 4X8OA 1XZCA 3VJRA 1DAFA 4DRXA 3SS8A 3K71B 5EFZA 4JUFA 3WQQA 5CVCA 3VH1A 3ZDFA 2A14A 1QOQB 4NOLA 3EPHA 1WHSA 1SH7A 1U9JA 1JR2A 4ZAGA 3NALA 4BV3A 7REQA 4XYEA 1SUCA 4BO5A 1GPAA 1VKZA 1SUIA 2HJWA 4HBZA 5DFAA 1TIBA 2I7DA 1II8A 3E6AA 2FPIB 2PL1A 2OB1A 3EVGA 4DDUA 5JCOA 5J1TB 3NH6A 2WIJA 1TMGE 3PVCA 4UBLA 4XGIA 2RHWA 3R0XA 4YC7A 4R71A 1G16A 4GKBA 3OF2A 4OQNA 2PCJA 3T7EA 4HWSA 4RGBA 1OBVA 1VGRA 2IGTA 4C20A 4WINA 3BL5A 1C9JA 1VYUA 1Z37A 2Z9DA 3L07A 3N07A 5JS7A 1N9KA 4NNPA 1CF4A 3JS5A 3TM4A 4XIGS 4FWBA 3PHBE 3K20A 2ZPAA 2X13A 4Y67A 1X14A 5ER9A 4KX5A 3MRXA 2P62A 5IEJA 3EMDA 1DAEA 1SIUA 2AJ8A 4WQMA 1MX5A 1KE1A 1X7DA 4YY3B 2IYSA 1KERA 1FC0A 4Y2HA 1F1BA 4JJZA 2XMSA 2C8LA 1M3SA 3QE3A 4D9EA 1ZP6A 5B55A 2L17A 5D1NA 1QHXA 3VH3A 3D6UA 2WD7B 3F6BX 5CDTA 1NC1A 2O0JA 3CNHA 4AMGA 2D0PB 3KJQA 4PPYA 1TA0A 1B00A 1Z62A 2B35A 3SC2B 1E1QD 4ENUA 5B1YA 4MLDA 1XZGA 2WYHA 4XWWA 1BOOA 2LKDA 3MXOA 5DHPA 4MDEA 5GJBA 3ZI7A 5B3KA 4KVFA 5K6TA 2FWRA 1AS3A 5KC8A 1OD6A 2VA8A 2WF7A 2O2SA 4Y0AA 1LVGA 2QVXX 2NO9A 3U4AA 4FTWA 4P82A 4Q1BA 3OIFA 1YH3A 1P9LA 4UDXX 3W5VA 4ENVA 1ND6A 5K20A 5AI9A 3S8YA 3L8DA 4B2IA 1H1LB 2DVMA 4LX0A 4QQNA 5DNAA 2O7QA 3TQFA 2E6UX 1GTZA 1VL0A 1Q0ZA 2DULA 3MTEA 1MABB 1O6BA 2I1VB 3HV0A 4IJ6A 3CLTC 4W5TA 1JJ7A 2YOGA 3TW6A 3VPBA 4C22A 2RHJA 3IBFA 2GO1A 5DGDA 3NYIA 1DXHA 3ACBA 2P5TB 3EVDA 4UUNA 1A76A 1DG1G 2OE2A 3JQCA 4MB0A 2GN2A 4BLVA 4CIBA 3QXSA 1XCOA 2BFEB 5FPHA 1TM4E 1UK9A 3QOXA 4BZPA 4DM4A 5HF6A 2M6KA 2EQBA 1IVSA 2WUWE 3GA5A 2WG0A 4MWBA 3O8QA 5EJMA 1U0LA 3T12A 3TNLA 1YS6A 4U4AA 2BR4A 3FNRA 2ZRPA 2C0CA 2Y66A 2CVPA 1C7ZA 1ZQ9A 1V5WA 3SFVA 3OPYA 2DG2A 4XRRA 3L84A 1O8BA 2BUBA 5ALOA 5TGDA 1FFWA 3IRUA 3ZI0A 4MWZA 5A7HA 1QDUA 1WHSB 4RGQA 5COBA 4YP5A 3O84A 1MX9A 2X7XA 1E5DA 4O4LF 2QG6A 4HH4A 4BTEA 2X1VA 2F59A 3IHLA 1HBJA 4XWAA 4GD3Q 1VMEA 5F78A 1IH8A 4K9PA 2N9UA 3WC4A 1QHGA 2FEPA 1IY8A 4JGIA 3UAVA 4MHOA 1LY1A 2JLUA 2XUKA 3AVOA 1ZK0A 1GT91 2OBLA 1NRWA 2WTMA 3AP2A 1ULUA 2FQYA 2ZJZA 1EB9A 3G8YA 3USCS 1AK9A 4EFDA 1EWRA 1U04A 3FBTA 3UWPA 3OZUA 2XCUA 2WKPA 3ELDA 5F1PA 3VZQA 4BPRA 5B57C 5I5EA 1RXWA 1SEVA 1WVGA 4U0KA 3UATA 2XVZA 2GO7A 1A5AB 4WT7A 1UIRA 2NUPB 1P45A 3VKGA 2ZITA 1YXMA 4X7RA 4JXJA 2B92A 4LZNA 3EQ7A 4BKQA 4CM1A 3CT4A 4Y2VA 5IFLA 3P9IA 5JYEA 4CIVA 3L77A 1E61A 1RJ9A 1WRBA 3IQEA 5EWMB 4DJAA 4CIAA 2ZIEA 2W2MA 4KR7A 5FAKA 4BTLA 2VL7A 3ZHOA 4DV0B 3WADA 1I24A 2VPTA 5G0UA 2EZ4A 3FZQA 1MAWA 2QRJA 3H97A 3W05A 3U5TA 1YRHA 3L0ZA 2KI5A 2VOJA 1TQ6A 4MA5A 4E13A 2ADMA 3GRAA 3QOYA 4D45A 4DS3A 4DXAA 5JW6A 2J67A 3WQBA 1N7IA 1XMIA 4BX9A 3WB0A 4LHWA 3BQMB 2H1OA 2XT0A 2IITA 2X9NA 1C4XA 4QWWA 2VJPA 3V5NA 2O8NA 4OBWA 2M6RA 3AX6A 4PN3A 4C2UA 4RAOA 4MVXA 4XPZA 1G7SA 1JDBC 1RYHA 2WFLB 2WZDA 3AETB 2O8CB 1CC1S 1W6UA 4P31A 5FJIA 3Q1KA 2I3AA 5AVSA 4C0JA 2CJFA 1QFSA 5FOUA 2ZQZA 3BWDD 1DX4A 4HXEB 4FFBA 4OGKA 2IH2A 3F74A 1A27A 2IU4A 2WWIA 4KVAA 4E32A 4E31A 2EFGA 2AKAB 1V11A 1E6CA 1PHPA 1UFVA 3A25A 3C3BA 5KOIA 2CDRA 4CTJA 1UFQA 4G0PA 3NHKA 3QPAA 3PSAA 1RXCA 3A4NA 3O95A 1XR3A 2WT9A 3EYAA 1UMBB 3FUTA 2Q7XA 3RADC 3H2GA 3PEFA 4TTJA 1NNEA 5C7IO 1ZUD1 3HVRA 2XWQA 5JAZA 1XI2A 1EFHA 1RLMA 2X5KO 2YJ6A 1O57A 4G36A 2HCJB 2NVOA 1S3FA 1MGPA 4HNRA 3TXAA 1NJ8A 4OL9A 4RZIA 2XDQA 1OX4A 5HGJA 1REQB 2QQGA 3IP9A 3U7JA 4LJ4A 4M55A 5K1ZA 1F14A 4RYLA 4ZOCA 3TOCA 1BE1A 3H9CA 3AFIA 3EVNA 1DXOA 3PUYA 4NDNE 4Y2SA 1K2WA 5K9ZA 2IOQA 5EHNA 1ZOLA 6LDHA 2YYSA 3UPDA 1Z56C 3NUGA 3EXIB 1JPJA 2J32A 3LD9A 4J0KA 3EC1A 4UAJA 5ALUA 4MR9B 2HWXA 4R1NA 3JASB 4HYTA 1ISIA 1QWOA 1YMUA 4TL6A 4I5EA 2Q27A 3N53A 4LA4A 2CFOA 3CUKA 2YQ4A 4HBGA 1F4PA 4BMYA 3FPHA 3AUSA 5FTKA 4YJ2F 5JMPA 2ZXFA 3F3SA 5DYWA 4C0LA 2X77A 3PX3A 1Z0JA 4JLOA 3CRMA 2WQ6A 4A2PA 3HNPA 5AW0A 2IVFA 3EK2A 3E3NA 5FUBA 2I99A 4ODIA 5EJ5A 5JECA 5JCJD 3KTAA 4B84A 3QP9A 1TQDA 1OTHA 4BQIA 3T4XA 1JKFA 3PRHA 1E5VA 3GRRA 2Q0QA 2N0SA 1JHXA 3VAAA 1KAQA 1XF9A 3FTCA 4N0EA 3ZIAD 1E6UA 1WPGA 2JFBA 2PRYA 3EGDB 4XD7D 3SD7A 2XD4A 3WLPA 1RPTA 1Z6TA 4OQYA 3K6KA 4PLFA 4FDAA 4BQFA 4F2HA 2OCKA 4L9AA 5KQRA 1A8IA 3W6NA 3KZKA 2W0SA 5LKRA 4IO0A 1DJLA 1DJPA 3FMVA 1ZW6A 3K0AA 1PL7A 1VBNA 1A8HA 4PTLA 3VTZA 3WLMA 1Z6PA 1JIQA 3KDSE 1N32B 4WJLA 1KGSA 1MX3A 4NABA 4LXIA 2NNLD 3RJTA 1X1SA 4UM5A 4XFKA 1L5KA 3WGYA 2HSGA 2BJVA 3MRVA 4G97A 1EGVB 1ZSYA 5B6PA 1EM6A 1NQ5A 3V97A 1YJ8A 3VAZA 1E7YA 4HQ0A 4I50F 2QHXA 3MCVA 4QUBA 5CJPA 4AROA 1NMXA 1QTIA 2R9VA 3QU4A 1JX6A 1R0WA 3WISA 1G3MA 1UMKA 1RWPA 1VL8A 3UMVA 3TZHA 2NU9A 4EPYA 4R0VA 1TCCA 3ZHYA 3LY8A 4OUDA 5HF8A 4YX9A 1XZKA 3TECE 4ALJA 1FFYA 3H5OA 5KBYA 1G98A 1HDIA 3L0YA 3CF6R 3QX9A 4K26A 3V3TA 3CSDA 3VTAA 5BW8A 4MV9A 2YWDA 3B2QA 3K8ZA 3OHPA 1W49A 1A7JA 3HYSA 5CLHA 5FOXA 1W2HA 4V2IA 4PO9A 4YPFA 4F60A 5FP0A 2BRUC 4IKEA 4JIMA 4C7OA 2G7ZA 1LDEA 5BYAA 1YKFA 1R66A 1SOUA 5EIBC 3BGSA 3AEQB 5JJBA 2Q1UA 5K0FA 3GMSA 3LRPA 3KETA 1W94A 5H02A 4KMRA 1OI3A 2C07A 1F06A 1QV9A 3MUEA 3R0ZA 2Q3DA 4FFBB 4G07A 4LTMA 4Q01A 4ZYXA 1U8XX 2CMGA 3N8KA 3WRXA 3ODPA 4KH1A 4D44A 1TM5E 2P1RA 2PJDA 2HWYA 1B23P 1CX9B 2G72A 1NN3A 5AVJA 4NFLA 4PVDA 2IBTA 2XB4A 3A6HA 3ZWXA 4FBMA 5CLGA 5JJLA 3LUKA 4J29A 4BS9A 4P22A 1U80A 4I1YA 3ILHA 3WS7A 1TRHA 2G36A 4WZBA 1BEUB 4LI0A 1JLRA 3L8EA 4FMBB 1ISHA 1HKHA 4GBMA 3HSSA 3JWEA 1MTZA 1SVKA 1XT6A 4Y7CA 3S8MA 3OSZA 4F72A 3LSTA 1RAEA 1VIDA 2P2NA 2XGSA 3A1WA 3L7DA 1FYFA 2QRLA 3P94A 1G60A 1UJ2A 3QPUA 5C5CA 1AA6A 2IXGA 2C94A 1RM5A 1T1GA 1U7OA 2JLSA 3EVCA 5AUQA 1XN4A 1YR2A 4OMUA 3EA4A 4P7GA 1FXSA 1LI7A 2DC1A 2Z95A 3M9XA 2K7FA 1IAQA 1PE0A 3E3LA 1V3TA 3WK5A 2CLCX 3R5XA 1N2HA 3A37A 3BHNA 3RRJA 1HDGO 1E2KA 1DWPA 4CUKA 1YCGA 4YGYA 5GJCA 3SE0A 3CZ4A 1CQJA 2NU6A 3ZTWA 3IT3A 3GLRA 4KUEA 4AYXA 1ZC4A 1TM1E 2BBTA 4OL0A 2GBLA 4Z1MA 1MEEA 4DEXA 1JDVA 2VHCA 1YFJA 1IXRC 1TMYA 1UKAA 1KFEB 1U7PA 5IT9A 4EUEA 2HTEA 2PYZA 4L8YA 1CUBA 3ZD7A 5AKIA 1H0SA 1EHCA 3OPQA 1U5CA 1Y4AE 4NNOA 3EEBA 4ISBA 3DTTA 3EVTA 3TJZA 1QO7A 4OYLA 4M1QA 4PG7A 3RJMA 4EGAA 3HWRA 2BCEA 1QVVA 4IRXA 1WDLA 4BNTA 3SZLA 2K2WA 5I8PA 3GXOA 1IBCA 4RPGA 2DT8A 2WHXA 3N74A 5BN1A 1NZFA 3OCZA 3CU5A 4O4JF 2J09A 4NEQA 2P41A 5EXTA 4AP6A 5IU6A 1I94B 1K08A 1EP3B 4DLSA 5CCXA 4EUKA 4DG5A 4MLCA 1M75A 2LZ0A 4HN2A 2JATA 4MVJF 3FCOA 2PWAA 4X60A 2P6RA 2XKBA 3U7HB 3D81A 2DR2A 3FWNA 4YYZA 4KXLA 1RJDA 3WX0A 1N5JA 4MV1A 2AFHB 4Z9AA 3CKYA 4F9TA 3NVKI 2P2LA 3B6MA 3IOCA 4E5VA 3DL4A 4R40A 4DUYB 1Q22A 3HJRA 2NZVG 2WU8A 1X7GA 1CRPA 3E58A 2YMPA 3DMRA 2W6IA 3GFTA 1JS1X 3L40A 1Y63A 1GUFA 1XRJA 2PT5A 4J49A 4RESA 4MPDA 4ZCLA 3FIJA 4BKOA 4X8HA 4E3WA 4BGDA 4LDPA 1OH5A 2HFKA 4OMFG 3NEAA 1JJVA 2J3JA 2NTVA 3ZQ4A 4OU4A 3O5AA 1AUQA 1BXRB 2QP9X 2NOAA 3HUFA 3FFAA 1KF0A 1N8KA 4GVXA 2FOLA 4MRMB 3LWDA 4YREA 1OREA 4JYBA 2UVPB 5FLKA 1RYMA 1BHO1 3VHXA 3H99A 2NP7A 4Q6WA 4YYEA 2GM5A 3I9OA 2Q5QA 4DN6A 1RKXA 2HWWA 4HTFB 2K87A 1V3UA 4KLRA 1WLSA 2H5JA 3HCNA 3ND6A 3D3WA 2GESA 3B6EA 3Q3HA 4M8KA 4NZPA 4C4XA 1CJCA 2XR1A 3O2NA 1PZMA 5GONF 2F00A 1ENPA 1GSOA 1K3FA 2Y1DA 2Y1XA 1U2TA 2Y76A 2NGRA 3LLVA 3O94A 3PHLA 4EHKA 3U7GA 3DL7A 1NQTA 4QU0A 1U6IA 2JGMA 3N2IA 3ZU2A 3ZZ0A 4V1CI 3LY7A 4KOAA 3AB8A 3MLAA 2LCIA 2D0IA 3BMCA 3P9RA 1A5ZA 2OD2A 4TTQA 5D6OA 4DL9A 3IO3A 4DQXA 3ICVA 4B7AA 4URVR 5JU6A 1XLUA 4J03A 2YDXA 3IUNA 5D3KA 2ODPA 2YN0A 2H4HA 5LA6F 4B7ZA 7REQB 2PA0A 1PNVA 5A0TA 2R79A 2X41A 3DZFA 3E1KA 1FFGA 4JQOA 4II2A 2W6OA 1QR6A 2LW7A 3BM5A 3P2IA 3RARA 3AWDA 3VX3A 3VBCA 1VHTA 5FPSA 3HKCB 4DCPA 2KW5A 3ZCQA 1FVHA 3FUWA 3AK4A 2ZTUA 3BTSA 1YDMA 4IJVA 4QULA 1HYGA 1R8SA 3N8DA 2O14A 2OFWA 2R1ZA 2PKWA 1IG3A 2A33A 3IIKA 2P1DA 1FUKA 5IKOA 3NU1A 2DEUA 1C1XA 2RGXA 3HJGA 5C81A 5A05A 3R6LA 1N6KA 1OWMA 4NBUA 4XQGA 3TNFA 4ARZB 4ARIA 4Q9HA 1ISSA 3OKFA 3CZQA 4N8DA 5F98A 1R37A 3AHDA 3SNHA 4UPEA 1WP4A 4JBIA 1JMYA 5C8VA 2AE2A 5IZCA 4QO7A 4Q3DA 4U3JA 4N6OA 1XU4A 1XYGA 3JY6A 4DZZA 1VI6A 4YRDA 2VNHA 2QMHA 3V2UA 3HB5X 4MQ6A 2XBLA 3OZEA 5BN3A 4E70A 3ZOZA 2CDAA 3JQGB 4RYDA 3NAMA 3ZUPA 4RTKA 2ACVA 4ZCRA 1ZI6A 2ALJA 4RZUA 3IUSA 5PNTA 5EPEA 2IYLD 3HNOA 3HSYA 5HFAA 3ANNA 4BFWA 2FFRA 4F1KA 4GPBA 4QJBA 1JR4A 1VLLA 5E9QA 3RKRA 4F45A 4CLHA 4BLRA 1GPJA 5C3MA 3BA1A 1JKMA 3RYIA 3GJSA 1IXSB 3GZNA 2VH5R 4DLXA 1B6RA 1E89A 4KQ6A 2ZT5A 4H60A 3ZGYA 3KL2A 4A8JC 4RS3A 3UPUA 3V4SA 4R8KA 2XUDA 2G04A 4KIGA 3VDNB 2H92A 2XQVA 3IVMA 4JBGA 4OHXA 4Q4LA 5A1JA 4NCNA 2P11A 1SBYA 1YUBA 2I76A 4MVCA 4OEHA 5CIWA 4ZYLA 1LKZA 1XZHA 4OH1A 3B9QA 1GKLA 3ZHUA 1JH9A 4OKNA 1LNQA 1H85A 1IHUA 3R7AA 5TEWA 3ZXUB 4PZ0A 4MUJA 4DCNA 2GBPA 3RYHB 1N2IA 4F84A 9ATCA 3K8YA 5KDOA 4ZTZB 1E5XA 1J8YF 1YR9A 4TVKA 5CT4A 1Q84A 3MMXA 5CCDA 3T0IA 4MGKR 3IVCA 4M86A 5K8JB 3QEAZ 3ZU5A 4J0DA 1D2CA 2NADA 4LOJA 5FYDA 3HUDA 3S99A 2PO5A 1RE1A 2P79A 2B0JA 4G23A 1CUSA 1D2HA 1WU7A 2PX4A 3GV0A 2A1UA 1B43A 1Z29A 3RVLA 1V4BA 1QMPA 5FX2A 2FPSA 1IIRA 1G3RA 1MMFB 2Q5HA 3TE6A 3EUEA 1LFAA 2OXFA 2FUEA 1U2DC 3H1FA 1LDYA 1M2KA 2QROA 5BT9A 3JD0A 1Q19A 3V1YA 4LJKA 1J9GA 1ODJA 1DHTA 2HCRA 5KVAA 5TT0A 1L9KA 1W2GA 2WF5A 5F2NA 3C8MA 1G5IA 1E9SA 3D6MA 3FWHA 2PNFA 1JSZA 2V6JA 1QM5A 3A7DA 3S68A 3WGKA 4F4HA 5L3SA 3SR3A 2D5IA 3ONEA 4H3KB 1JU9A 4KYIB 4OYRA 3DV0A 5JFTA 4WSOA 1R8QA 3P9ZA 3VPGA 4M87A 4MARA 3ILXA 4OLAA 1GZ4A 2H17A 3OPYI 4TYNA 3L9WA 2QZPA 1Z16A 3PE4A 1CQIA 3HBMA 1GNLA 2EJCA 4I9HA 4BGVA 2W2LD 1Q11A 4RHUA 5AXDA 1L5YA 4B83A 2ZBEA 3MD0A 4O4HF 4G4GA 2REBA 5FWDA 2FPPA 3C8ZA 4GOKA 3GFRA 5K01A 1RKUA 1LBQA 1JFSA 2WV7A 4KRXA 3FNBA 3NC4A 3OX1A 2A9FA 4RBNA 4W7HA 1B6TA 4K87A 4MUBA 4CF5A 3G13A 4KXUA 5FNVA 4ZGBA 2NO5A 4TGLA 2J3IA 3GFPA 3D43A 2ZUTA 3AM4A 1OB2A 1A69A 1QYVA 4N7JA 5CVEA 3V46A 4TLEA 5SZJA 3NHBA 5CDSA 1A1VA 3OIYA 3GLKA 1EXNA 3P9KA 2QNRA 3UWKA 5F21A 2YZNA 1S96A 3MD9A 3FPJA 1A4UA 4PLCA 2C5EA 1R00A 2OHVA 4E1AA 4C1BA 3EDRA 4M8SA 4KQHA 1RJ9B 1UT5A 1Y8CA 3RABA 3AI3A 2R84A 5JMWA 4HQ6A 1V95A 1H6AA 4XLZA 1WMSA 2LTAA 1EVQA 3I2JA 1WTCA 4DMGA 2C5SA 1KQOA 5BSGA 4BJHB 4JK3A 1M2NA 1YUNA 3GGGA 4RHYA 4TKVA 2PSDA 2PUDA 3QZUA 4MMZB 4YFYA 3CRW1 2JJ2D 5ILQA 4BDSA 1R4MA 3RAGA 1KK3A 2BFCB 4BV2A 1SB8A 5JI3E 2QTNA 2PWYA 2JCSA 4BKUA 1ZVQA 1AKRA 2FMKA 2V65A 2XXBA 5E1DA 5ELXA 2WJJA 4IV8A 3TLMA 4LKOA 5IYZA 1XLWA 4YRRA 5LQKA 1JA0A 2J3MA 3USZA 1EVZA 3PDJA 4EEXA 3M70A 1J5XA 1XCLA 5F9MA 1XMVA 1QDLB 3LMKA 5B6JA 3F4BA 3B5JA 2V55B 1VCIA 1M34A 4IMJB 1KJQA 1LBTA 1NJ1A 2PWPA 1I2DA 3FIUA 1DPGA 1N2ZA 2QT1A 4WUTA 2IEDA 2Z1NA 3J81A 1EUDB 5LU8A 4TV9B 3DZGA 2BI4A 3ZYCA 1USKA 3PQDA 4QQKA 4JI6B 2Z98A 2G9VA 4E5NA 3DEAA 4PZPA 4G1MB 4D43A 3ETGA 4X61A 4YDSA 3OG9A 3VV2A 2X6TA 4HADA 1MEJA 3UK2A 2ZRQA 1AK2A 1MB2A 3HVJA 3LFUA 4AJEA 4EWLA 1E8MA 4ENQA 4C6HA 1U31A 3BWXA 3HCPA 3F6PA 3EWIA 3MS4A 5BN4B 3UFXA 1E8DA 5EEHA 1SBCA 3WB1A 4DCOA 1L1QA 3NRCA 3SBOA 4G5SA 1JI3A 2DFPA 4ZOLB 3CLHA 1Z22A 3OE7A 3G8DA 3ZEAA 4RVNA 3Q6MA 4KAXA 1EGAA 4I8DA 3IP6A 3SVTA 3MT8A 1HURA 3C3EA 3PXBA 5AHRA 5EWLB 3ZE1B 4UNRA 2AI3A 2VNIA 3SGLA 3TR0A 3OQVA 3HKBB 1OTXA 4NESA 1YA8A 1YB6A 3R5KA 3V8BA 4BHTA 5KVCA 2XBUA 4QDUA 5A62A 5FV7A 5EQFA 4X5OA 3ZXYA 4BMVA 1G8JA 3CH6A 5FA8A 4CKCB 2I7XA 3C87A 3L01A 2VJDA 3T4UA 2NV2B 1B3BA 1E18A 3AI2A 4OYHA 4C01A 1A4RA 4PG8A 4MKIA 3BHJA 3K9WA 4H7FA 3GN1A 2MSKA 2NXJA 2H54A 3BB3A 3IAAA 3L0DA 4V0MA 3ZQ6A 3A6KA 5ALLA 3UWOA 4A1OA 5ISMA 3LNTA 1DOHA 4YACA 2WD9A 4HXGA 3IDSA 1E64A 1RLTA 1T5DX 2FK8A 1G8KA 2Y27A 3OFVA 2PSSA 3PT5A 5LBUA 4LF9B 3BCSA 4G67A 3FPAA 1ISGA 2ZFUA 5DNWA 4DA7A 2ZVPX 3IMCA 4YHBA 5AOVA 2IPNA 4MDHA 3QW2A 2J5RA 2RHCA 1NPTO 1ZR2A 1T9ZA 3VR3D 2B1QA 2PLNA 4D3DA 3KHUA 3HPRA 1NUAA 1J22A 1KORA 4MTCA 1F6BA 1FUYB 3ND8A 3VC1A 4CLRB 4FILA 2JZOA 3NQ41 3CVOA 3JQEA 3SBXA 1PT9A 1CETA 4CV2A 4YMIA 3ZCPA 3T15A 3OJ0A 4NMMA 1H2XA 3UFBA 2X40A 1V35A 2Z4SA 2B5WA 3Q1LA 1J99A 3T3HA 2IIVA 1EUZA 2JIPA 1IHYA 1DQPA 5H83A 3MCUA 1COZA 1JHRA 2P67A 4AURA 1ODKA 1WD7A 4R9SA 4F2GA 3AESB 2X2FA 4EYQA 3OIGA 4JHXA 4LFAB 1EVJA 4WUVA 2AK2A 1V1RA 3IP5A 3ZIUA 3D5EA 1E6KA 3PTLA 3Q0TA 2A5GA 2WW8A 2V7VA 3EVZA 3GRVA 1J42A 3PGMA 2YV1A 3NXSA 1ECFA 2OTCA 3PGVA 1ZNYA 3HVHA 2B37A 2JKYA 3LPCA 4QQRA 3S2IA 3ZWCA 4AZ3B 1MPXA 2FR1A 2BMVA 1ZRSA 1AZLA 3AVQA 3PE3A 3FGPA 1PJ3A 2VJCA 1K7FB 2CLFB 4KLCA 1T1RA 4MR9A 5F3DA 1B76A 2B4KA 2NU7A 2WNIA 2PLAA 3KLMX 3NH9A 4Q02A 2X1HA 5LZ4A 3CNBA 3KVRA 3QYAA 4PC2A 3LCUA 5ELMA 3I76A 4DJEC 3JQAA 4RZHA 2Z5LA 2HC9A 2H1IA 2IZ7A 2QYHA 1NKVA 5I7FA 4I9GA 2B1RA 3NNNA 3ZNPA 1EX6A 3VNBA 1R7RA 1BXGB 3KS9A 2WABA 4EY5A 1TK2A 1TUEA 2DUWA 2GD1O 5IC5A 2AFIE 3NHAA 2SKEA 4B4WA 1SNYA 1N2JA 3ITKA 1NIJA 1PUIA 3IVGA 4HXYA 1OFHA 3EC7A 3REQA 3KBOA 3D3QA 4FLEA 1CIVA 1RTKA 4XGKA 5DP1A 2X0DA 4RVHA 1LQUA 1FSZA 2AOUA 3EUWA 4I9FA 4D42A 2VYQA 1JQLB 4PZZA 4BQEA 5LP1A 3HSKA 3ZWMA 4XWTA 4H0NA 4HDCA 2OYRA 4M9QA 3MT0A 2G40A 1MC4A 4PYNA 4QJIA 4IHAA 4HDSB 2IGBA 2WM8A 4CM4B 3QOFA 4QOJA 1W87A 1O54A 4N7RA 3UOAB 3TM5A 4E15A 2VDVE 4Q9DA 4QUDA 4BU0A 2FG6C 4K6MA 3B3JA 2QTHA 4TVBA 3TQQA 3WZ2A 1NT2A 2AN1A 3AG5A 1S2GA 4QO8A 3W6ZA 2X0EA 4FZ5A 1FJ2A 4QL3A 4TS1A 5D01A 4R2JA 5HRCA 3PS9A 3N2ZB 2O54A 4YUYA 1WXIA 4ND7A 3TGLA 2BKXA 1CE8B 2JFGA 3BXHA 5KWJA 1TTTA 1W19A 3D3EA 3IP1A 4B3HA 2ECFA 4TUYF 2WF9A 5HIKA 3D1JA 1K9SA 2CXRA 1SVSA 5MFPA 3DFKA 6ADHA 1KMHB 4E46A 1I1HA 1MXHA 4J7XA 5ILOA 4C4RA 2V6BA 2D13A 1WCIA 3NCHA 3PWSA 4C29A 2ZU6A 1KSFX 1V7ZA 4BN0A 4O33A 1QK4A 2A4KA 4PN7A 1CR1A 3RT7A 4MLZA 2QL6A 2XNHA 1P9RA 1R3UA 2OLKA 1Y1TA 1HE1C 1BFUA 1ZX1A 3OOYA 3VSEA 3T3NA 1QONA 1W8IA 2IZ5A 3ANSA 2LDBA 4YCJA 4DBLC 2NMVA 4EI2A 1HE2A 3M49A 1Z5GA 4EMBA 3KTDA 1TUGA 4M0CA 3FR7A 4QRDA 5BO5A 2NSYA 3H4MA 4QUEA 2NU8B 2IZ1A 2WHQA 1WXHA 4BZZA 1Q1ZA 3B9PA 1CEQA 1ZXBA 2OBYA 1JKXA 2W2PA 3V2GA 5TSDA 5ES3A 1UXHA 1MNAA 2ECKA 4MRRA 4TVOA 3HACA 1CDDA 2HRBA 1FYWA 4C6RA 4BN5A 5K0CA 2C96A 1RABA 3PF9A 4GNRA 1IBRA 4W5QA 2HD4A 1KPHA 3B70A 5CFOA 1ZCFA 2FRDA 3JPWA 1AUVA 1AUOA 1BVRA 3FDFA 1AS0A 3GGPA 3T3IA 1E5LA 2G77B 3D8HA 5K7SA 5KU7A 4I0WB 1HEUA 4P53A 3M33A 3IIJA 4BLTA 1SVWA 4RO0A 5ERYA 5IXSA 2OGTA 3IAFA 3HB4X 3ZI4A 1QRSA 2X7JA 4YQEA 4EOGA 4US1R 3AXSA 3LUHA 3LUAA 2AUNA 1C1HA 1DTWA 3H5LA 4LXXA 4PY2A 1I33A 4MGZR 2Q9AA 4NPAA 4WOCA 4FQ8A 1DOZA 9LDBA 3JQAB 1T9BA 1V9LA 2GVDC 4JEHA 2WMDA 1CJBA 1MJHA 3DV2A 3PEWA 3VPXA 4M9CA 3OCVA 4M49A 3OZWA 4C07A 4C4PA 1TQ8A 3PUVA 4CG2A 5BOSB 5IZ4A 1EVKA 2DTXA 3HI4A 1D2NA 3G88A 1HYEA 1D6SA 3H2SA 1IB6A 1QQ7A 1X87A 3IAM6 5HCIA 1UBUS 2G6BA 3AU9A 1HMPA 4L4RA 4P08A 2C2OA 4B6OA 3SX2A 4ZKEA 5KVVA 1ESNA 2WSMA 2IW1A 3CLTD 1W5EA 1CUZA 3HN6A 4XTRA 5LXTF 3N59A 3UK1A 5ELLA 3RV3A 5BVHA 1TJ3A 1AN9A 3G79A 3QKRA 4EHDA 4G37A 1E3LA 3B3AA 2XVMA 3KXKA 2BBSA 4FBGA 3VZRA 5KSYA 3TBHA 4H9GA 4POOA 1WY7A 3KD3A 1NQAO 1MB0A 1Z15A 2ZWMA 2OENG 3F6EX 4J7CA 1SKYE 4IQGA 1Y9ZA 3DEIA 4L6CA 5ANRB 4YJKA 5HRUA 3OAAA 3EUFA 1OXMA 2YVKA 4ER7A 4JYAB 3CVJA 2OXRA 3DBOB 1T1JA 3A6EA 2PDAA 5ESXA 3S5UA 5MN5A 4WLUA 1R0YA 2DQYA 2O1SA 2IWHA 3GBPA 3VOSA 1ARZA 2PL5A 1G59A 2V03A 2PN1A 3FDJA 1Y6FA 4UDNA 3HA2A 4UOQA 5BSVA 1CDOA 3FRHA 2DWQA 2PVCA 1E0KA 1TMKA 1W36B 1Z3IX 3U56A 3HG7A 1PW7A 1P8AA 1GTMA 4BFYA 1N25A 5FULA 3FR8A 1GKYA 2K7ZA 4B3FX 2J07A 2OXCA 1L5SA 4XOUA 4EB0A 3K9FC 1K6MA 3ON5A 3UV7A 3GVHA 1P6UA 4KAAA 3OTIA 1GRQA 4RDCA 4Z4IA 3DW3X 4Z4FA 3SS7X 1QIHA 2B4TO 1ONBA 4M0MA 3L1UA 1OHHA 4FJ1A 1ZR4A 2IDJA 4L8VA 3SF0A 2A8YA 4FEEA 2IHTA 4DJTA 1HQKA 4HDKA 2RH9B 4P4NA 3AVTA 5CLQA 3PXGA 4KFUA 5LFAA 1ORRA 2ERXA 4KQXA 5JTUA 1PHRA 4KDFA 1DEAA 2H7XA 2XYRA 2WTAA 5LLDA 4UEKA 3E7XA 1XP8A 5SZIA 3FFTA 5LMUB 1AKEA 3LUPA 3MRSA 3DP7A 3ASUA 4QAJA 1XOIA 1FEZA 1J8MF 1YR3A 3M1YA 4G0XA 2R85A 2VJOA 4PVCA 3TMKA 2J0EA 1GCUA 2VKTA 3BERA 2XTAA 3OCXA 4G89A 4XLLA 1Y4SA 4DLLA 1U7DA 2OWEA 3B12A 3KB6A 4PNPA 4GYJA 3GC6A 3NJ8A 3NBZC 2F8SA 2W8BB 5JO9A 1CZUA 5JSQA 1AC5A 4L08A 3C4QA 1GWNA 2Q8QA 1E3QA 2OM6A 2OORC 2XKAA 2XOKA 3G2PA 5KKAA 1M1YB 1NJ5A 1T36A 3R3XA 4CCSA 1NMYA 2ZM6B 2EX1A 3GI1A 3HCWA 2IUUA 1BD4A 2PIAA 4KPEC 1V1MA 2G1PA 4URYR 3TRDA 2R66A 4KE9A 3QTLA 2DM6A 1B8OA 2Q8NA 1Z5ZA 4Y18A 5LP6F 3IAUA 2ANBA 4RU1A 5BMVF 2TRSB 2I2AA 3DO8A 5LU9A 2J8ZA 1QHHA 1H65A 2NUAA 4QVGA 2I1WA 3R09A 4YQZA 4OQFA 1Y1LA 1BWPA 2CB0A 3G2LA 2FN9A 4DWOA 1EFUA 4MVJE 1Y1SA 1ZA1A 2V6MA 3G23A 4FCCA 2F62A 1IM8A 1OYWA 2HLDD 1CUAA 2PMWB 2V6IA 4PYLA 5AM0A 1IHOA 1YONA 3G9UA 2NV6A 2GZ3A 1GCIA 3G6WA 3TB4A 3MYRA 2XDAA 4URFA 2A5JA 4DZRA 3H11B 4X0EA 1NXOA 4C4ZA 2VEOA 1JNXX 1K4YA 4WDRA 4ZU6X 2VF4X 2ZKLA 3F49S 3P2OA 1PR1A 3DMYA 4K9QA 3H4TA 5EIXA 2R5WA 1RQ2A 2PUHA 4K9KA 3KQUA 1GJRA 2ZROA 3IR5A 4BQSA 2FU5C 3DGFC 1MGOA 4E7OA 1NKSA 1E69A 4NH0A 1DBWA 4CCYB 3VSCA 2GA9A 3TCNA 4NCJA 3IYLW 1T3HA 2QLTA 4ZGGA 3GBSA 3RSHA 4XPIA 2W2XA 1E2IA 4EUSA 3U44A 4BCCA 1AQUA 1VMKA 5I8ZA 1UP4A 1OCEA 3AO0B 4G1VA 4N5MA 4AMZA 2BEJA 4D9NA 4BLUA 1OW3B 1DEXA 1GKUB 3BAZA 3M4ZA 1TYAE 3HBAA 2YBEA 3NRBA 1X70A 1F8FA 1FLDA 2O6LA 2BGMA 1SXQA 2PX8A 1Y6JA 1BMFA 2XRYA 3MF4A 3MQ4A 4G85A 3KJEA 3CLUC 4AIIA 3P0EA 4E94A 4UE6A 2O48X 3EIOA 4OSEA 2V7TA 3DNPA 3GBVA 1ENOA 1VL6A 3LI2A 4JI7B 3KR1A 1DAIA 1DLJA 1PJLA 1T0JB 2FGKA 2H1HA 2EL9A 3SP1A 3TOZA 3WBKA 4DQLA 3FKSA 4QBHA 3P20A 3C1UA 3JRWA 5G1NA 4DLZA 1ETUA 1Z6XA 3R7FA 2MT9A 1TVKB 3S7ZA 3JARB 4TWJA 5EIWA 2WB2A 2O06A 4JLUA 1RCUA 1MB3A 1WB4A 2GCIA 3Q0IA 3L6OO 1XZ8A 4B3CA 1FFDA 2P9QA 1BWQA 4DAOA 1KDZA 1M8FA 4RCVA 4ERXA 4HH0A 1G2QA 2PBZA 4RK4A 4UMDA 3NUQA 4CETA 5I5GA 1KNXA 1QG6A 4BC0A 4IF6A 5L53A 5FAXA 1JQ3A 3UOGA 3TW8A 1W96A 3IA2A 4Z8YA 4X84A 1QJ4A 1P0MA 2UZ0A 4I4IA 4L2IA 3DUFA 2AN4A 1N7GA 5TRTA 1USUA 3ZQKA 1N8NA 2F1HA 1Q1BA 3RFUA 5IDWA 5TX7A 3JR7A 2IFTA 2I4RA 3CONA 2QMZA 4KIWA 4RENA 4HY3A 3HCCA 3KJZA 5KWSA 3LUCA 3OAAD 4GZLA 3QVKA 2VYCA 1RAFA 1N78A 1GZ7A 3MJEA 3GFSA 3H9EO 3GHYA 1G6OA 3LP5A 3W2HA 3PCXA 3L7CA 2R0QC 2BGNA 2VKQA 2VQ3A 2WAMA 2O2ZA 3CXRA 3A06A 4QPZA 1BO6A 1F0PA 1HORA 4MQUA 3T99A 2CHGA 1UMCA 4PGGA 3WWOA 4NJEB 3LKVA 4ZJYA 2YOHA 1DCKA 4P4LA 4YHHB 1RP1A 5BNFA 5KX5A 4ER6A 1U6KA 3C39A 1J07A 3UJ6A 3WXMA 2O8BA 4IHJF 2L18A 2NSLA 1XGKA 1FLVA 1WSAA 2UVPA 2C58A 3GMIA 5G53C 4FJ0A 3T61A 3TI9A 1WB9A 3K94A 1EFAA 1L5GB 5JZVA 5FQOA 1QX3A 2XZLA 5BUSA 2ZE7A 1EK6A 5FWNA 1T5LA 1ABFA 1CS4C 2CNNA 3G1TA 1Q1GA 4ZALA 4JP3A 3AJ8A 4J0EA 4BNGA 2IYEA 1D1PA 1IMJA 3ZWOA 1MC5A 1ZHFA 2E49A 2G1JA 2PS1A 3D4NA 1E9DA 3F5MA 3ID6C 3JVIA 3HJCA 3AIOA 2IUEA 2JGAA 2XIQA 3RK1A 3UUWA 1G42A 2FWBA 2X0FA 3H19A 1EPUA 1HG0A 3ZWVA 1L7BA 2IXTA 4HDRA 4NG5A 5AJXA 1F2UB 2OFOA 2PR7A 3F8WA 4MP3A 4N7BA 3H1PA 4HB2A 3VRHA 4CTKA 2C0PA 1AKTA 4Q1VA 3K70C 4HVLA 3H9JA 1RW4A 2DTDA 1WOYA 2ZRLA 4ONEA 1A9ZA 3CB2A 2KLHA 4LISA 3TR5A 1ZINA 3E3OA 2F2TA 2EEZA 2XE7A 3EPRA 3CVYA 5IKMA 2HYDA 1KI2A 2AQIA 1PGNA 3FAZA 2EFDB 2Q5FA 4Q4AA 3TNYA 2FLKA 5E4YA 5JARA 3LK7A 1WZ2A 1I1QB 4QT0A 4EJSA 1ZAYA 2R2AA 4CGYA 3FSJX 4FBLA 4X1IB 4DA0A 1R9GA 3C3WA 1DRWA 3V1NA 1WPXA 2P6OA 3BDIA 3EISA 3IBYA 3PNPA 4FFMA 5G3ZA 2C9YA 5GVRA 5DXAA 1W46A 1JF8A 4CQMD 2XYPA 2PPLA 5AM5A 3DAFA 5CB4B 3AM1A 1PR3A 4N5IX 4ZZ3A 2Q3CA 4J4TA 3KJHA 4PFSA 2QMEA 3MN1A 3E9QA 4F21A 2QR2A 3CN9A 1X86B 3ZUGA 5BQPA 1M7BA 2XKJE 3LZCA 1IRXA 4FS3A 1NBWB 3C15C 5J2UB 3TLAA 3WWDA 4E33A 5AVWA 2BFAA 2P4QA 1Q2XA 2PH1A 2VWGA 5KSZA 1L4UA 2ID8A 2Z8YA 3ML1A 1WF6A 4C2AA 4CIXA 4CU5A 2JA1A 2VNSA 4IINA 4CG0A 3HJFA 1WMDA 2QRGA 2FR0A 1EM8B 5LD2B 1XF1A 3ZHQA 3O9MA 1NNLA 3TW0A 5A0VA 2BEKA 2PFGA 3WRWA 1MO5A 2QYSA 1D7OA 4I1UA 3D7NA 1I4OA 3O4JA 4R7GA 2H57A 1KOGA 3KEOA 1LQ2A 1X0VA 1YCFA 3PD0A 4P84A 3T3GA 2E4WA 3W5AA 3C41J 3GIWA 2BHRA 2XB6A 4D9MA 2O3SA 2P5UA 3TZ6A 2GNOA 1GG9A 3GGSA 5AW3A 2UYOA 2BMWA 4ZAFA 5FBKA 4LNUB 2J9FB 1YS9A 3KV3O 1BHQ1 2EZUA 2I0FA 3D3JA 1KOFA 3H5RA 4X1YA 4XDHA 4KREA 1F2TB 3PUHA 2J7KA 2ZIGA 3UHPA 5U4QA 4TTIA 3O8QB 4FGJA 1BHJA 3BXXA 1LDBA 1F8XA 4ARVA 5BQFA 3I2YX 1I4WA 4XSGA 3IJEB 3R7WB 1A04A 3H0KA 5A5FA 1KS9A 4KC0A 2H2DA 5ALEA 4R6XA 1WTAA 3OPYB 3WSTA 4AF7A 4FNGA 2GS9A 3FTQA 1JEQA 3V55A 5LOVF 2NTYC 1NXQA 4MGEA 3LCJA 1TM7E 1L5LA 4UJ3A 4I1RA 2WG2A 3OZVA 5A3JA 4RMJA 5D6NA 1NBIA 2O50A 3MWFA 5ECDA 4AWBA 1K97A 1JDBB 1MEOA 1SC6A 5IT0A 2OV1A 4PAQA 3U49A 2R8XA 3FZNA 4HDMB 1QNFA 2A3RA 3K9LA 4IXNA 3KWLA 4K9MA 1V7QA 4OOFA 3S7TA 1J6UA 1P5HA 4IOKA 1Q16A 2GR9A 3K16A 2WWVD 3SZUA 5AW6A 4F3TA 4ND8B 1EDOA 3NHUA 1A9TA 2EBFX 4JVNA 2P0EA 4KODA 2P4SA 1GTJ1 4LI3X 2K5UA 3UXEA 3L0PA 1IUOA 3UBMA 4PBRA 3W06A 1MN6A 1YBFA 4B34A 2C1XA 2C2XA 5H81A 4GBED 1T9HA 1BXZA 4C7XA 2EX0A 4HKTA 5EWMA 1E20A 3DVQX 5E4TA 3T7RA 4LYEA 2E4UA 2QL9A 3DF7A 4EPVA 3ILSA 2VP2A 3RBAA 3TSAA 2DH5A 1IAVA 1MAVA 1S5PA 3PNYA 3CWZA 1YRQA 3KZMA 2P2YA 5THQA 5IZCC 3KPWA 4CMIB 1P62B 2YHIA 3ZZNA 2XX3A 3CXUA 1JALA 3C24A 1OYYA 4GEKA 5B12A 1SK9A 2ZLBA 2QX4A 3HVUA 5LQJA 1NF8A 4PANA 4JU9A 5D5QA 1KZ1A 2PSJA 1K92A 3H65A 2A57A 3Q3VA 2C97A 1PG5A 3FDXA 3UN1A 2W2KA 2QA5A 3QUBA 2GXAA 3QF4A 1P0IA 3N3BC 1E3WA 5CLFA 2IUYA 1EQAA 2VAXA 3MB5A 2GHRA 4ZIRA 4F93B 3FA2A 1A72A 2ONCA 3IESA 3RQSA 3VHQA 4EK9A 1E94E 1XA3A 1ZHOA 1JIUA 1M73E 1XV5A 3FGOA 2PQ0A 3L7MA 4KH0A 3R74A 1NW3A 4K05A 4H3SA 1BFKA 4BRSA 3WGVA 4FKBA 1FFSA 1KO7A 1EM8A 2ZAYA 3NDPA 2X9VA 4NMLA 2X14A 3TO5A 4JLSA 3U4IA 2OV2A 4IWYA 4ZQGA 1UM8A 2G71A 4EG8A 3TZQA 2D1RA 4WWHA 1N5MA 2QXYA 3RHZA 4CEJA 1NKTA 3VZSA 2XW6A 4HQFA 4D8UA 2VSQA 4Q19A 5DYYA 4ABYA 3UAYA