1K9VF

Structural evidence for ammonia tunelling across the (beta-alpha)8-barrel of the imidazole glycerol phosphate synthase bienzyme complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
200
structure length
200
Chain Sequence
MRIGIISVGPGNIMNLYRGVKRASENFEDVSIELVESPRNDLYDLLFIPGVGHFGEGMRRLRENDLIDFVRKHVEDERYVVGVCLGMQLLFEESEEAPGVKGLSLIEGNVVKLRSRRLPHMGWNEVIFKDTFPNGYYYFVHTYRAVCEEEHVLGTTEYDGEIFPSAVRKGRILGFQFHPEKSSKIGRKLLEKVIECSLSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amidotransferase hisH
publication title Structural evidence for ammonia tunneling across the (beta alpha)(8) barrel of the imidazole glycerol phosphate synthase bienzyme complex.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 60
structure length 200
sequence length 200
ec nomenclature ec 3.5.1.2: Glutaminase.
pdb deposition date 2001-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF00117 GATase Glutamine amidotransferase class-I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1k9vF00
4UOZA 3D54D 4I4NA 4UNIA 2VPIA 4Y0NA 3EWNA 4OQ4A 1OX5A 4E08A 1U9CA 4P36A 3P9SA 1Q2UA 3ZJ5A 1WL8A 4OGFA 3TTXA 3ZR4B 1BXRB 2V4UA 4MGHA 3UJNA 4LGYA 4RKWA 3PQ4A 3N7TA 3ER6A 1GG9A 1O1YA 1OX6A 4OFWA 4B31A 3PQ7A 3OT1A 4GUDA 4WINA 3NVAA 1QVZA 4OIFA 3R74A 1A9XB 2VXOA 3L18A 1OI4A 4ZDKA 4L8FA 3TTYA 4ENQA 1ONSA 1T3TA 1GGEA 4L8YA 5K4AA 2ZUWA 1I7QB 1R9GA 4OJYA 3PQ5A 3B3AA 3CNEA 3MIIA 4L8WB 2ZUVA 2R1TA 4ZGGA 1PDWA 3TTWA 2YWBA 4BFLA 3SF8A 5SYAA 2W7TA 2FEXA 3GRAA 5DFAA 4P35A 5LIRA 1P81A 4L95C 3EN0A 1CF9A 1QVVA 3PQ2A 4I46A 3BWEA 5JZMA 5SY9A 5BV2P 1KEEB 4Y1FA 2AD5A 4ENUA 1GGHA 1G2IA 3F71A 4XLLA 1M6VB 4Y1RA 3UGJA 4L7QA 1T36B 2VKTA 4I2NA 3R76A 1VCOA 4AUNA 4OGGA 1QDLB 3EFEA 1C3OB 1L9XA 4QYXA 4BTEA 1P80A 1CS0B 1FYEA 2R1TB 1IZYA 1OX4A 1PE0A 4P5PA 4RKYA 3TTUA 3B36A 4UOQA 4Y1GA 4AULA 3TTSA 4B7AA 1JDBC 5E9AA 4GE0A 4B40A 4R7GA 1KWGA 4JQSA 4B5KA 1OY1A 4QYTA 3M3PA 3TQIA 4ADSG 3FIJA 3SOZA 2R1VB 4Y1RB 3MGKA 3WFZA 1N57A 2ZUSA 1KA9H 1QVWA 2AB0A 4ENWA 4HCJA 1GPWB 1PV2A 1IPHA 1Q7RA 2H2WA 2YWDA 3OT1B 3B38A 3NONA 3UMMA 1VHQA 1OX4B 2XF2A 1UCFA 2VRNA 3CYFA 4MTCA 3TTVA 3UOWA 4ENSA 1VCNA 1P7YA 4AUEA 4E5VA 2RK6A 4B2YA 1S1MA 5IP5A 4S0ZA 1J42A 2NV2B 4UZSA 3P9PA 3BHNA 1PDVA 1IZZA 2WJZB 4ENVA 3SF8B 4K2HA 2RK4A 4AJ9A 2RK3A 2ABWA 4P34A 1GPMA 1GGFA 1P7ZA 3KKLA 4N0MA 3UK7A 2A9VA 1I7SB 1VCMA 1GGJA 5SY6A 2YWCA 2GK3A 4BIMA 1KWKA 4ENRA 4WXYB 3CZAA 3EZGA 4P2GA 2R1UA 2D7JA 1JVNA 3PQ6A 1SY7A 4Y1EA 1QF7A 1K9VF 3FSEA 1QWSA 3PQ8A 1KXJA 1CE8B 1T0BA 2R1VA 2VDJA 2ZUUA 4ENTA 4ENPA 4AUMA 3NORA 3NOOA 3NOQA 2LXNA 4PXYA 4UCFA 4D1YA 3PQ3A 3CY6A 3R75A 3L4EA 3P9RA 1FY2A 3EJ6A 1SOAA 4GE3A 1C30B 3TTTA 2IUFA 3CZ9A 3VU3A 2GHRA 2YWJA 3F5DA 4MNTA 2ISSD 2NV0A 1P5FA 3P9QA 3L3BA 3L7NA 3NOVA 4L78A 4N12A 3ZJ4A 2ZUTA 2OR3A 3RHTA 4ZDJA 5SY4A 5JZOA 4ZDIA 1I1QB 1GGKA 4LRUA
chains in the Genus database with same CATH superfamily
2G67A 3EVTA 3DJYA 4CUJA 3CV3A 4EVIA 3LK7A 3ROTA 3R6WA 1HDYA 2IDZA 3PENA 3W7AA 3WRYA 1Z82A 1V5FA 2I4RA 1WHSA 4G9BA 2HLPA 3B1WA 721PA 5JAPA 1VL8A 1DXYA 3AG5A 3CF4G 3TPCA 3N9IA 3R4CA 5IEBA 4S12A 2HEGA 4LHVA 2GF9A 3DAOA 2XD4A 5FNVA 1DRVA 4H6VA 3ZV4A 3KYCA 1R8QA 1X1TA 4PEVA 1QZTA 1QVAA 3BSFA 5GZ6A 1F12A 5IS2A 1TF2A 1PHRA 4RIGA 4BNDA 3GVHA 5AQ1A 5GADl 3CS3A 4MV1A 4F91B 4NONA 1VRWA 2KYRA 2J9ZB 2J85A 4YBZA 4ZGGA 1G5HA 2FWBA 3LBFA 1MIHA 2J9RA 3NJRA 4NZ9A 3SIWA 3ZZNA 2QSYA 1WP4A 3IIIA 4HGNA 4YMUA 3DWIA 1D07A 1W1WA 1XRSB 3WQRA 4AUKA 3WA6A 4BNVA 2WAOA 1DG1G 3UG7A 3K96A 1LNQA 2G70A 3PXBA 3DH0A 3CNOA 4KJZA 2VA9A 2ZRFA 4MSUA 4GYWA 1Z4OA 2EKZA 9ATCA 3L1IA 4DV7B 4Y6RA 1GA4A 4Z0TA 2A0YA 3GPDG 3R5JA 4KDRA 4QFDA 3RSFA 4DMGA 1Q1NA 3BDVA 1V47A 3GWGA 1LTHR 3ZKWA 2I6FA 4RQTA 1H1LA 4F96A 1P4SA 1ZMRA 2P4SA 4RD3A 3ZW8A 5KNBA 1TAUA 2PUDA 3H3JA 1N5LA 4C6TA 4RMNA 1ZONA 3HCPA 2O1WA 5CVJA 3V4LA 4B80A 2KM1A 5A02A 1ZAYA 1E1KA 3MWJA 2R48A 3OHSX 1W9HA 4ZMSA 3MWGA 2WSLA 3WO1A 1QG2A 1AKYA 2VJKA 1RE1A 3FUCA 3UFBA 1Y9JA 4KQ2A 4EAAA 2HO4A 1KY3A 1TMGE 3DVSX 4YBRA 1KZGB 2Q0HA 3EZNA 3I9MA 3TPZA 4DIMA 2ZXUA 4DHEA 4NU6A 4TMWA 4DBLC 4PVCA 3ME5A 3OKPA 3WB2A 5KJ6A 1B7GO 1DBSA 1M72A 2PMKA 4HDSB 1NJ5A 4YY3B 2W48A 4ZIRB 3DZJA 4BO8A 2GBPA 3ZHVA 2V59A 2R00C 4QUHA 1JEQB 1OU0A 2DUMA 2FUG1 1GUYA 2OWEA 3M7IA 4ZHQF 5CLQA 4LJKA 2BMVA 3THXB 2RJNA 2J4FA 4UREA 2QTGA 4CLEA 3AV3A 4GZ3A 4EARA 4WXYB 1PSWA 5TE9A 4DLSA 1M0WA 2PWPA 3OJCA 2Q29A 3I45A 1YI8A 1K4KA 4Q4JB 5IC6A 1ZQ9A 2YFQA 1I4TD 1W34A 3L6BA 3WWEA 4NV3A 4TLMB 1SCAA 3SMQA 1CUAA 2X19A 3EVEA 2NO4A 1S2GA 3KU4A 1G60A 1ZK4A 1TU3A 2VHEA 4B6PA 4ER0A 3LUGA 4OHWA 1DAOA 1T4CB 1X14A 2XKJE 2ZBQA 3R75A 1Y80A 3INYA 5EUCA 1VYVA 1WRBA 4BKOA 3HMQA 4PZEA 4RVOA 2IFTA 4DDHA 3AUSA 3EG5A 1AGNA 4HDNB 3AVQA 3CU5A 1SM4A 4KGZA 1QJCA 2NV0A 3LDHA 3MJFA 4IL5A 2CCJA 2MSDB 5CVDA 3WYCA 2FDRA 5KYWB 5M2QA 5L51A 1U11A 1EFVA 1KDPA 1ZUNA 1DELA 2PM8A 2JH9A 3CQ9A 1YZ3A 1MO3A 1NMXA 1PWZA 1U4OA 1JA1A 2ATVA 1MR3F 4IDBA 1UP4A 1QH1A 3TUJC 5LIPA 3P97A 2VJMB 4LY6A 2GCGA 1H3FA 5BP7A 4P36A 2EG5A 4MIKA 3R8XA 3X0DA 3TCKA 1H6BA 2Q4DA 4MAAA 1DIHA 3KB1A 9LDTA 1Z6PA 1JSXA 2QTLA 2XIQA 2PCLA 3BFKA 3BMNA 1Y1KE 3SEAA 3JATA 4PYOA 2R2AA 2ZJ8A 2OBBA 5ECYA 2CFSA 3T5MA 1EGAA 1HL3A 5ALWA 2I80A 4RYDA 1WV0A 2JH3A 2ZJ5A 1WOYA 4ZOAA 4L8YA 5FDFA 1F9EA 2WSMA 2ZUWA 3KOUA 1PI3A 4W8GA 3CNQS 1POXA 3F5MA 5HKKD 2JJYA 5LQMA 3LY8A 4QPJC 4S05A 1IG0A 2IUTA 2VP2A 4FGZA 3DPSA 4RE5A 4B9EA 2WDZA 3THRA 3F3SA 4HQKA 5FOQA 2IV2X 4M2LA 4KXQA 1AUPA 4FDVA 1ZGGA 2JI9A 3AHDA 1GPUA 4Y1FA 1YT5A 4PQGA 1W0CA 3R5TA 4Y1RA 5DNEA 3U0VA 2VZ0A 3QK7A 4UE3S 1PHPA 3KR1A 4GD3Q 1G55A 3LBHA 5H9WA 1N34B 2O8EA 4MRAA 4C06A 2IVZA 1ODKA 5EPUA 2BKAA 4ZT4A 1CY2A 1T2AA 4R4JA 4X1YA 3WGLA 2AMFA 3LZDA 1CPYA 4KE6A 4I50F 4NZZA 3BSWA 3V2GA 4NDZA 2JGDA 5IFLA 2BEVA 1JPJA 2Q4EA 2PGIA 5TMPA 1R4ZA 2HAEA 2A59A 1LFAA 2JAPA 3BRWD 1FB5A 3WV4A 2Z83A 4LF9B 1WG8A 1E2HA 4GUAA 2TMYA 5K99A 2B7BA 3DMPA 2NO9A 2RB5A 4A03A 2AYXA 3KPVA 4X7MA 4A1FA 2FPIB 2AGVA 3KAJA 1ESDA 3D2AA 2ROQA 3FI0A 3HKCB 3S1SA 3BWCA 3FCXA 2FPXA 4L16A 4NOMA 3VHRA 1XN4A 4MDYA 2VTBA 1UXGA 2YN4A 5HE9A 4B73A 1AXRA 4YRFA 2ZTLA 2FHPA 3H97A 3WMWA 4ZI5A 1LW7A 2FB9A 2FZWA 4XAQA 4YCSA 3T0IA 5F35A 2D06A 5WRFA 5IASA 1PSDA 1VQ1A 1AKNA 4BNUA 1ZIPA 4JI7B 3ETHA 4J4BA 3ZXXA 2FVXA 1V4VA 2I03A 3KZOA 3CR7A 4Q7MB 3MPUA 4L27A 2AC2A 5FAXA 3IAFA 2DHDA 2JA1A 3SBOA 1XDWA 4EG8A 6AT1A 4RJTA 3CT6A 5K6AC 5CFNA 1D1QA 1EUDA 3D4BA 1OLXA 2G06A 2H5IA 1QIMA 2B1GA 3ANNA 4O1MA 3GLFA 5CB6A 1MAHA 4DA4A 4M0KA 2ZATA 2I66A 2YZGA 4DWJA 3KZXA 4MVJF 1H2HA 4BU1A 1JWBB 1T1EA 3SCZA 5LM3A 4X94A 1BRMA 3K09A 3P9RA 4EITA 4MAMA 2P6PA 1EE1A 3CIOA 3RSHA 3QWIA 4CGYA 4JVNA 5EHZA 2XH8A 4DZZA 3TYXA 2JFUA 1ZVMA 3M49A 3QYAA 5JI2E 1YVRA 2REQB 2Z4SA 2ZYUX 3ICQB 2J4DA 3PC3A 4M1SA 4ND7A 4V2IA 3JVDA 1Y4ZA 2GAOA 2R1ZA 2WAMA 3LFHA 3OX4A 4FGUA 4KUEA 4M0CA 4MWBA 3ZY2A 4J43A 4A73A 4AICA 4UOZA 5IHXA 2C8JA 2FFRA 1F8XA 2B5OA 4MVJI 4OQ4A 1LBEA 4TMVA 3RO7A 3DE4X 3BB1A 1L5SA 1JALA 3RBXA 3UY4A 4BY9E 5JADA 2JHAA 1L4FA 2VNHA 5F51A 4J07A 3ZI7A 3CF0A 2XZOA 2Z9DA 2A0UA 4FFPA 4XSVA 1BEEA 3U9TA 4CDRA 1PYDA 3ITNA 1I10A 8ATCA 4GX5A 1VGVA 1LKZA 1ISGA 7YASA 2OB1A 2BEUB 3CWCA 2NO5A 3V3TA 4EHNA 2OZEA 4ZYLA 3CVOA 1IULA 2Q1WA 5DNVA 3UKJA 1FBTA 4BGVA 3WRVA 4QDJA 1JWAB 4C29A 3HVUA 2JBWA 2VI5A 4KR7A 2Z43A 2QX4A 1Y63A 3NTQA 1ISJA 4GW3A 1P9RA 4G0WA 2D74A 4H7PA 1L5KA 2W4IA 4UNQA 1RLTA 1RADA 1U7OA 4RPCA 1ANKA 1VCIA 3HBLA 4L4UA 1VG8A 4IFIA 1WLSA 1YR7A 4ALLA 4DM4A 1P4JA 4KQEA 1D2NA 4LZOA 5FWXB 3LK6A 3VKUA 1HT1E 1OIVA 3D6FA 3L7JA 3PEEA 4U9UA 4MR8A 4D0NA 5EPEA 1Y89A 4HZUA 2R8PA 2ZB8A 3N86A 3Q3JB 1U8CB 1J06A 4DLKA 3UHOA 3DL4A 1KSHA 3UT0A 5FORA 5ALPA 3EPJA 3ZV6A 4UTRA 2ECFA 3MUOA 5EERA 4ATNA 3WZ2A 8LDHA 3W5AA 4Z3OA 2Q3MA 4JXXA 3I4FA 2W00A 1ZVJA 3EQ7A 3L77A 1JMYA 3UBTA 1ESZA 4OP1A 3EIFA 4PLPA 4YMTA 4YMHA 4Q9IA 1I0LA 4PPFA 3HCDA 3DCJA 4RF2A 2R87A 4UVEA 5IBRA 4CMIA 2FN4A 2HMVA 2AG5A 2Z9CA 2BR3A 3D8SA 2XITA 3I1FA 3K9NA 3M0EA 4NI5A 5G0TA 5BSRA 3SLKA 4BCBA 3ZWAA 1U8EA 2QNBA 4L72A 5CURA 1ECBA 4R81A 3HWX1 4RGQA 1H1DA 1BWSA 2VJPA 3D6MA 3H6HA 3VXKA 2O3RA 3JQGA 4YI5A 3EGXB 4BMPB 5A5VA 2Q7OE 1P2BA 2FG7C 3LF1A 4MUKA 2WFAA 3SQWA 2ZWMA 2RHBA 4KQKA 5BMVF 4KQGA 2H4HA 2C1XA 3UWKA 1IUNA 3X1JA 1EEXB 4TV8A 5BW5A 3GROA 1Q0TA 3D7SA 1DTWA 4NFYA 3N0RA 5FUMA 2R85A 3IURA 5FTNA 1LDEA 2AUNA 1WKCA 1V95A 3U3RA 5F3WB 3BIJA 2JK0A 3SQXA 3ETJA 3JPYA 3MSXA 3OJOA 3AXTA 1TK9A 2FUKA 4JC8A 5IFKA 4HXYA 1G59A 2PD6A 2RBEA 4D1YA 1LZKA 3MA0A 4BJ5A 5IDVA 3DOEA 1RWKA 3OOSA 3HKDA 3A3YA 1R6BX 1T35A 4XTCS 1R4AA 4OFBA 5HM8A 2GYUA 2OM6A 3WB9A 2CJWB 1C41A 3ZDZB 4V0KA 2DERA 2IZ5A 4K6OA 2ZREA 4N9QA 4JODA 4Q1FA 4WOBA 1VPDA 3EQ6A 4ER5A 1KEPA 4OQFA 2QA5A 5G41A 4HGZA 3EASA 4UNIA 2O9JA 1NJ1A 4JA2A 3MRVA 1U98A 4UC0A 2JRCA 3B7WA 3T3PB 1UMBA 1EG2A 1ULBA 2EFYA 3C70A 3ZGOA 5C1DA 3UJ6A 1ZN7A 2ZIAA 3PLAE 3BA1A 4BX2A 4ZJZA 4V1CI 3DXXA 2ZU0C 1A2KC 1FFCA 2ZYTX 1XXLA 1VIYA 3GRZA 3CNHA 4F3CA 5EZYB 3DV9A 3O92A 2Y4NA 1AGYA 2ZTHA 2IF0A 1EIZA 1Z29A 2ZWPA 4PPYA 5KKAA 1G21E 2Y27A 3O8QB 5GWXA 4TLCA 4EGJA 2QX7A 2V5UA 5KAPA 3ORFA 5K45A 2VHTA 4GPEA 3E2PA 1Z2NX 2J3LA 1L5LA 1SEPA 2IX9A 2ZSUA 4Y9UA 4U39A 3TTWA 1EA5A 4IDHA 2TMGA 1FX0A 3KQOA 1U6IA 2YJ3A 4JVMA 4LYYA 4YUVA 3THWA 3M3DA 4EQZA 2DR0A 1H66A 4IH4A 5HUHA 2FMXA 1E9CA 4HNAB 1F4VA 3HE3A 1SD5A 5JJBA 2NNLD 4K6HA 1SVSA 1NE7A 2PG3A 3ZG6A 2DOKA 1GY8A 4RL4A 1OGJA 3JQRA 3T9CA 3RADC 2YXNA 4M60A 1SBYA 2R96A 4B79A 1KDVA 1KZ1A 1L5WA 3O74A 4BTVA 1PL8A 4HPJB 4JA0A 3ETDA 4AO6A 2NSLA 1MDFA 3CISA 2YZKA 3NEPX 4CQLA 2PLNA 3O8DA 4D9JA 2Y1LA 4GO1A 5P8WA 1X38A 5KWEA 2WMDA 1UXIA 5EFOA 4KQHA 1JL3A 4A4DA 5J4LA 1AE1A 3AO0B 4KQJA 1RI1A 1E32A 2AC7A 3OA2A 1V11B 3Q6NA 3TN7A 1F7UA 5BY2A 5REQB 2JI8A 2Q9CA 3A9TA 4NYIR 1ENYA 3A0UA 3ORRA 4QULA 4F4CA 4NYMQ 4U02A 3V4ZA 3C3BA 3OTWA 4WNAA 3KK0A 4GDMA 2H1IA 4H0NA 5A06A 4W1SA 4NYMR 1WD7A 2O2GA 1KDZA 2C97A 1UZMA 1U2QA 1Z2AA 1UBNA 5EI5A 5IT5A 1FMFA 5AVVA 2JBAA 1MF7A 1NA5A 4INZA 3PLRA 5FADA 4OMDA 2QT1A 1GKKA 2YRFA 4LXIA 5FTLA 3DBVO 3N7AA 5PNTA 5G2OA 4A3SA 2HNAA 1V8OA 3TXXA 2J0UA 2C29D 1YVDA 2HC9A 2XGMA 1XT6A 2VPYA 3NHYA 5D2CA 1T5OA 5C3UA 3JZDA 4R2LA 3JRWA 1GUFA 1NI5A 1Z6AA 2PK3A 3N2IA 4KLRA 1M76A 2VIIA 4M21A 1FYDA 1YZTA 3TR5A 3L8CA 4C22A 3NH6A 4RZUA 4V0LA 3AJDA 1XHEA 4JR1A 4C21A 3CZAA 4E46A 1GQFA 2VDRB 3L9XA 3OEWA 1K3TA 4YK7A 5LWQA 4M9XA 3GLSA 1WCXA 1M6NA 2COKA 1JDJA 1E79D 1QONA 4M9CA 1NM5C 1ECGA 4Y67A 5BYBA 4AUMA 2DPLA 2LXNA 2PVSA 1IXYA 2Z5VA 3DR3A 1VI2A 1HF3A 2XQIA 4QPZA 4W7HA 1GDHA 1PIWA 2QX9A 2YCBA 3N6RA 1CQIB 1IHYA 1N2JA 4LWQA 3RK1A 2GTPA 2AF3C 1AVTA 2BFWA 3W2HA 1FTSA 1JSLA 3OM1A 5BYKA 4MPPA 3UCEA 3K9LA 5JR3A 1F8GA 4NQZA 2OC9A 3ICPA 4PX9A 2GI4A 2YUIA 1G6KA 1NNLA 3NOVA 3R5XA 5HF8A 3ZD8A 4LXXA 5CLIA 3RHTA 5FBVB 1DHRA 1SU4A 2E55A 3KX2A 4FSDA 1E60A 2UZ0A 1XCJA 4DTIA 2C5SA 5DVZA 1FP1D 2AFIB 3EWNA 3K0AA 4YP9A 1B8VA 3UMBA 2HQOA 5KYTA 2JAWA 2XVZA 2N46A 2ZSAA 4XEHA 4WZAB 3OCCA 4AJOA 5JNLA 3D3WA 1Q11A 3H0CA 4FNAA 1WXQA 2A5FA 5B2EA 2FQQA 5JNWA 3LLMA 5EY5B 1GTRA 4GKJB 5AHOA 1AQUA 1RQRA 3RHSA 3TM5A 4MHOA 5GGXA 2LVBA 1QYRA 2JNWA 3DOFA 3BAFA 1SBIA 4ZVRA 2B0JA 2DTXA 4JI3B 2WZDA 4D9KA 1XD9A 1S2LA 4MIYA 5FXMA 3FTQA 1KC3A 5KYGA 4C0JA 3QPUA 3DQQA 4EFLA 5H81A 5JJKA 1ZKDA 3OF5A 1N6RA 1HQKA 1C1HA 1R6VA 1UINA 2W0SA 4WUVA 5DFAA 4MWTA 5KX5F 3VO9A 3EN0A 1SUIA 4QODA 2YY5A 5J43A 2NAFA 2YBEA 8MHTA 2YWXA 4DL9A 4MYCA 3U16A 4Y7DA 2IUYA 3V97A 2IEZA 2J5BA 1JIVA 1Z36A 2P9FA 2RJOA 2WVJA 1YDHA 2ZVDA 3CGWA 3IPYA 1EFAA 3DZKA 4G2NA 1GLGA 1O6FA 2F3RA 4M38A 2QD2A 1EZZA 3HYSA 3HM9A 1BN7A 1JNYA 1UKEA 2IIVA 4MW9A 4PHFA 2A3NA 5BOSA 1PUXA 1QGZA 5JVDF 1T2DA 1XQXA 1KKUA 1W0KD 2ZE6A 3LHFA 2FP4A 2I2DA 1REQA 2FPLA 3SDSA 5IULC 3FIJA 2D5BA 3VYVA 3RC8A 1O5TA 2EKDA 3CZPA 4C4ZA 4QG7A 4YMIA 4HDRA 4HATA 2HNKA 2OXIA 2AG8A 3WMXA 1L4HA 1YR9A 1HNNA 1N2CA 2GLXA 2Z2ZA 3KKKA 4Y9DA 1T3HA 2WWVD 2W11A 4KX5A 3WMGA 2C4KA 3G02A 5YASA 4BUJA 4HDOB 3ETNA 2Z6UA 2ENUA 3BE4A 1M8FA 2UU9B 4UBNA 4IJKA 4IH1A 3BIWA 3PNLA 3O94A 4HDMA 2FPKA 4KPUB 1Y3IA 2P2ZA 3P0JA 3LL4A 2Z6QA 1ZHFA 5E2IA 4YRIA 2RGRA 1N7GA 2O5VA 3A32A 1R3DA 2QEQA 1AKVA 1RQNA 2QB5A 3GLHE 4LI3X 3PJFA 4RYLA 2QLNA 5FUBA 3SIPA 3L02A 1A9PA 1XD8A 1HSOA 3D1LA 4RWEA 3ZOKA 3EUAA 1K9VF 2V97A 4AJJA 2CXPA 3TAXA 5EA2A 1DT5A 3KQWA 4GRAA 4Y2TA 4LRWA 1P4GA 3CLTC 1PD1A 3TLEA 4NOKA 3Q5GA 5KO2A 3TW6A 1YK0A 1W581 2VF7A 4PXSA 1FDSA 1U7DA 3U56A 4GC5A 3HVIA 1UJBA 4OU4A 3RT1A 3AMVA 4IJUA 2WU4A 5JO0A 2HT1A 4YAKA 4ZXPA 3KJIA 1PJSA 4DPLA 3VPSA 5CA1F 1BQ4A 1S5PA 4KWEA 3PPIA 4KE7A 2DPMA 1YL7A 3DGEC 5EZSA 3H99A 3OIFA 4H35A 4MQEB 3DEAA 4KXMA 1KAHA 4G4GA 1A4IA 1WM1A 3WL7A 4TTJA 3T4EA 2JIQA 1G5PA 1L4YA 3C3DA 3RRJA 4LTDA 4TT8A 3TE6A 3WL4A 4N5IX 1UFRA 3F2IA 4FDLA 4X6LA 3BIXA 4L4ZA 1QRAA 2J1LA 3RQIA 1TGYA 2D1YA 1U9IC 3NYRA 5FOXA 5L45A 5F9HA 3X3HA 1UZLA 3CLKA 3NS7A 2ZIEA 2IH4A 3I1YA 2JIDA 1TF5A 3MQ2A 2PX6A 1Y7TA 2O8VA 3IGFA 3DMFA 2BW0A 4L57A 2EBUA 3HB7A 4LC9A 2BF7A 2IZZA 2XPCA 1QR6A 3C5WP 4OJYA 4PYJA 4F2DA 3IEMA 4WLVA 1C14A 1TL7C 2WLTA 4O4HB 4I0WB 1L5FA 1NXPA 1CY0A 2CUTA 3K94A 4L02A 4WKNA 3V8NA 4AJ4A 4BLRA 1A2BA 1E0SA 4JROA 4XIIA 4HQNA 3D64A 4B7UA 5IF9A 3MMPA 3I6IA 5BW4A 1FMTA 2VP0A 2FP3A 3BC1A 3K1ZA 5IVKA 1WE2A 2XLCA 5CBPB 2M6KA 1CJUC 1QG6A 3C39A 2FMHA 4IKEA 1IN8A 5EJEA 1G2QA 5F2OA 2W2KA 4HQ0A 4B4DA 2XQVA 2YZNA 1WCV1 2Y8EA 2PKYX 4ICIA 4UU0A 5KOHA 2H4JA 1U2RA 4XIGS 3PNYA 1SGWA 1P61B 1K89A 3VNRA 4MX8A 3LMKA 4Z7NB 5IJ9A 1OTHA 2PXAA 1KO5A 2IHTA 2J31A 4G1FA 4XFJA 3OO1A 4V3CA 4C89A 1DQRA 2REXB 4D4MA 2IUSA 4WY5A 1FMCA 1RNLA 3BXFA 4DXHA 4F4FA 2EWMA 3EXHA 4TTQA 3CPSA 1JQAA 1M34A 1YZHA 3QLJA 5A6SB 3ITEA 4E5DA 1KDTA 1DWPA 3EQ9A 5E4YA 1TCUA 2QK4A 4KZKA 3ZLBA 2E4WA 3JAKB 5CB0A 1BD4A 3BK7A 3K1AB 3D7MA 3CLHA 3E3MA 4K7JA 4XM2A 3DTNA 4UDXX 1LUAA 1CUCA 4PF1A 2OZVA 3FPJA 1ZFNA 1ZOPA 1YH3A 2QN6A 2ZPAA 2HIMA 3AR5A 2PHZA 3DZBA 1E96A 4GP6A 1EVLA 4YCJA 1NRXA 4IG9A 4K8RB 4PQYA 3I4CA 3RR2A 3BILA 1UKYA 2WJYA 2QRJA 3W34A 2XDQB 4OBWA 4NH4A 1RT9A 3EFHA 4OKSA 3CWQA 2Q2QA 3MTDA 3DS8A 4PO8A 1QE0A 4P3KA 1L6IA 3NHKA 1KQNA 5F77A 3QVMA 4CL3A 1QX4A 3G2JA 4IFEA 4WJLA 2X2FA 2NO1A 1OUMA 2YC2C 3DDWA 3PXGA 4ENTA 4JGIA 4LEIA 4B7ZA 2QE7D 1CUBA 2HSZA 3AZQA 4BQSA 5KVQA 1Q1BA 5A4JA 1JT9A 3NOQA 2JLUA 1VL1A 4LHYA 2E9SA 3E82A 2HRDA 4HTFB 2FWRA 3QEKA 2QR2A 3PCRB 1U7WA 3W9UA 1XZHA 1DJLA 2I67A 1VKOA 1Q91A 5DYWA 4BUZA 1R4MB 4RTOA 4RSMA 2IODA 1XBTA 3KAKA 5IH3A 1DLIA 3FVTA 1C7FA 3L92A 4EG1A 1VLVA 1WW8A 3WGGA 1DTEA 2PEYA 1SVKA 3F49S 5E1BA 2AZMA 4DR7B 3PNSA 1P2DA 1ZUD1 3UKDA 2XF8A 2JJ8A 1MAAA 2IEAA 3JR3A 2K6GA 3ASUA 3P9YA 3WGKA 2XGOA 3KJQA 4RSHA 1PQ4A 2GUGA 4CM6A 5B1EA 1ST2A 5AVWA 1RPJA 3OPXA 5J4VA 1V26A 2OV3A 3AZPA 4O2BA 1G8AA 2XCQA 3SXUB 3ZXYA 4Q1DA 4EIWA 2QRKA 2ZITA 3VR2D 5L3SB 2ZIZA 4Q4AB 3STVA 1KEEA 1L4GA 5EIWA 1VI6A 4F4JA 1AXEA 2J9GA 3WYNA 3MAGA 5A0FA 1N9ZA 1W75A 1C3LA 4RORA 1ZM7A 4R1UA 4K1LA 2CDAA 3W6UA 2ZVPX 4FS8A 4I19A 1B73A 2QM0A 4NXNB 3MCTA 2P9TA 3FI9A 3QFFA 4BQOA 4OX9B 1T9ZA 5CK4A 4BO0A 4NZPA 3ECAA 4L95C 1P29A 3F73A 2IA5A 2O8CB 3W8RA 4CF7A 3OH8A 2OXCA 3IR5A 2GRUA 5IJZA 2E3JA 5BNIA 5K8VA 3TLZA 5EKSA 4C0HA 5JASA 3H4MA 1KOLA 4RFSA 1EXMA 1VCOA 1T24A 4B46A 3LL7A 2G1AA 2HFJA 4Z5XA 3P9CA 2WFLA 3WYEA 1OWNA 4I50B 3V4RA 1QANA 1THGA 4DSTA 2HA7A 1TQ4A 5BPHA 3ESRA 2AVNA 2NO6A 4PLGA 1VL0A 5SV2A 5KIAA 1OU4A 1EBFA 1L4UA 1M2VA 2R9VA 3HR8A 4TRRA 4CL2A 2CHUA 4MPTA 3E1KA 4IIDA 4NABA 4FDTA 4X90A 2QP9X 1GD1O 3WFZA 3U4AA 2VYCA 3RREA 2C4NA 1Q17A 5F1OA 1YF3A 3OQVA 1XO1A 1Q7RA 3B8HA 2CMDA 4G1UC 3TLBA 3TLJA 1HSZA 1TU4A 2H17A 3T1YB 2H0RA 1K68A 4ER7A 1Y4SA 4CYMA 2ZI9A 2W83A 5C46F 3GMDA 5JZBA 2ZDQA 1UZUA 3D6NB 2X4GA 4FMBB 4J6EA 2V65A 3QOYA 1JQLB 5DHUA 2I7XA 1Z07A 2W37A 3KD2A 1GQOA 3KP1A 4YRSA 2O59A 3KXDA 5F3DA 5CB4A 5TQ2B 3N05A 1C7ZA 4DVGA 3ZIAA 4YDRA 5HZGA 13PKA 1QSGA 1WDWB 2I3AA 4FEAA 4GYKA 3VBEA 3ZPXA 1KH1A 4P22A 2QAGA 4GVPA 1SULA 5KMGA 5LP6A 1O94A 1SBTA 3DXZA 1I2ZA 4QYWA 3H5RA 4CKZA 1DOZA 2SCUA 2ZZNA 2QE6A 1W4LA 4RANA 1Z2EA 1XTJA 1K8XB 3G0OA 4J9UE 5EJ6A 5IJ0B 2H1VA 1YC5A 4HRXA 3NU1A 2A9KA 3LIPA 3TOZA 3FY4A 1JE0A 5IT0A 1X2EA 1EX6A 1X13A 3W6OA 1APBA 4POOA 2RHLA 1U7PA 4TXNA 4JL5A 3GNLA 5THKA 5HR5A 5AXCA 2QSJA 1YU6A 1FTNA 4XYGA 4ZPXA 3F6SA 3RUAA 3VR4D 4GKBA 2VK8A 4OQZA 2CGEA 1IZ0A 3NM6B 2O1XA 3B2QA 2JFVA 1NL3A 4Q15A 5ALLA 3ZJ4A 3LECA 3O21A 2AOVA 2OB2A 3P0RA 1EUYA 1V1MB 4G07A 3NLLA 3C5VA 2YWRA 2WJGA 5FI3A 3ID6C 2PD4A 4PHHA 4R2JA 1UQTA 1LXCA 2JAQA 3TSZA 2CNOA 4UBOA 4YJFA 1J33A 1RPAA 2FCAA 2JFQA 2N3ZA 4D2IA 1BW9B 1YR1A 2VEOA 2JIOA 2FRDA 2Q5LA 6REQA 2H2IA 1PGNA 3HB9A 3OZFA 2HA3A 5FL3A 4JP5A 4CKBB 5BXQC 4JFRA 4CN9A 4MUMA 4OFXA 5JAOA 1OB2A 3QBVA 4HL6A 1CERA 1ABEA 3IVCA 4I9UA 1EXWA 4NENA 1A69A 1U7HA 1MAVA 2AFHA 3H6GA 3L79A 3QSGA 4ID9A 5T8KC 2EEZA 5E3HA 1FUEA 2D0PB 4DV6B 3I5XA 4LYEA 2ZRGA 3U4MA 2W6ID 3OIDA 5JIBA 1V25A 3PQ5A 4AZVA 2RAFA 4A0RA 2EU8A 4C6TB 1TTHA 4UXHA 3EAGA 1VP9A 1DSSG 1ULHA 2XA9A 2D5LA 3FB1A 4WLFA 2ZB2A 3G8CA 3OOYA 2M6RA 5IDYA 3ZNQA 1FU8A 2GLTA 4Z51A 2X7XA 4ZMBA 2CXQA 3TL2A 1XKXA 3QF7A 3R3YA 2VNSA 4RHYA 3EXHC 5E4FA 2HHAA 2MYNA 1GGHA 1OGYA 2XMPA 3RPEA 4RXMA 2MR5A 1LDGA 2VWGA 3EGCA 2B1RA 2NSYA 3DVQX 1HT2E 3ILHA 3G1TA 4W9NC 2BGLA 2FFQA 4UTVA 4OHBA 1D0IA 1ONNA 3LC2O 4L0CA 1OX4A 4U0KA 1YIAA 4PCLA 4BLUA 4BX0A 4R01A 3K5WA 3R24A 1K63A 3C3KA 5BRAA 3NB0A 3HVRA 4UD6A 3BXXA 1EA7A 2RJ3A 5FPSA 3TIIA 3USCS 3WGIA 2QOEA 3L0DA 4N6OA 1SCUB 3T3GA 2CJXA 2H08A 3ST7A 1F4PA 1K5PA 1V6SA 3IMKA 2AXQA 1P9LA 2DULA 1JX6A 1QRRA 3FNFA 3TR0A 1MGPA 3D3EA 4XLZA 1TO1E 2H4ZA 3AB7A 1GTVA 4DCGA 2ATCA 1JFSA 5JD3A 1EUCB 4UDOA 4HWTA 2ZBDA 1DIAA 2I1LA 2YHBA 3NONA 2NN3C 2CUNA 3MEQA 1RM5A 1OAAA 1R7RA 4UMDA 1AF4A 3DP7A 3SZLA 3ABQB 3V8EA 1VG9B 4NPCA 2WHPB 1Z6QA 4BBJA 4YPVA 2FDCA 1V6AA 4LYHA 2C9MA 1RWXA 5K8LA 1ZR4A 4ZOLB 3W5JA 3P8ZA 2PJUA 4R0NA 1QFZA 2QX6A 5BVGA 5C1OA 1JTEA 2B30A 1KTVA 3WLQA 4B4KA 2X1MA 3T34A 2YDXA 3DAHA 4EF6A 3KYJB 2OKGA 3IAHA 1KI6A 4AMYA 5A3QA 3N0TA 5ESDA 1ADYA 4WCFA 3NHZA 2WU0A 1QF7A 2IYTA 4BGDA 1JFRA 3JD4A 4ZT3A 3IP8A 2NPIA 3U4DA 3GT7A 3UMGA 1VCHA 2FWAA 1WUHS 3KHUA 5KPJA 3L41A 3EPHA 3P4XA 4R1PA 5D86A 2PR7A 1DPFA 3RD5A 4FYKA 2YVAA 3C87A 4V1CB 4MS4B 3SM3A 5L9AA 1KPHA 1SOAA 1Y9EA 3PCXA 2UDPA 2ZE7A 3HSKA 3RCBA 4QEZA 2PMFA 2BYTA 2WIDA 2APJA 1UM9B 3FYUA 1X1CA 3PDCA 4XB1A 1P5FA 4Z1MA 4I1PA 1ORTA 1FXUA 1IY2A 1I80A 1G9SA 1O4WA 1BZYA 2ALJA 2B9VA 4NHOA 2JPDA 5HF5A 3FHLA 4GI7A 3BTSA 3UMFA 3EOBI 5LN1A 2P3QA 1FRNA 2C07A 2MU1A 3OJEA 3STYA 3T5TA 3KR9A 3L0CA 3AVTA 1CR2A 2P8JA 3VH3A 4LDJA 3IAM1 3SFZA 4CI0B 4XWTA 4YWHA 3L2OB 5BUSA 1PR5A 1P2FA 5MN6A 2YKGA 2JZOA 3PNMA 4JJFA 3Q88A 1L4BA 1MC5A 5A05A 2XBUA 4K9QA 1KBQA 5JPDA 4LMBA 3VAAA 3MTGA 1PT8A 3OEED 1KAGA 4L0DA 3OFNA 3NWJA 4NCIA 4TTTS 2YVUA 3ZWKA 4E5MA 5KJ1A 3KZCA 5K0EA 3U7HB 3SDBA 3ZQKA 3EMVA 1SOWA 4RA6A 5A03A 5ITZB 5BN4A 1S02A 2OP0A 4F0JA 2O4CA 2YX1A 3MCUA 4JYPA 4TOIA 4QTUB 5KYVA 1Q44A 1JR4A 1FJ2A 1T15A 4J16A 4NATA 4RENA 4C4YA 3CX6A 4DR3B 4ZZ0A 4D8TA 5F2NA 4UPEA 2V9PA 2BHRA 4AKEA 3PQCA 1ZSYA 2PT7A 3B9QA 4XDHA 1Z5PA 1VDZA 1W4CA 2WC1A 3EISA 3K4QA 4DBLE 4FHDA 1D0SA 2HRZA 1K8QA 4MW4A 1A8SA 1D2AA 3RROA 2Q6TA 4KI7A 3UUEA 5T4HA 4CFZA 1HMPA 5DIFA 4GPAA 3CPJB 2W6ZA 4EECA 1EDZA 4OK6A 1SCJA 5EINA 3RYFA 4FZ5A 2G5PA 1NVEA 1TVMA 2CD9A 2WJ3A 3G2LA 4CMHA 3G8DA 1JDBB 1AOXA 2VT2A 3IA7A 5A2QA 3R9IA 1GL7A 5LU9A 1LF5A 3G2NA 1QHFA 2KS6A 2QNIA 2J3HA 3A31A 4RADA 5CLHA 4A92A 5EJMA 4DLNA 2HRQA 4R16A 1LPSA 4Y98A 3RAPR 3KPJA 4JQSA 3K31A 4BXOA 4DARA 1ESNA 4LNUA 1G5IA 1YOVA 5KU1A 3SOZA 2HCRA 5JCJD 4GSLA 4JUCA 4WDQA 4CT0A 1V5GA 3RTCA 2XMSA 1YCGA 1T8TA 4R0VA 1JLLB 1M10A 1QVWA 1UC5B 5DJ5A 2R11A 4NCJA 2GEKA 1FFWA 4TLEA 4UM8B 1ZZEA 1W85A 3B1VA 2WHQA 1U1EA 4BJHB 1GA1A 3C6XA 1XXHA 4JKIA 3UG6A 1Z13A 3KO8A 5FBKA 4B9AA 1JA0A 2ORWA 4UMVA 1QOZA 2RFLA 4ESHA 2BZ0A 5JI3E 3HSYA 1NXOA 2WOOA 3IUNA 2IHZA 4OFZA 3SR0A 3IQEA 1Q1ZA 2DCMA 1I9GA 4WLEA 5JC1A 5TJ9A 2V4ZA 1V16A 3RLFA 3SC6A 1OV4A 4FFDA 2CHEA 1T6ZA 2PGOA 4FZVA 2CVQA 1M7BA 3QLTA 1WEHA 2BKVA 1USIA 2O6LA 3B20A 4QAJA 4HLUA 2MSKA 4G9EA 1L6RA 1SMKA 1IXRC 2WZQA 2PKQP 4OH1A 3KLOA 3L5KA 5I7SA 3RS4A 1CTQA 2IF2A 1QGUA 2F1OA 3VOAA 4LKRA 2OG2A 4ARSA 4JITA 4HD8A 4QUKA 1FS6A 3R7LA 1BAPA 4JI6B 2OCKA 2YHAA 4ZO4A 3W2EA 4GPD1 2X0FA 1ONBA 3EZLA 4IF4A 4HDKB 2WIBA 4TVOA 3HDYA 2PX3A 1TA4A 3W04A 4Y6LA 3G2IA 1XLTA 2WW8A 3TLGB 2WB2A 1U63A 1U0LA 3IBSA 1PTJA 2C0CA 4G63A 4IMRA 3NOXA 2IW3A 4EJFA 3DULA 3OE7D 5B55A 4PZYA 2NUAB 2IUFA 1WXIA 3OLVA 1PFQA 4QOIA 5AK0A 3SLRA 1PZXA 3H9GA 4C9BA 4YAIA 1P1KA 2ERCA 3AIMA 2HCBA 2IPMA 4O4IF 3KJFA 2WUVA 3ZWNA 1DC3A 1E9AA 4DYHA 4L2IB 4CIAA 1ATIA 1XU7A 3R20A 3DTTA 1NVXQ 4YFVA 3KSUA 5LFAA 1E92A 1NVUQ 2Y1KA 4CI9A 4A23A 1M2WA 3IE2A 4X8HA 3STHA 2J6IA 1LNSA 3EZ2A 3P2OA 2Q3DA 1GUDA 4U5QA 1VE5A 4BLTA 1GXSA 5CW1A 2ZTMA 3D5EA 1SQGA 2ZUFA 2DFNA 5LQRA 2IXDA 4QXOA 4D0RA 4M0FA 2OAQ1 4UUOA 4IGEA 1E5QA 1E20A 4GG1A 4FHGA 2Y1XA 5LQNA 4G5HA 4A8JB 4F2GA 4Z6KA 3DL0A 3GPCA 2AV6A 3F98A 3U7RA 3DMGA 3OU2A 4BNWA 1WY5A 3B3AA 3ZVNA 3P5BA 3KTFA 4PRZA 2DUJA 3N87A 3AI1A 1XTSA 3SOPA 1Z18A 2FEXA 1KTIA 3A2KA 1PP4A 2PL1A 4YRNA 2QM7A 4YP1A 3TB6A 1P2VA 4W5QA 4EGQA 5KDDA 2A5GA 4DGSA 1M6VB 2Z30A 1HQDA 4BMXA 1PV4A 4R9RA 1CY6A 1L3IA 3OX2A 5AM1A 3JQBA 1JILA 2IXGA 5JVDB 1K3UB 2YICA 3IQFA 4KIGA 1GFSA 1HEIA 2QJWA 1XEXB 3DBLA 3QNMA 4XXHA 3W3ZB 2O5CA 4PRKA 4J4HA 2MYPA 1JG6A 1GDDA 1P31A 3AR7A 1NG9A 221PA 4PANA 1XHFA 4OHUA 5KKCA 3Q7SA 1RHJA 3IT3A 5DXAA 1YACA 4CM3A 3QUCA 1PR0A 4FFNA 3NXSA 3B6JA 3SYRA 1X7XA 4OGWA 1UC9A 2QLFA 1IK6A 2R7NA 4KQ9A 3TS1A 3WRWA 2YWDA 5K03A 1NDUA 4HBGA 4RPGA 3GEEA 2D1FA 1GJRA 2DPYA 3B3JA 1W93A 3E9YA 1ATZA 3AIOA 4B3CA 3A1TA 1SJ9A 4BVKA 5HQ3A 3HWSA 3DM9B 5EE5B 5TMBA 1R9JA 5EJIA 3DBOB 3ZCQA 5COQA 3OOWA 2I2BA 3L0ZA 2GJKA 2G63A 3UKOA 2GDZA 4AD8A 4DR4B 5K3BA 4WW0A 3QUSA 5AXBA 3M4YA 3UT6A 2G82A 2VCYA 3LY7A 4GSYA 3VH1A 4ZCTA 1AD2A 3KQKA 5ALGA 2P4HX 3NPAA 4CMJA 2D2XA 3R8FA 3RC2A 4FZ3A 1IEWA 5FUVA 3W2GA 4D45A 5PGMA 2J46A 2JCVA 1AS0A 3KVOA 2MMCA 3H2SA 4NCXA 1UBUS 5CHEA 3AF2A 1E1NA 3MC1A 3P71T 1A7AA 1WDTA 4OHRA 1E6UA 1PU2A 3U7IA 4GQIA 3NOOA 1E18A 4IV5A 4LNHA 1AHIA 5DI3B 2JLQA 1NP6A 1U28A 1TQ6A 2BF4A 3SZ3A 3WWCA 1CNMA 2QVYX 4U2FA 5TSDA 3S2UA 4BKRA 5JNRA 4X8OA 1C4XA 1VA4A 1R6AA 1E4EA 2VDKB 4BJ1A 1M8GA 3LKDA 4CDNA 3AY0A 3GLQA 1NN1A 5TF0A 5CA1B 4MTLA 1J0BA 1CCWA 1KZ9A 1OC2A 1V5IA 2RSLA 4L22A 5EJAA 3T9DA 2EJCA 3E7XA 1FFDA 1IEXA 3H5TA 1LPAB 4J16C 1LRKA 4FYWA 4QTYA 3W05A 1NOJA 1LDMA 4ZEMA 4E33A 4N1AA 5HIMA 2LCFA 1NW4A 2RD2A 5CDGA 1KY4A 1W2WB 3QEMA 5ED4A 1BXGA 5EIOA 1CEYA 2YQZA 1AIPA 4QNNA 2ZJ1A 1Z5NA 3D0RA 3H11B 3K4PA 1XP5A 1DAEA 5A4MS 2RBGA 5FPQA 3AUKA 3D1VA 1KL7A 1CQJA 4OIFA 3AM3A 1D6JA 3C2QA 5TPWB 4LCEA 3VHLB 2B94A 3Q15C 2FW0A 2XRYA 4JN6B 4YAJA 2BRUC 1H42A 4P4SA 1KQGA 3DOHA 1EQAA 1Q3KA 3DE1X 3GVXA 3NV9A 2YXDA 3CSDA 4G5RA 3T9FA 3BM5A 1WA5A 5FEMA 5K0FA 3IOBA 3ANXA 4CKCA 1ADFA 4RLSA 2VXCA 4JB3A 3QW4B 3WL3A 1I2DA 2KMLA 4YJ2A 3BWEA 2OV6A 2R60A 4I6JA 2CNWA 3NALA 3V33A 1LPOA 3MGGA 2X15A 5CGZA 4RVFA 4QKQA 1PFYA 1LTKA 2CNBA 3ROKA 3IO5A 1SKMA 3GXBA 3Q7PA 1G9XA 3OWXA 4ALJA 4BO2A 1Y1SA 2B4QA 3HS3A 4QGSA 4AY3A 1Q0SA 3EH1A 4IV0A 2QQFA 2OBNA 2E89A 3FKQA 3NAMA 5EYPB 5AVJA 1ADGA 3QVTA 1G17A 2FMIA 4KSBA 1MH9A 1KPIA 4DZTA 4YLGA 5JQGB 1YDFA 1TYEB 3TZQA 2YC4C 5K3FB 1UK8A 1EFKA 5IAOA 2QTVB 1VLHA 1LFDB 3WGZA 4WFIA 4FZRA 1H2ZA 3TF5A 1WPGA 3JAWA 3P0EA 3WLIA 1FSZA 4BRZA 5GJVC 3LWBA 3I04A 1I3OA 3AR9A 4U8HA 2PTHA 2QMYA 4M7PA 2YHIA 2RH8A 3DDUA 4PTYA 4GM4A 1MT3A 1SUEA 3PEYA 3TLMA 1OFTA 3O7MA 4E2WA 4WWHA 3AGQA 5HJ2A 2WHEA 3MJVA 1TKAA 3H9CA 3ZZTA 4IS3A 3B6EA 2H31A 4L9WA 3MGCA 1XLTC 3EXIB 1C5KA 3UANA 3RS7A 3ESCA 2C4TA 4RF3A 3UH1A 1OFHA 2YJ4A 3V8QA 1EB8A 5ANRB 4PWYA 3ZDRA 4CR8A 5ADHA 3OCUA 1IJKA 1VJ0A 3PGKA 2V5VA 3MRSA 3AY7A 3MCZA 3T7DA 3ZI4A 4F11A 5ICGA 5HCUA 3AI2A 1O9GA 1QQ7A 5I9MA 3FLMA 1PQWA 4KUGA 1WDMA 1S4MA 2DECA 3N0XA 1SY7A 3S44A 3LVRE 4JKYA 5F1PA 4ZT5A 2BH2A 1KXJA 3VC3A 1T0BA 2WJJA 3JWPA 5E8RA 4EFKA 4A1OA 3D8NA 1E3JA 3NIDB 1YCDA 1G66A 1GTZA 1DKNA 4DDWA 1OHHD 1R0CA 3IRVA 3T7KA 1UWLA 1IYZA 1JQDA 1P6QA 5JHHB 5AVUA 1M75A 4WK2B 4RZ3A 5I48A 1NVVQ 5KCZA 5FWNA 1M7GA 4PTLA 2AJBA 3CKYA 1VPWA 1WS6A 1NVVR 1W44A 3HRIA 1JYFA 4I36A 3FPGA 3HLKA 1RACA 5AHRA 3WIOA 1OX5A 3UAGA 4MS1B 3SQNA 4JKOA 1F8FA 5KVVA 3UJNA 4NK4A 3AUXA 1IL0A 1SWWA 2PIDA 4PM4A 4HFMA 4Z4IA 2C9CA 2DQSA 4AURA 4I3HA 1EMDA 3IFSA 3K1TA 5AHXA 4Z9AA 1FVHA 1HDOA 4LC0A 1LDBA 1F5SA 3GT3A 4AIRA 1UAGA 3CLUD 1WBBA 4A8PA 3CVUA 3WSTA 1Y6GA 1XRRA 5F98A 2CDNA 2D2VA 4FMPA 1T3TA 5SYMA 4JEMA 1CEXA 1C3XA 1XEWX 2QM8A 3IRUA 3OQHA 3Q9NA 4MKFA 5IJWA 1ZY2A 2DUWA 1ONPA 2BFCB 3U4IA 3UAZA 3QP9A 4WLOA 3R9XA 3K15A 4LJ9A 4UBIA 4RHFA 3ZDQA 3JQ7A 2AXEA 4P0TA 2IWRA 3GLFE 3KCQA 3QWHA 1CF9A 1NIPA 3ZWVA 4EPRA 2G0NA 5BN5B 5C8XA 3TNYA 2CXSA 5JWRA 2PS3A 1HFJA 2AUTA 3GNTA 3K53A 2PL5A 3VFDA 1L7PA 1BDBA 3CRMA 5C2JB 5JATA 4IWNA 3AFOA 1QJ4A 2JH8A 5IUKC 5TPZA 3G82C 1G4AE 3VDXA 4C7OA 3GQBA 1S0UA 5E1MA 3T4PA 3W4JA 4OVKA 1G7TA 2AEMA 3PHHA 4WESA 2Z2YA 4MV9A 1RM4A 1VPLA 2Y2VA 1XRMA 5K0LA 2I87A 2ST1A 1SRRA 3SYNA 3UQZA 2Y2UA 5HIAA 2EHDA 3C8ZA 3ASVA 3GVIA 2ZWIA 4TTSA 3K5HA 1YFJA 2WKWA 4RY9A 1YFZA 1ZL0A 3FMPB 2JF0A 4O3FA 2J5XA 4TYMA 4BE7B 5JLJA 2J6HA 3NM5A 2XNJA 3E4DA 4ARUA 1KP2A 4UVIA 5E38A 5ALNA 5I7HA 5K1ZA 1TKRA 3U6BA 2H0AA 3OCYA 3IAS6 4DWVA 1ND5A 2PL3A 2WSIA 1NLYA 1RAGA 2WYIA 3N70A 1ZL2A 5JCJA 3RUHA 4WX2B 1K27A 4JS0A 3KLNA 3UA3A 5EIEA 2GMWA 2OUIA 4LRQA 4S0ZA 1SQ0A 2D1TA 2GN4A 5TGTA 5C5DA 3PWKA 5JCOC 2J0EA 3HDQA 4OB6A 5BNZA 4FI3C 1DCKA 2HK7A 2OLJA 2PRZA 2WJZB 2QIPA 1A8IA 1QIEA 2JRLA 4UCXA 4MVJM 5ILGA 1LBTA 2HSGA 3EZYA 4FFVA 2UUCB 2AK3A 1LBSA 2IBMA 2XBMA 1KFKB 1P17A 1M2GA 2G8NA 2GX6A 4B3FX 4EJ0A 4XQ0A 4AP9A 5I5EA 1DT3A 3HO1A 5BWCA 3ZYZA 5AO9A 1K75A 4TTAA 4GYJA 3AOGA 4B35A 1PR2A 3A1CA 1RBQA 5KTSA 5I6DA 5KQGA 2XZTA 5CT4A 2CWWA 1XDDA 1J0DA 3GLGE 4L3OA 1JG4A 3M81A 4HH0A 5IK2A 3LUPA 5A7GA 3PEVA 4P80A 2V1XA 4B8WA 1UADA 1XQ1A 3TSYA 4FJ2A 4D8VA 1PEYA 2Z57A 2HN9A 3TDNA 4EJSA 4D3FA 3HCEA 3HXTA 4L50A 4ZYTA 3WYFA 1JLSA 1RWQA 5CCBA 1SOVA 4INOA 2A1IA 2B4AA 5B1DA 3E58A 2FK8A 3OLCX 4BC1A 1MHPA 1HEYA 3E0QA 1VM6A 3G1UA 2CBXA 4LX8A 3WGMA 4C3ZA 1KMHB 3VZPA 1XQWA 1HYGA 1U2EA 2WYWA 3EUFA 4B4UA 3DFUA 2QHXA 4HMQA 1A3CA 5A0TA 2JGKA 3F6YA 4YGYA 3OJWA 5F2EA 1U9ZA 3I1IA 3AUFA 5AKXA 4N3NA 4QU5A 1I7NA 2VT3A 3U13A 2GBIA 1AK2A 2BMAA 3P96A 2CMHA 4CM9A 5DOVA 4EEKA 4TT3D 4YCNA 3HUDA 3ESAA 3JWGA 4ARZA 3OCWA 1HWYA 2H1SA 1Y9AA 4BKMA 2BUAA 4L8FA 4FBGA 4WZZA 3M3HA 3RFXA 3WC4A 4F84A 4WRRA 5CDUA 3RDPA 4PAOA 4YXFA 5AVTA 2BBWA 4NDAA 4NULA 1PLLA 3RODA 1D4AA 4ZIRA 1RHRA 4YCMA 3Q9LA 5GJWC 4FUTA 2OUKA 4V2UA 5I7AA 5I7UA 1JEQA 3QLVC 3MGBA 1K98A 3FBTA 3MN1A 1BRTA 4HH3C 5ICMA 3DCNA 2ZJYA 1ZD9A 2ZG6A 1O87A 3NUGA 4HH4A 5JDCC 4IHJA 3WXBA 1U5BA 3OPNA 3RAFC 4BEJA 2FJUA 3E0XA 2CEAA 4V0RA 2ZJBA 4R6XA 5IC5A 2UKDA 5C0OE 1G6OA 4BAZA 2FE1A 1WBJB 1IHUA 1V0JA 2HX1A 4JBXA 3ZDAA 4Q4JA 2AR0A 1UR5A 2RHWA 3SEQA 1YASA 2YYAA 3NBYC 1MORA 1NX6A 1R3UA 4PG6A 1DRWA 1RS0A 3L7OA 4RA9B 2VRCD 5FWYB 1ISHA 4YONB 1RLMA 4H1VA 2CD7A 2O6HA 4PICA 2AKEA 2Q99A 4WXMA 3STWA 4C07A 2FMKA 4GHWA 1T4CA 2YOHA 3D8RA 1K2WA 5DM2A 1M74A 2HA5A 5GM1A 3RHFA 1S96A 2YJGA 3C48A 3TZBA 3WGHA 2I2CA 4BATA 4CR6A 4I8DA 4L5JA 2R66A 4A5SA 5KUTA 1TA0A 2A9PA 2YJNA 3MILA 3VKFA 5BV8A 2E4AA 2HBQA 3ZK9A 4U00A 1USWA 2QN1A 1M67A 1ZKMA 2H4WA 3NKFA 4NBKA 2D54A 3U09A 4DUZB 3QU9A 1SUDA 4L85A 5CPFA 1DBWA 4BO9A 2R79A 4F6CA 4EYOA 3QKTA 4UUBA 3IMFA 2XF2A 1B0UA 4US0R 1PGOA 4QFMA 4L4XA 4XJTA 2VJMA 4E5VA 3RTEA 4MQ4A 2R8EA 3SLGA 4F4HA 3AR3A 5KQPA 1OQAA 4IQGA 4X44A 3PQEA 1XMSA 1GQRA 3ROFA 1RABA 4CKWA 2GPNA 2V03A 3I2GA 1RYHA 1TQ2A 3NXKA 4LVCA 4PQEA 4BP3A 4K8OA 5TXGA 1N7JA 2H0QA 4ZVVA 4D3SA 1P7ZA 3J81A 1BMFA 4EG5A 2X4LA 1QH8B 4JAVC 1L5HB 3D8HA 3F6PA 1XWFA 2BHNA 3HZRA 2FN3A 1LC0A 3AM1A 1JQJC 4ZANA 2Z5LA 4Q18A 2JI4A 2PDAA 5DM0A 3VGJA 1PWEA 5IWAB 1WABA 3LHSA 1X87A 2D2EA 1RHKA 5DEOA 2JFBA 2GRJA 3FE2A 1LC3A 1V9SA 3MJCA 1S7CA 3ZHRA 1YJQA 2DJ5A 3AF1A 3BBLA 1WMSA 1UPFA 1MKYA 4R3UC 3QIAA 3SHOA 3WLTA 4MA5A 2F62A 4DNOA 1JHQA 2BKUA 5CXQA 1Q92A 1J20A 1GN8A 4UHHA 5C8YB 5CFQA 1WZUA 2ZSIA 1SCNE 1UJ6A 5KSWB 4EA8A 3OZIA 4H4CA 4L5YA 3DBRA 3PNBA 3CUYA 1PNVA 4P7KA 3N0VA 1WQ3A 4ACAA 4TZTA 1Y1TA 3AHGA 3G59A 4UBLA 1BWRA 4F3KA 3GFOA 1FP4A 1VIAA 5B4UA 4DV4B 1KF0A 4NEQA 1M1NB 1NKTA 2OHVA 5B3JC 4EKNB 1PS0A 2OV8A 5JT1A 3LIIA 4GFDA 5CITA 3FG9A 4IGKA 4IEFB 2O0MA 1ZEJA 4BMYA 3A6GA 2FPIA 4KMSA 5HYVA 1KI9A 5D3KA 4F3YA 3FTPA 4PW0A 1IZ9A 5D7BA 1KRXA 5HCIA 2JJ1A 3HKCA 3C3PA 4DLYA 5BT9A 4XYLA 4I1OA 3BKWA 1Q1EA 4NOJA 1DEHA 4PIMA 2OGZA 3TOVA 3H1GA 3EC2A 4D6PA 1JI3A 1SXGA 1IMJA 1QFMA 4YJ3B 4E7OA 1SKQA 5IU6A 1D2CA 3MT0A 4ER6A 1WO8A 3CBGA 1KVSA 1WB9A 1R8XA 2P2SA 3GRAA 3AF6A 4R7ZA 5K8IA 1X9IA 3BN3A 4QDTA 1A5TA 3LPAA 2NTVA 4C0AC 3E7PA 5CXUA 3QVXA 1SG6A 1N6HA 3T06B 3TIFA 821PA 2A4KA 3PBKA 4MYTA 1JG3A 5B3AA 3U3ZA 4TZKA 4OHFA 2H2HA 2DFVA 2WYUA 1FYEA 3RIHA 2FFJA 1J4AA 3F9RA 4QOEA 3MINB 5AQEA 3CVXA 1RI4A 1OH7A 4GQBA 3QWFA 1W7AA 4YHHB 3EUEA 1DAIA 3AEUB 4RPHA 5DYTA 2HSDA 1MABA 2PQ2A 3E23A 3BXOA 4KN5A 3F7NA 2PPLA 5K5EA 1JKIA 1KDYA 1QQ6A 2OECA 1NVAA 4H3SA 3SEFA 2OK8A 3BEOA 1YZLA 1TUGA 2BE7A 2E4YA 5K0CA 3KSAC 2XBLA 5IDQA 2VPPA 3SBDA 3P20A 4G36A 4M9ZA 3UMMA 3KTDA 3AKCA 1ECLA 4AY2A 2WM9B 1FTWA 2DE0X 5DMHA 1VJ5A 4DCOA 1CP3A 4UOEA 1HZZA 2OXTA 3E22B 3IHLA 1RWBA 2VR1A 3QKSA 3ZE2B 1GG2A 1W5FA 1TNDA 4BAGA 3JARA 2B8JA 5TQ0B 5JUWA 3FPBA 5CAEB 3BFXA 2UXDB 3UTDA 2HJRA 4L4RA 3ZGYA 1VGRA 4HEJA 1EYZA 1BEZA 2XUFA 2O50A 3KR0A 1ZMXA 3GP8A 3F6EX 3R7SA 1Y8QB 1OZAA 2OGTA 4C4XA 2DZDA 3FDZA 4ESOA 6GPBA 2G04A 1T0UA 3KVNA 4FZJA 4D25A 4DIKA 4C4OA 1IY9A 4GEKA 2V7GA 1FDVA 2Z0MA 4TWZA 4EF4A 3S2GA 5BSKA 5I9TA 5EIBD 2G9NA 2J0SA 4OOFA 2YJTD 3BK1A 4HBZA 5E8JA 4TV9F 1ZJ4A 5IVDA 1KHTA 1WZIA 3AB3A 3QVLA 4J0EA 4R1MA 3MHTA 3HK2A 4KRXA 1QO0D 1MJNA 2ZT5A 5BSEA 3G0HA 3DT6A 4ZD6A 3GLVA 4BWGA 2JVIA 3NDIA 4N8EA 3OCVA 4NEGA 3ZE8A 4MPJA 4AMZA 2HR1A 2VAWA 2QQEA 2R7LA 2CLEB 4PIPA 5HILA 1BXRA 3QHAA 3WLNA 4GECA 4OHVA 3CVJA 1WMFA 3X1XA 1CUSA 3HBFA 1KZ7B 3KQLA 4BZXA 1Y9DA 1JHXA 1RWWA 3OTQA 4EGAA 2NO7A 1MX5A 1MLDA 1VJCA 1BH6A 2HK6A 1A82A 4IUBS 2PZBA 3HO6A 1OHHA 1DAPA 1QPBA 1XG5A 3HU1A 2UZ1B 2HOQA 3OOEA 4FJ0A 5HK9A 1IDN1 1N2CE 3G5MA 3PKZA 4FE3A 4CIXA 1ZP6A 2A67A 2PLAA 2UVQA 4HF7A 3A3PA 1LLQA 1OF1A 3P9SA 4WFKA 3CKMA 4MKIA 2BJVA 3ZR4B 1F51E 1OXKB 1SQ6A 1WXFA 2FPGB 2QRNA 3CRNA 3H18A 4OYRA 3QMVA 5FOUA 1LNZA 1M2FA 3EIQA 2JL1A 3IH5A 2OFWA 2JLVA 2VBFA 2BDEA 1O3YA 4B74A 4BJ6A 1YNOA 5JS7A 6PFKA 4PSVA 4PAQA 1UK7A 4U7TB 4MP6A 3M4NA 1J1ZA 3LPLA 1A8UA 3T41A 5LVAA 2WWYA 1S7GA 1MGOA 4DDTA 2AG1A 2WBLC 4I1IA 4MP8A 3MAJA 1YHNA 2O2CA 3A6FA 1QCCA 3MUFA 1SK9A 1GNVA 3EGXA 3MYRA 4MULA 2GPAA 1MOZA 2WMYA 4ZTZB 4R8SA 1OSNA 2ATEA 4RMGA 4DW8A 1DC4A 1RM0A 2FN8A 2PH7A 4AYXA 4DNXA 4MRVA 3HI4A 1FW8A 2B2NA 3NRBA 4YRQA 3ZCRA 4DRZA 1QYVA 1QRSA 4EFNA 5ECDA 1QNLA 4FHEA 1AMNA 3QXGA 1CB0A 3SF0A 4CT4B 2XXBA 3KB8A 2BGWA 1QTQA 5KPDA 4TRJA 1MO5A 1RYYA 2E5WA 3PGA1 4FFOA 1N5KA 3T7RA 4YV7A 2OILA 2WAYA 4YCLA 3W3AH 4QBIA 1KZYC 3QG5A 2NYUA 2EGGA 4F6LA 2TSYB 3O2SB 1QGYA 4INJA 3V1NA 4DBVO 1U2SA 5B30A 2E4ZA 5EE0A 1R6UA 5BSVA 5C35A 3DDOA 3FKSA 2X0RA 3TQIA 4YV0A 1E0AA 2HDOA 1O8BA 1K86A 3CCFA 3RSQA 4ECAA 3EODA 1E1MA 2XOXA 4HT3B 2V7TA 3CC8A 5CFMA 4CTKA 5T5QA 5T7BA 1XJ5A 1JSZA 5ALQA 1J2EA 2NTNA 3WOHA 4P54A 2YL2A 2R6ZA 3KQUA 2J3KA 3TRJA 2ZSKA 2F59A 1YULA 5DNDA 3AHCA 1XKLA 3WIEA 5LYJF 2OFOA 4ZC8A 1RQGA 1SHTX 1TLFA 3FJOA 3RT7A 4DLRA 4D9CA 3TKAA 3DO6A 3HDGA 2FX2A 4U7WA 5ETJA 2ABWA 3TNJA 3RQSA 4IRMA 3PUYA 2WJHA 2VF5X 3AUJB 1Q0ZA 4FWBA 3SYTA 3I2FA 1G3QA 1SBCA 2ZQYA 2ZM6B 4HB3A 2YV2A 4LTNA 2VQ3A 3K05A 4NNOA 4Y9SA 4OV6B 2NVUB 5TT1A 4BNHA 5HZHA 2JIMA 2HWKA 4I9GA 2FV8A 3W5BA 2DBRA 4JGGA 5CJ2A 16PKA 4EMSA 2QYTA 2I4MA 4RIFA 5DP1A 1T4GA 2QRHA 4BPBA 2C9ZA 3FTNA 2YFHA 3D2BA 4N5LA 3I9OA 4WCVA 4BNLA 3Q40A 4XVQA 3FZGA 1HA3A 5EUQB 1JJBA 1W52X 3T38A 4N7JA 1P9OA 4K0KB 3PB3A 4QATA 2E87A 2JANA 3WG9A 4B1FA 2PA0A 1NWHA 2ZTUA 2H1LA 3FHJA 2OO5A 2WUFA 3RVBA 4A8HA 4BX3A 2G9VA 1P7VA 1YJXA 4CF4A 5JAHA 3ASZA 1Z68A 2NZYA 3SVZA 1PWHA 2YNMA 1M34E 3A6JA 1YZNA 3ELDA 3G23A 3JQ8B 2PLRA 3G5AA 2NNWB 3B6KA 1XZPA 3OUTA 2O8BB 3U9SA 3FOBA 1WAMA 3VVLA 1NR1A 4AYWA 5DRYA 2BH9A 3TTXA 3KETA 3EYWA 1GEEA 3QKWA 1QNFA 2D1QA 1CUFA 4E0BA 3F7TA 1OX6A 2BFAA 2P6NA 3WDSA 3PS9A 4PNZA 2LIVA 3RVSA 3ZUGA 1MXFA 3HJNA 3JRNA 3IAAA 3GZTB 1MJHA 5FRDA 2IIQA 2K4MA 4RDXA 1OI7A 1MQ9A 5CT8A 1DS6A 4L6AA 4OM8A 5MGBA 5M34A 4KH0A 2NTJA 4Q9LA 1GGEA 3COSA 1CWUA 2XWQA 2QTCA 4KO2S 4YRBA 1GA6A 5BQ3A 1RAAA 1PDWA 2YY7A 1X19A 3I5UA 1K92A 4MOWA 1KI8A 4MVJG 4RK4A 2C88A 3IIJA 1KJZA 4MVJD 1PL0A 4PSKA 5J1SB 4KGVA 2QD3A 1RVV1 3KYCB 3B3GA 1Z39A 2FK7A 4W6QA 1G2IA 2GYYA 4EOGA 3PXXA 1ADBA 4FS3A 1FE8A 2Q8PA 2BGUA 4FFBB 1HZZC 4LRSB 3U62A 4BB9A 1HTWA 2YWHA 4MW1A 3IR6A 3RIEA 3PF8A 2V8OA 2A5DA 3H5AA 4KAXA 4BMCA 4UMFA 3UENA 3JYHA 4MA0A 2P9JA 4EL0A 5IAKA 3TXYA 4RJ2A 1G42A 1E1QA 4PO3X 5FT9A 4I1VA 3ROQA 3RW9A 4BUCA 4DRYA 4NYJQ 3ORHA 2X0JA 4KOEC 1E7MA 4IRXA 1U90A 2Q4TA 3TNLA 4UPDA 1ZRHA 3F74A 3C74A 4NYJR 5HFNA 4QT0A 1FTYA 1G20A 2VAVA 1G6Q1 3A05A 3H86A 4HQOA 3EB9A 3L6DA 4MQMA 4L5AA 4F3NA 2C5AA 4OY3A 3K72B 3G7UA 1E6MA 3D2LA 4FEEA 3X1MA 3FM9A 3RFFA 1RW4A 3WICA 5MN5A 3RC9A 1UOPA 3WLRA 4V3BA 3ZKWB 1O96A 1DE0A 4WZAA 1H1LB 5DNAA 4Z2YA 1ZIXA 2P0YA 1FDUA 3B6ZA 1OFGA 3GN1A 2A84A 4QDUA 3FIUA 2XTMA 3HLYA 3NGMA 4Y2RA 4RETA 1GRQA 2EGHA 3F96A 2PUBA 1M8JA 3NT2A 4RKEA 2V7QD 3ZTTA 2Q1YA 3WJAA 3HLTA 5F9MA 3LHDA 3DMNA 4QOGA 2LNDA 1VLLA 5L8VA 4N0MA 2XCIA 2X9QA 3LYUA 3TDMA 1UKBA 1E2NA 2HDWA 1R8SA 3D7LA 2PFKA 1BQ3A 1XAJA 1ULTA 2WEKA 3R6GA 3DMTA 3R0JA 4LISA 4QVGA 4KFCA 2Q41A 5C4GB 2E82A 4I8IA 4BV8A 2QRLA 3JQDA 4EGSA 1Z74A 1I5RA 1UKZA 1W1UA 5DX8A 4Z8YA 2WU1A 1Z5VA 3OEHA 4H2DA 5LMZA 3FFBA 2VSOA 4II2A 1U1GA 3CONA 2AMLA 2C00A 4YCBA 2XAAA 4BFSA 3H1PA 3OFJA 5DK6A 5AVSA 5KWVA 2OL4A 3CLSD 4JJ6A 4AJNA 1IC6A 3LW8A 1P2TA 3PWZA 3WLOA 1KAEA 4MNTA 2ZSDA 2DF8A 2PS9A 3E6AA 1WPRA 2OR3A 4V39A 3L05A 1KWGA 1KIMA 1GIAA 1SH7A 2FR8A 4LOKA 1HURA 1ZOLA 1W8IA 3PUJA 3CLUC 4KV9A 1JB1A 2BCJQ 4WH0A 5JV5A 2XB2A 4QLBA 2EW8A 3BRSA 1ZCBA 2Q5EA 1VZ2A 3FFXA 1GG9A 5LZ2A 1SXIA 1JQ5A 1E3LA 2V3CC 1T3SA 3BYZA 4TMYA 1X42A 3WGOA 4MGKR 2IYPA 2ODAA 2FLKA 3ESYA 1SKUA 3B5JA 4INAA 4IHKA 2WQ6A 2ONYA 4GGMX 4KKXB 1EFVB 1VBNA 1ZUNB 3HBJA 4BWFB 3ZE6A 2IGTA 1QH1B 1NULA 4FNGA 1QYXA 1UZNA 1YU9A 4E2YA 3WIDA 5ILQA 4E22A 1W88A 4QHTA 1OI2A 2CJYA 3COYA 1L7VC 2HU7A 1WCYA 3V32A 3BMNB 3VM6A 2JFPA 1FDIA 1VMAA 2GPJA 2Z4RA 4C2TA 3RRNA 4B8YA 2C4MA 3JATB 3KEOA 4O2BF 4PZAA 2F3SA 5DBOA 3OQIA 1NUPA 3TFWA 2C2HA 3VZRA 4QJIA 2XNCA 3EY9A 4WXEA 5C53B 3Q8KA 4R54A 1P0CA 3FBWA 1N25A 4BNYA 5E9JA 4RVUA 4ND8A 5L3QA 2OHFA 4R3NA 2QRGA 3BEDA 4HFJA 2Q0XA 5AJXA 4R9SA 4QJ3A 1LWNA 1DEXA 5ALFA 4AL4A 1O2DA 1GZ3A 3COVA 1Q2XA 4LHWA 2L82A 3LH5A 4BNKA 1YS2X 2A88A 4Y1RB 5K0GA 4N3CA 2VSXA 3EWAA 4AU1A 3RE1A 3HNOA 2E6KA 3M2PA 4PPNA 5FYQA 4BNIA 2C7BA 4PAGA 4LJ6A 3V2UA 3O90A 2VJBA 1Z4JA 4MINA 4N9WA 1HG1A 4DB4A 4KR3A 1HEUA 3O4IA 1UFOA 4KW7A 4MQEA 5G0UA 3BOSA 3CZMA 1W19A 2AFHE 1KSJA 2V1UA 2JGDB 2DFKB 4LF6B 4E2FA 5LKAA 1HLPA 1HXHA 1K7EB 1MB4A 3OF3A 4Q9KA 3THYB 5JCXA 2CLKB 1LD3A 2CLLB 2I6UA 3QV2A 4AP6A 1USVA 4RVSA 1OD6A 4KIFA 3V4FA 5A04A 1MO2A 2JI7A 2KPOA 1P74A 2PANA 4QNRA 4DWWA 1LSOA 1TD9A 2AHRA 2OO5C 2PS1A 3BE8A 4JP3A 4NU8X 1AX9A 3L04A 4P5EA 5FCDA 1SCBA 2FN9A 3KUXA 4FE4A 1NJ8A 2F9MA 1QTIA 2OCAA 1A8PA 3NC4A 2VTBB 3ADBA 2HDNB 1MXHA 4HQFA 3EIEA 2DRIA 3S8YA 1Y6ZA 4C03A 2ZUDA 5EJ5A 3LA8A 4JDPA 1AN0A 2NAPA 2ZLBA 1GEGA 2Z3ZA 2ZRHA 1XMVA 4JUIA 1YOBA 3ABRB 4XIFA 3R3UA 4OL9A 1DKUA 1ZK3A 2FVYA 4Q9JA 3LUFA 3O26A 1KFEB 1YQDA 2FQYA 3P0HA 2B6HA 4QJBA 1EHCA 3ZK7A 1V8FA 4FEGA 1HQYE 1EUDB 1E0KA 3AILA 3BD9A 2GN9A 1OLXB 4L0MA 4CM8A 3AF4A 4AN0A 1CJCA 4YRGA 2JARA 4O1HA 1XDSA 2X13A 4PRYA 3BF8A 5IG2A 3T1TA 5JJIA 1GPAA 3JQEA 5MFPA 4UUAA 4X97A 1YZVA 3CH6A 3T7TA 1DKRA 2WAAA 1LI5A 2C98A 3UPUA 1TLTA 3HVKA 3IT0A 3QUTA 3QVUA 4WKCA 5KHAA 3ZDCA 2OHIA 1IEQA 2X1HA 4LGYA 1U3GA 2WPNA 1N33B 3N7TA 1SUAA 3KTOA 2I6TA 2X8AA 1CUZA 1KSFX 3P0IA 2J0VA 2XOKD 1GR0A 4DJJA 2VCEA 1G9TA 1FDTA 4ZODA 5JFGA 1J2UA 4LJ4A 1YAHA 2OYRA 3K1AA 2C5GA 2GBGA 3OPYI 3V7WA 1DQZA 4E5PA 4EYGA 4F5DA 4ZHQA 1UJ2A 4OI0A 5DTRA 3FMGA 5E3IA 5C8ZA 3GZJA 3M34A 2E37A 3PYXA 3MFYA 4G1VA 2R7MA 5KZMB 3ZJTA 2B3DA 1OW3B 4MQBA 2FZEA 9LDBA 1RTTA 1WJGA 5DXJA 2GN6A 3MJTA 1KY2A 3LRXA 2PFSA 4M54A 4RHUA 1MPXA 3I42A 5LA6F 2AJ8A 4HADA 1MC4A 4R2KA 1BA2A 1QP4A 2VZ8A 2Q4OA 2OPHA 5IYZF 3FW1A 4B3XA 1ZPDA 1P75A 3ANYB 2NO0A 2WP0A 1VFNA 2HO5A 3P19A 5EP1A 4C7KA 4CHTA 2VQFB 2QVXX 2OBMA 3CLVA 1U2ZA 1OTYA 1X1EA 3VU0A 5JD6A 1XYYA 3WMFA 5E9AA 4O33A 3RUEA 1OWOA 3K0CA 1G5QA 5FBHA 5CNKA 1XCBA 4X64B 1NNSA 1AKWA 5CG2A 4Q3OA 1HT3A 1KARA 2C99A 1RI3A 1R4MA 2D4AA 2JS7A 3PUVA 4IXTA 1R64A 4YWJA 5KINB 4PLZA 2NZ8A 4W5RA 3M5CA 4FKMA 1U8FO 2XDWA 4XUEA 1LU9A 1IN6A 2H2WA 2X8JB 3RUIA 3M6MD 4HUQB 1KO8A 1TIKA 1C9DB 2G25A 1HLFA 2NP7A 3KPUA 5HEKA 4RU1A 1YC2A 3M9XA 5IKMA 3K7EA 1IHDA 2X9GA 2FGKA 4NNPA 4TKUA 2QN7A 4MUAA 2E4UA 2RAVA 4EB0A 1JIUA 5FHRA 3U39A 4WFJA 4HOYA 2VP4A 4G1CA 3RRYA 3S3TA 3DGFC 1IZZA 1JH9A 3SSOA 4QQRA 3HDTA 1E9EA 1RQXA 1G8PA 1RKXA 1UJ4A 1IJFA 1SC3A 2XUJA 2YIJA 4IJ6A 4WI1A 5SICE 4EB6A 1PFVA 4OSPA 1AGPA 1CQPA 2HYIC 1T1SA 2IYEA 3SWWA 3MIZA 5FFMA 4P7GA 3AIIA 1BX1A 1Z28A 2IL1A 3NDJA 3PICA 4H3KB 3VPGA 5JZSA 1KWKA 2WT8A 4F7WA 4JX8A 1SC4A 3WL5A 2AMVA 2XV1A 3ZWOA 5CDHA 4FPXA 3OMLA 3EBOA 4HYYA 2O8CA 3EIHA 5EMNA 4MWCA 3UJAA 4D0LB 2QLLA 4BRWA 1ESEA 4CCWA 1R50A 2FPMA 3JY6A 1TRHA 2ZIWB 4TV8B 2PS0A 4M4SA 1DHTA 3LT0A 2VPTA 3OMWA 3FRHA 3FWHA 4RTPA 3COZA 1R15A 4I50A 4CNBA 3ET4A 2ZUTA 3FGNA 2RCYA 1R0XA 1SXHA 2AR9A 5HW0A 1ZRMA 1I1QB 2X5KO 3NTOA 5EESA 3NIFB 1HDIA 2VPIA 3W1VA 3HZOA 1E7QA 1XXHE 3USES 3AY6A 1JJ7A 2FZ4A 2CE2X 1FQJA 3HKDB 4LOHA 1NY6A 3VUEA 3W8NA 2VYVA 4QPNA 4E70A 5HBGA 4PINA 4Y0AA 5KOYA 2FQXA 4Q24A 5U4XA 3VC2A 1ZA1A 1HDCA 2IJGX 2IPAB 3I34X 4EHKA 4OP2A 3H2HA 3FUWA 3OE5A 4NF2A 3UPTA 2PX8A 4ZTUB 3VR3D 1OI4A 1U0TA 1G8SA 2QT9A 3AESB 1UFQA 3NGXA 4IIYA 4AY6A 2JLZA 4FHZA 1T0IA 1RI2A 3L6CA 4YXWA 3SX4A 1RLJA 3K2QA 5TQ2A 3NI2A 3OZUA 2A5LA 1RZ3A 3C15C 4JVSB 4YR9A 3IBYA 4WBNF 4U2DA 3RIGA 4KREA 3JQAA 4UZFA 1YR2A 1DC7A 3KXIA 4OSEA 5IT4A 3T12A 2WF6A 4PGFA 1T6NA 3LUKA 1RXUA 3TQQA 4N48A 1F8YA 2C3YA 4GP7A 5TEWA 3NWOA 3BX1A 4DRXB 1I6MA 1Y8CA 2AD1A 5AI5A 3ZDBA 5G02A 1V1JA 3E3LA 3A9SA 3PUKA 4MEJA 3RNOA 1OBFO 1UJ5A 3Q41A 5KU7A 2FF7A 5GZ3A 2ASEA 2D59A 2ON6A 4YIKA 4B3JA 2SKEA 4MVJA 3W7BA 2PGJA 4UHEA 3ZU3A 1ZGJA 2WY2D 4I3FA 3P2YA 4IXNA 5LKRA 2XA1A 3THWB 1WETA 1Y3BE 4C4RA 4H6XA 1DQPA 3INRA 5BQPA 3O4FA 1V3UA 1C8LA 1X39A 2X2EA 1CDEA 3NT4A 1BA3A 3GY0A 4TLDA 1A2OA 2OLKA 1B8OA 3S2SA 1TDJA 4KUHA 4DCSA 2AL7A 1QLHA 1RPNA 3CZCA 3OPMA 4GU5A 3W1WA 4UTOA 2O8DA 4ZEVA 5JAQA 1V1MA 3OP1A 3PF9A 2PBLA 4PLVA 5CYFA 3UOWA 3RFVA 4CQLB 1TK3A 1P6XA 3OZEA 4PSCA 3NEAA 2I1WA 3AU9A 3FMIA 4C87A 4PZZA 1G38A 2QS9A 3Q0EA 3CN9A 2ZRPA 1BW9A 1IIRA 2IOFA 3B9PA 1O4VA 3LE8A 3VQTA 1RJWA 4KFSA 4YJDA 1Z73A 3FDIA 5EIBC 2PKWA 3SVTA 2DT5A 1XZEA 2WJPA 4XPIA 3M6FA 4EHHA 1D4ZA 1HY3A 5I4CA 1ZITA 3DLIA 3H5IA 4WNAB 1Z3CA 4NJEA 3A70A 4AJHA 1ZXBA 1BYUA 4GI2A 5CXSA 4TV9B 2PUWA 2H59A 1YKFA 5K8TA 3NCTA 2JBAB 1W5SA 1V8DA 1XNJA 2D7JA 2P5YA 2HRRA 3IUYA 3GRRA 2RCNA 3PZBA 4FMCF 4LN1A 5D01A 5EQDA 5F33A 3GQVA 4IOKA 4LRYA 3S2EA 5LNK6 1B1AA 1XELA 2P9GA 3O3MB 5FOWA 4ME6A 3W2IA 4HSEA 1TAGA 2GPWA 3SSMA 3WBBA 4E31A 2J0UB 5AVYA 1VMKA 1CVRA 1L7MA 4OJTA 1Z4LA 4XX1A 3R2JA 1MC8A 4MMXB 1PUJA 1RKQA 1SD1A 3GF4A 3L5OA 5H70A 3T7AA 4IZIA 1UT8A 4D92A 1E1DA 1SC1A 1G98A 4G4SP 2C04A 2YZ7A 3F1KA 1JSRA 2IY7A 2QPLA 1ZCJA 4ZAZA 4ILEA 3X1WA 3ZXIA 4F04A 3LKBA 5SY4A 1ZH8A 2AFRA 1GL6A 1GGKA 2PMCA 4N8DA 1RIFA 3WI7A 1EFRA 1SNYA 2XWBF 1BGWA 1JG7A 1SCUA 3H9BA 4G26A 2XCSB 3RBVA 3SBXA 4CV3A 2FNAA 3Q6IA 1TZJA 4FC6A 5CG1A 3M9WA 4YAOA 3VZDA 1I0ZA 5F21A 4QT4A 3I2HA 1NY5A 4G8CA 4NCKA 2G76A 5ALXA 7MDHA 1LS1A 5KQLA 1KVTA 1NFRA 1EUCA 2DG2A 4CG2A 3TOSA 5L4SA 3ZC3A 1ZGHA 2GVZC 2LW7A 2YFYA 3KOWA 4PBRA 5IAGA 4QBGB 1BFKA 2BN4A 2X22A 3KUKA 1I2AA 3B85A 5BR7A 3MTBA 3RARA 3RK4A 4NFHA 3S2FA 3ZS8A 3WNVA 3I9V6 1A27A 2LGJA 3Q8WA 4N3BA 1E5LA 4ROSA 3ENVA 4GM0A 4ZVNA 3D3WB 4A27A 5BMVA 4I14A 4JQZA 2CLDX 2JLWA 4ZQEA 4XYMA 3RIYA 1NN5A 1ACMA 2ANCA 4DV0B 4QDKA 3REQB 5LQUA 2YQ5A 4G25A 2OO7A 1OV6A 2BJWA 3QLUA 3V7UA 1PR9A 3PIDA 4FNMA 1SHJA 1XJQA 2HSJA 3GCZA 5BYJA 4C4PA 4U2GA 3R0QA 1JHRA 1AGRA 1Z4NA 3B70A 2Q1UA 4BZZA 1XNHA 4OMFG 3AG6A 4V1CA 3CPHA 1J8DA 3F9IA 4EA9A 3NBMA 3S1AB 1CUVA 1ODJA 2ZTVA 4EBBA 4KHPB 4C7XA 3RB8A 3S70A 1UM9A 1JFTA 5J2TF 2ZJOA 2YV3A 3M4ZA 1A5BB 1DMRA 5EKUA 2OBFA 3DHVA 4RV4A 2DMRA 1N5DA 1GAJA 3NT5A 2G28A 2JLYA 1JH8A 1UCFA 4GVLA 1IOWA 1OFIA 1M33A 1KVUA 3O3OB 3CX7A 4UEJA 4X7BA 5JANA 2RC6A 2VOJA 5IDWA 1X8JA 3Q8LA 3OTOB 2FP4B 3AH8A 3UAOA 1P8AA 1WZNA 2EOAA 2W90A 3M89A 3R0IA 5AP9A 1RBMA 1UF9A 2BELA 3COPA 4PFQA 3IOMA 4ZAGA 5JAUA 2P6OA 1SZPA 3EW7A 4HDRB 4Q3AA 1L1FA 5CIWA 1R0RE 1TQ8A 2WKQA 2WSSD 3RFCA 4M1EA 1H3NA 5ITZA 1B6GA 4KKVA 1N2CB 2QRMA 4OQYA 5H4HA 3RU7A 1M2OA 1GSOA 2ACWA 4AS3A 1E2BA 2J7KA 5E2BA 2YYYA 3GL9A 3UHJA 4PC1A 1R5OA 2W6OA 1NQUA 2ONKA 3BTOA 1BIFA 1LRLA 3C3CA 3L1HA 1S3FA 4AZ0B 3B1FA 1FFAA 4G1EB 2X8WA 1H8HA 1C3JA 2XCOA 3TH5A 3QI7A 1HFEL 3TQTA 1YIOA 1FU4A 2BGKA 3LY5A 2GH1A 2VK1A 4ZYVA 1H9CA 3I9V1 3M6XA 3SHVA 1VJ1A 1G8FA 1YS4A 2H7CA 2PSHA 3I2JA 1KJIA 4Y0VA 5CNIA 1GDTA 5BN1A 3I4LA 5JXWA 3GJ0A 1SVUA 4UMEA 3U0BA 3TGLA 2ZSHA 1YI1A 1OH8A 2CFIA 1NR7A 3BMOB 4J03A 2QGFA 4DQKA 3UM9A 4RLHA 1KJ9A 4E94A 4HN9A 1CK4A 3NBUA 2WE7A 4Q3KA 5K0BA 5AJZA 5I3ZA 1W48A 1JS1X 1NYTA 1S8OA