1KABA

Stress and strain in staphylococcal nuclease
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYGPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stress and strain in staphylococcal nuclease.
pubmed rcsb
molecule keywords STAPHYLOCOCCAL NUCLEASE
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
total genus 41
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1992-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1kabA00
5C4ZA 5CV4A 4QB4A 3ITPA 2F0IA 4IALA 3PMFA 1EY4A 1F2MA 2F0FA 1SYDA 2O4XA 5J1ZA 4E6IA 3U9OA 2SOBA 2F0GA 1SNOA 5EKLA 4K5WA 5I6WA 5IGDA 2EYOA 1TT2A 3DMUA 2PZTA 3H6MA 3LX0A 1JOQA 1U9RA 3HEJA 3RUZA 2EY1A 2PZUA 2PW5A 2OF1A 3NUCA 3D4WA 2F0NA 4K5XA 5KGUA 1A3TA 2EY2A 2PW7A 3TP8A 4OL7A 2LKVA 3MZ5A 4DGZA 1STNA 3MEHA 3NXWA 4ID6A 4NMZA 2EYMA 5M9OA 2F0HA 3D6CA 5HGTA 4EQNA 2F3VA 1SNCA 1STBA 1JOKA 1SNPA 2EYHA 4I65A 4B9WA 5ISRA 1TR5A 3SR1A 1ENCA 2NUCA 4KD4A 5KEEA 2F3WA 4LAAA 3S9WA 5CV6A 4K8JA 4N9PA 4F7XA 1KABA 1F2YA 4K6DA 1F2ZA 1EY9A 1STGA 2F0MA 3NP8A 3QOJA 4G57A 2KHSA 2EYJA 4WRDA 5DAUA 2F0JA 4N9TA 4DF7A 2EXZA 5EKKA 2OXPA 4PNYA 3NQTA 3P75A 4IUNA 5K5PA 1SYGA 1EY0A 1SNDA 4R8NA 1STYA 4F8MA 1IHZA 2SNMA 1II3A 1SYBA 2SNSA 1EY5A 4IZ8A 5IODA 5CV7A 5F2DA 5CR3A 5IGGA 3DHQA 3OMGA 4ZQ3A 4KV6A 1RKNA 2F0VA 5I9OA 2EY6A 4K8IA 4PMCA 3BDCA 1STAA 2M00A 4YIJA 3TP6A 5IGEA 4WORA 2RDFA 4HMJA 4K14A 2KQ3A 3V2TA 5IGBA 4KY5A 5J22A 1JOOA 1TQOA 1EY7A 4KJOA 5C5LA 1SYFA 3SK6A 5KYIA 2EY5A 3EJIA 4NKLA 5IOCA 4J1MA 3R3OA 1AEXA 3MVVA 4KTAA 4ZUIA 5NUCA 4NP5A 3OSOA 1EQVA 4RKLA 2F0KA 3EVQA 4HMIA 4TRDA 1EYAA 1KDAA 5CV8A 4DFAA 5IGCA 4EVOA 2PZWA 4RKBA 5CV9A 5C4HA 4ODGA 2RKSA 3P1HA 1A3VA 2F0SA 2F0LA 2F0QA 3SXHA 5I9PA 2F0UA 2RBMA 1EZ8A 4HTHA 3VA5A 3NHHA 1A3UA 2EYLA 3QB3A 3QOLA 2F0EA 1NSNS 3D4DA 3C1EA 3D8GA 1A2UA 2PQEA 2F0DA 2F0TA 1EY6A 1KDCA 2HQEA 4KD3A 2F0OA 5E3FA 5E1FA 5KYLA 5C6AA 3E5SA 4K5VA 4QMGA 3TMEA 4B9XA 4KY6A 5I6YA 2EYPA 3T16A 5HURA 1SNQA 1SNMA 5IIFA 2OEOA 2QDBA 5DEHA 2EYFA 3SHLA 1EYCA 4J6HA 3SK5A 3SK8A 1ENAA 4ME5A 2PYKA 5JAVA 3OWFA 3NK9A 1SYEA 4KY7A 3TP7A 3T13A 1SYCA 5JOBA 4KJNA 4S3SA 5CV5A 4H7BA 5C3WA 5EGTA 4EQOA 1JORA 2ENBA 3HZXA 3SK4A 1STHA 1A2TA 4PMBA 5KRUA 1KAAA 2F0WA 3MHBA 4K2KA 5C5MA 5CGKA 1EY8A 2WACA 3BDLA 3MXPA 3TP5A 1NUCA 5KIXA 4NDXA 2F0PA 5C3XA 4K2LA 3OMCA 4MIUA 4DU9A 1KDBA 3C1FA 4KHVA 4ZUJA 5IGFA 3ERQA 4EQPA 3EROA 1EZ6A 5CC4A 1EYDA 5J39A 4QF4A
chains in the Genus database with same CATH superfamily
1JR0D 2F0IA 1IKLA 4AYBE 5FJ8G 5C4JH 4A3IB 3KUPA 4CKEA 4R1JA 1VQPA 5K36H 3HKZB 3VA7A 3I4MG 2JA8B 3E6ZX 3G6JB 4H13C 3RMHA 1I3QB 2I0QA 3NUCA 3A0JA 3TP8A 2ZTCA 3E9HA 1I94L 3J81E 1MJCA 1BQQT 4OONA 3CCVA 4I65A 3CCQA 4DV3L 1A63A 4IN3A 1TU2B 1ENCA 2CWAA 3CQZB 3KDFA 3QR8A 1JMCA 1K73C 4X6AH 1F2YA 2EYJA 1EEFD 2OXPA 2HCCA 4H0LC 1XTCD 2WAQE 2NVQH 3L9AX 1TWFB 1HR0L 2F0VA 1H9JA 3TQYA 1FGUA 4C56C 2A19A 2DY8A 1Y69U 4XQJA 3GTPB 5J22A 3PIP3 2J7ZA 2O5JC 1U4MA 4RKLA 1EQVA 1J6QA 3VR4A 3RNUA 1EYAA 1KDAA 3Q22A 1PH7A 1IW7D 2BCOA 1TS4A 2ZM6Q 3NTKA 1V1PB 4L5RC 4BY1H 1KQSA 4HJ8A 2UUBQ 2VY3A 1OTCA 1GUSA 5KYLA 4HJAA 1M90C 1UE1A 1EOVA 2BE5D 4HR7B 4DV3Q 1HTLD 2YU9H 2I46A 3GP7A 4APVA 4DR2L 5KNBA 3OTOL 3GQBA 3OWFA 1VDZA 1QOHA 3NK9A 1KRTA 3CHBD 5EPKA 5AJ3Q 3R2IA 1E24A 1KLGD 3CC2A 4EQOA 3HZXA 1A2TA 1TS5A 5KRUA 3RLFA 1HR0Q 3K7AH 3TP5A 2HHHQ 3OW7A 2WFWA 5FJ8H 1BO0A 2EVBA 1VQNA 4KHVA 1IYUA 5CC4A 2JA6B 3S1NB 1SN8A 4DAPA 2XGTA 1HQMC 1LTGD 1N33Q 1EY4A 1HA6A 4BA1I 1F2MA 2JE6I 1YIJA 3I4MH 3AFQA 1XNRQ 4RMFA 3STBD 3Q0AA 5IGDA 4X65L 1FR3A 2WINB 3A8JE 3A5UA 1PTOB 3WWVA 1HXYD 3F2UA 4DV7Q 3U50C 2K75A 4JBWA 1JJCB 1Y8NB 3PUZA 3J81j 3EA6A 4G4KA 3S16B 1STNA 3W1GA 5E4XA 2F0HA 1FJGQ 1SNCA 2H4OA 1I6HB 3PQIA 1VF7A 2F3WA 3GV6A 4IFDG 3GTJH 5A2QL 1F2ZA 3NP8A 1O7YA 2KHSA 4MHEA 3QWNA 3Q23A 1I5FA 2GVBA 1FD7D 2Z6KC 1EY0A 1A62A 1SNDA 1VQBA 1JWUD 4DAYA 4FF1A 3RLNA 1IBMQ 4OIJA 2Y0SB 1PRTF 1TWGB 3CRKC 3I4NG 2Z6KA 1XMOQ 3I73A 5TSSA 1PYWD 1DONA 1XYIA 3MVVA 1LUZA 1W2BA 3EVQA 1VS0A 1B3AA 3E0JA 1PTOD 3VDYA 3IL8A 5IYDH 4PZ7A 2F0UA 2AUKA 1IZ6A 3G4SA 2E5LL 3MFYA 1NSNS 4KD3A 1GHKA 3GDEA 3RZDB 4YY3L 1SLJA 5ELNA 4A3LG 2LXKA 3P7JA 5A2QE 1E0BA 2OEOA 2MJ8A 3LWUA 3ND8A 4IUQA 2FFKB 3E9IA 1K3BC 1BR9A 1U4LA 2RDGA 1PFSA 4P75A 5T1GA 4XT1B 3PO2B 4GN4B 5LMUL 1QUQB 1HNWL 3M9BA 1K0RA 2RQXA 2RVLA 4DV5Q 5IP9G 4K2LA 3HRZC 3HOUB 2JEBI 2DN8A 5IOCA 4QB4A 4F87A 3H3VI 3LWEA 2RDHA 3CU7A 1BF4A 3MXUA 1EWIA 1SNOA 2B2YC 4WFN3 5EKLA 4B3SL 4DR3L 4CDDC 2D2CC 1U9RA 1TWHH 1H9RA 1AZQA 3K5NA 4A3GB 1VQLA 2KHJA 2ZT9C 4OWXB 2B2YA 2E2JB 3VR6A 4ABNA 3NWSA 3CCLA 1D2BA 3HFZB 4NMZA 2K1BA 4IFDH 1CQFA 2K5QA 5DNFA 3S2DB 2KVMA 2RA4A 2NUCA 1G51A 4QJFA 3U58A 3BS1A 3WOFA 5LHY1 1LTID 3D6WA 5DAUA 3S17B 1ILQA 2K7VA 2XNAC 3AYHB 4PNYA 4XT3B 4GZYC 1EQTA 4QCLA 3AU7A 4R8NA 4A3CG 4OX9Q 1IHZA 3URYA 1N34Q 3I4NH 2X6LA 1BKBA 1PA6A 2DGYA 2K5HA 3L0OA 2IHFA 2A5HA 4ZLTF 1SFOB 3IKJA 1YJWA 4WORA 2RDFA 4JI1L 4CDFC 5C0XI 4UP8A 2UUCL 3TN2A 1PLFA 1LT5D 4L8JA 4J1MA 1AW7A 4KTAA 4B3SQ 1EIYB 4DFAA 4DR3Q 2G9HD 1L0YB 2LMCB 3T1HQ 1TS2A 3MC0B 1YNNC 3JAMi 5I9PA 4MZ9A 2D62A 2VB2X 4KKSA 4J8QA 1CHQD 4OXPA 4A3LH 3GTKB 1LM0A 4NXMQ 4C1NI 1A2UA 1I50H 3QG1A 1JC7A 1MJEA 2OCEA 5M3FB 5C6AA 1SMXA 1M1KC 2KJXA 1F2LA 3FPUB 4GKKL 2R93B 1N36Q 1GVPA 4O1NA 4BA2I 4PMWA 1HQRD 3KK7A 2K03A 5JPNC 3J7AF 2ALYB 2KUMA 1EWCA 5C4JB 4R9WA 1ASZA 1PVOA 1SROA 4LUVA 5IP9H 2AQ1B 4RGMA 2A6ED 1NY4A 4K6LA 1X9NA 5JJLA 3A8IE 1WVLA 1PXUA 1MSHA 4AYBG 3I8ZA 1XPRA 1EZ6A 3U4VA 1QILA 3D4RA 3PMFA 4A4IA 4ZYSA 3RZOH 4IJHA 2PNHA 1EQRA 1CZGA 5I6WA 2EYOA 2PMZB 1ZYRD 2L12A 2NZ1D 1JT8A 4C3IG 1PV4A 2NVQB 3NWTA 1JJGA 1N9WA 3HG9A 1KIXA 2B8FA 1X3EA 2TMPA 5HGTA 1N32Q 2HQLA 5C4XG 2DY7A 3SR1A 4G7HC 1CZWA 4N9PA 2B2TC 4A3CH 1STGA 3K0XA 1W6KA 2WAQG 4OO1G 1BCPB 1VQ9A 2KENA 3TSSA 5M5WH 3Q8DA 2AKWB 2B2TA 1T5XD 5CR3A 4RCOA 1JICA 4RHSA 3CCSA 1HUNA 5I9OA 4BY1B 2PCFB 1KD1C 1RD9D 3JAMc 4K14A 4KY5A 1TQOA 4DNTB 2ZJRA 5GADC 2YU9B 2A69C 5EPJA 3KDFB 2AHOB 1KNAA 4DK3C 1TS3A 4DUZQ 2CCZA 3SXHA 4L5SA 2WV6D 4HSVA 3C3LA 1HCZA 3A5ZB 2F0TA 3K7AB 2R7ZH 1S5BD 3S1MH 5IP7G 1MSGA 4XIGS 2EYPA 2N3SA 1NJIC 4JI7L 4A76A 4DAMA 4F88A 2MO0A 2UXBQ 2R61A 2PYKA 3GO5A 3P20A 4YWLA 1X32A 4LF5Q 3I4MB 3K6OA 1HA5A 5BN5A 1SE4A 4OIKA 5D14A 1OXXK 2IHEA 4LUZA 1GD7A 2MQHA 1EU4A 5CGKA 4JI6Q 2IX3A 1YJNA 3BYTB 1WD0A 5JJZA 4LJZC 3KF6A 3EROA 4AQYL 2B39A 3VR5A 4DV4L 4I7ZC 3CCRA 1UEBA 1YNJC 1AE3A 3ONAB 3J7YW 2AUJD 2QW7A 3U9OA 4C3IH 3GTJB 2VQFQ 4DR4L 4DN4M 3PUVA 1IKMA 2VXWA 2AWNA 5JVH3 2DJFC 5C4XH 1TY0A 5FKAC 2HT1A 1A3TA 1DXMA 4AH6A 1RIPA 4Y7NH 1LT3D 3TREA 4X66L 2K01A 3H15A 4OO1H 4KI0A 1MI2A 1UWVA 2VQEL 1EWHA 4JCVE 3OYYA 4JBJA 4N9TA 4R4CA 1D1IA 4P71A 1V9PA 3KF8A 4UHVA 4C3HG 3LNNA 2MFIA 1SYGA 1JB3A 5J3BA 1IBKL 2OQ0A 4OWTB 4DV2Q 4JK1C 2J4XA 2IWHA 2A68C 1RHPA 4B3ML 1F9RA 4DR7L 4DV4Q 2K5DA 2AMCB 2G9DA 3Q24A 1NBWA 4YCUA 5NUCA 2ZTDA 3OIQA 4DR4Q 2E2HH 4RKBA 1PH1A 1XNQL 2F4VL 4ODGA 2F0SA 1L0XB 4L5TA 3DWAA 2L4NA 1QNKA 4JG2A 3VA5A 5EKIA 5IP7H 2EYLA 3QOLA 1KTKA 2MUYA 3JAML 3D8GA 4LF8Q 4JVZA 4CBVA 2BA1A 2HQEA 3I3CA 5I4DA 2F0OA 2F52A 4DAYB 3E5SA 3HKSA 3HOWH 1V43A 2EPBA 2Q2UA 2D9UA 1QZGA 2ZTEA 1X6OA 2VQEQ 3H91A 1G2TA 1TWAH 4LFCL 4CDEC 3HOVG 1HNZL 2K4KA 2L11A 2K32A 4LF6L 2C35B 4WJWA 1SMYC 2ENBA 1G91A 3SK4A 1TWHB 1WTWA 2WB1E 5CBEE 1I4HA 3CAMA 2IY5B 3C1FA 4PZ6A 4JI3L 4DR7Q 5IGFA 1LACA 4QIWB 3X3MA 1PZID 5C4ZA 4EX5A 5ELCA 1ZXTA 4IALA 4C2MH 1BOSA 3GV3A 4YWMA 4GNXB 2NVTH 4ME3A 4WJ4A 1O7IA 1H9MA 1XNQQ 2F4VQ 3JAME 1HNXL 5T1IA 1VQOA 2Z1CA 2I5LX 1QCBD 1TKWB 2CQOA 2EY2A 3BVZA 3I4NB 2XTIA 1UUPA 1SDFA 2EJGC 4DXFA 1NR2A 2F3VA 1W3SA 1PZJD 4JI5Q 1M8AA 4GOPC 1WCMG 3NQIA 3S9WA 4DR5L 4C3HH 2UU9Q 1BXTA 1UAPA 1CA5A 5E4WC 4DF7A 3PSIA 2RF4A 3F2CA 1D7QA 4LF6Q 2IL8A 4GOPA 1L1OC 2K52A 2FINB 2JN4A 4DNIA 1C4QA 1Y14B 1I50B 1U5KA 2EZVA 3K5LA 3CKIB 4IUTA 1NCVA 5IGBA 1L1OA 4LF7Q 3K58A 3CPFA 4JC0A 4IJLA 1CFMA 4CHTB 4NP5A 2F0KA 4TRDA 1PH8A 4JI2L 1DCZA 1YNXA 3P1HA 2J0TD 4NXNL 4HEDA 3HP3A 2NBFA 3S15H 2KCMA 1C8CA 4O0AA 3C46A 1EY6A 2GA4B 3TMEA 1BVSA 4XDXA 5I6YA 1G6PA 1D5XC 1Q82C 5HY6A 3HOVH 1D5MC 2A6HC 1PH4A 1IBLQ 3AFPA 3J7ZC 4DR5Q 1CK1A 4HJ9A 1R9TH 3HOXG 1AZPA 5BR8L 4XQNA 4N8FA 3RZOB 1LTLA 3TP7A 3CD6A 2CH4A 1MHWC 3NELA 1S5DD 3BZKA 2EOTA 4ILWA 1VMCA 4K0KL 3K57A 3WDNA 4TQUS 3KOJA 3SDZA 4HN7A 2F0WA 4FP5D 2ZJPA 1I94Q 5KIXA 1D1KA 5IYDG 2UXDL 3LGJA 4FXDA 3RN2A 2B2WC 4EQPA 3A56A 4CJ1B 3M3YH 1F77A 2RHSB 3OWEB 3NBHA 1JQYD 2RSNA 2B3GA 4A3JG 4JI2Q 2XWJB 4OWWB 2B2WA 1MIUA 2DNCA 2L55A 1X65A 2NN6G 5BN3A 3I7FA 4NXNQ 2PZTA 3LX0A 1GUOA 3RUZA 3OHXC 4LFAL 5M5WB 5G3LD 2I5MX 4OL7A 1GUNA 1TVXA 4Q0FA 1WCMH 1AH9A 4BBSG 4J15A 1STBA 4BBRG 1ONLA 3K80C 4IUUA 1PRTC 3ZJYC 1GUGA 5CMDA 1B50A 2F0MA 4NPSA 1GOZA 5EKKA 3KJOA 4BXXG 1VQIA 3I4LA 3L2PA 1MGSA 3DEOA 3D0FA 4PZ8A 3VYTA 4IZ8A 4U673 5GAGC 5ELDA 3OMGA 3L3OC 2UXDQ 1ICWA 1KC8C 1CQVA 2R7ZB 1ESRA 3S1MB 5FOBB 1KAWA 4L6TB 1ESFA 4KKTA 1YNND 1QWYA 4NKLA 4DR2Q 1A6XA 5EJWA 3OTOQ 3I56A 1Y1WG 1WTHA 2L15A 4FDBA 3E0EA 4EVOA 3J80i 1VQKA 1QVFA 2IJ0A 3OIPA 1FL0A 1ZKOA 2FHTA 2PQAA 5IYBG 3PIO3 5KNCA 3MA2B 4GLVB 4AYBB 4DV6L 2KCCA 1I4RA 4ZRZA 4IPDA 2NWGA 3HOXH 3T16A 4KHZA 3DM3A 1SNQA 4QGUA 1YI2A 4JI4L 3MXGA 2L0CA 1HFGA 5ELEA 5LMNL 3UDXA 3J7A5 2JQOA 1AFPA 1U0LA 4JV5L 4X65Q 4C3IB 1WFQA 4NW2A 4RWSC 1B70B 3Q6SA 4IO9A 4UPAA 1ILPA 3C2PA 1BBUA 4DPGA 1NMFA 1LV9A 3BDLA 4CJ2C 4FF3A 3NPPA 5C4XB 2FMCA 2R7DA 3D3RA 1Q90A 3CMAA 2NVYH 1KDBA 5BN4A 4Y7NB 4P73A 3M4YA 1QJOA 2QEJC 4A3JH 3ITPA 2K04A 2NN6H 2AQ3B 2WAQB 5M5YH 1TIID 1XPUA 3H0GG 4RAUC 4JYAL 2VNUD 3DMUA 5M5XH 3KBGA 1GUTA 3BVMA 3HEJA 4ULLA 3AMUA 2PZUA 4BBSH 4R4QA 2VB3X 4DV6Q 3D4WA 4BBRH 2BOSA 1PHJA 2NVXH 1LLRD 4DR1L 1MD2D 2EXDA 3I91A 2Z9HA 4QQBX 3M4QA 4JI4Q 3X3NA 1S4ZA 5KEEA 4BXXH 2DJGC 5LMNQ 1TWCH 1O7ZA 1E22A 3OOCA 1ML0D 1DGSA 1X3PA 3KLSA 4JV5Q 1HR0W 2F0JA 3DUZA 3P75A 2E2HB 3K59A 3V05A 2E5LQ 1AN8A 1UE7A 4X64L 3DHQA 4HAEA 3UDGA 3EBEA 2A69D 1NR4A 4YY3Q 5EBCA 3F1ZA 1Y1WH 3S14H 1S5CD 3J80c 3F2BA 1RJTA 3HOWB 4UP7A 1PH3A 1UE6A 3BZDB 1LTAD 1X3FA 5IYBH 4DK6C 5KYIA 1TWAB 4POGA 2PO4A 2XWBB 4BY7G 5LMUQ 1EZ8A 1HNWQ 2XSCA 1HFNA 3KF8B 1EU3A 3W1BA 1DM0B 2BH8A 4Q5VA 5E3FA 3FEWX 1Y8OB 4FYDA 1VQMA 3R93A 5JEAJ 2A73B 1IXRA 1B8AA 5HURA 1D8LA 1BDOA 1CKMA 3BJUA 1Z47A 4ME5A 1CI3M 4C2MB 1ET9A 4XYOA 4KMUC 2A1AA 4KY7A 2NVTB 5DM73 2EE1A 1WOCA 2OQKA 4CKCA 2WB1G 3A74A 1JORA 1Z7TA 1YNJD 1PFMA 4L5QA 3ERSX 4MIUA 4QUFA 2MHVA 1J9OA 1RTOA 3H0GH 1OO9B 5FLXc 1E7ZA 3ICEA 1Q12A 2R7ZG 2DNEA 3BZCA 3T4AC 2O4XA 1QZHA 4C3HB 1KL9A 2SOBA 1VF5C 1V1PA 4V0BA 4XQQA 2D5DA 2QF7A 3H6MA 4DUYL 2UUAL 5LL6S 3V96A 2QCPX 1XMQL 5JJIA 4CJ0B 3MEHA 4H02A 2HUGA 1JOKA 2EYHA 4JI1Q 1YHQA 2UUCQ 5C3EG 1X54A 2CW0C 1KABA 5FO8B 1L0WA 1YHBA 4EQ5A 2KECA 3BVGA 3TS0A 4WRDA 1Y1VG 4A3KG 1KRSA 2A68D 1Z6HA 1Q86C 1RDPD 5C0XJ 2SNMA 1II3A 3WOEA 5IODA 5EPLA 1STEA 4P72A 1B1ZA 3S15B 2RSOA 1PTOC 4PMCA 1STAA 3FPPA 5IGEA 4GKKQ 4HMJA 1HHVA 4ZK9B 1EY7A 4HCEA 1E1TA 3HOVB 3BG3A 1R9TB 3TBIB 4BY7H 4B3RL 1NE3A 2L1BA 3K8AA 4FF4A 3KLRA 1VQHA 1QVCA 4JI8L 3VYRA 4DK1A 1XJVA 4CKBA 1S3OA 3NHHA 1A3UA 4N8X1 3J80L 4B3TL 4KLKA 1D5ZC 4GOPB 1XMQQ 2PQEA 1YBYA 2JSOA 1KDCA 1Y8PB 5JJKA 5M3MG 4EGVA 2E8GA 3GTOH 1Q1BA 5IIFA 1CA6A 1SMYD 3CCMA 4POFA 2HIXA 1I4XA 1HZ9A 3M3YB 3ER0A 1W6JA 1ENAA 1RCVD 2L9HA 1VMPA 1SYEA 3IFDA 2K5NA 3I70A 4UY8C 3N6RA 4BWGB 2MPMA 4LFBL 1LTSD 1PTOF 1EY8A 1NUCA 2CVRA 3CCUA 1DJRD 1OXSC 1NTGA 2CH4W 1WCMB 3UE0A 1J5EL 3DWPA 2HDMA 3ULPA 1I4GA 4NB3A 2F0FA 3M4OH 4B3RQ 1LO5D 4E6IA 3HOWG 3I72A 4M8AA 3NEMA 1NNXA 4FNFA 3J80E 3M85A 2KEDA 2HIVA 3VR3A 1RODA 4DV0L 2E74C 2KOLA 1Q8KA 5FLXL 5C3EH 2LKVA 5L37A 5JEAG 5IWAL 1XTDA 1SJHD 2EJMA 3NXWA 3DLLA 4ID6A 1GXDC 4YHHL 3EQLC 4A3MH 1Y1VH 4A3KH 3K5MA 2IPKD 4IQZA 2JJQA 1JE4A 4X62L 3HOYH 1OXUA 5LL6X 1K8MA 4G7ZC 2EXZA 4FVMA 4B08A 3NBHB 1VQEA 1KXLA 2FMMA 2I07B 3H09A 3GTMH 5F2DA 5EQ0A 1JE5A 4KV6A 2C5CA 3UE1A 1J5EQ 2M00A 3TP6A 1WJJA 4QY7A 3HKZE 3HOXB 1OXTA 3TEHB 3TRZA 2E76C 4JI7Q 2EY5A 3W5OA 2XN9C 2HDLA 2XRSD 5C4HA 3TZDA 2F0LA 4MTKA 5FLXE 5M3MH 2A6HD 4HTHA 1VQFA 4KK7A 1PRTB 3H3VC 2IT1A 1UE5A 4A93G 4HIDA 3I55A 4QUCA 1KLUD 3GTQH 1PYSB 4RGTA 4R4TA 2NVYB 4AQYQ 1K83H 2GVAA 1SRUA 2EYFA 4A3JB 4J6HA 5M5YB 4X3TA 2R92G 5C0XG 5C3WA 2R3ZA 5HGQA 2ES2A 1IL8A 4UAIA 4YCVA 1K9MC 2I5HA 1VQ4A 5M5XB 4P74A 3F2DA 2BDNA 4JI0L 1JWSD 2PQAB 4BBSB 4O2DA 4IFDI 3IAYA 2F0PA 1Q1EA 4BBRB 1Q3LA 1HUMA 1B9NA 1CUKA 3S1QH 4X66Q 2NVXB 3CXCA 1G291 3K0YA 4K8JA 5ELBA 1CKNA 3W3AA 4HSPA 1Q8IA 4U68A 2O2LD 1P16A 2Z4IA 1TWCB 4DXGA 2ZJQA 1WI5A 1G8ZD 1TT2A 2PNRC 4LMQD 5JEAH 1JOQA 3RLOA 1PRTD 1IBKQ 2F0NA 4K5XA 3FKIG 1CT1D 1FNVA 1A0IA 2N78A 5JVG3 1P8LA 1C48A 1V1QA 1VQDA 4C3JG 2JK8A 1SE3A 4EQNA 1PZKD 4B3MQ 1S72A 1EOTA 1Y1WB 3S14B 5FO7B 4X3KA 4XYQA 4LAAA 4F7XA 3H3VH 2B63G 1EY9A 3J7AV 1SXTA 2P5ZX 1HJPA 2FXQA 4JI0Q 5C44G 5I2YA 3D31A 2YV5A 4ZQ3A 1RKNA 2EY6A 1H9SA 3O13A 3PIPA 1X55A 2N8NA 1R4QB 4A3EG 2KQ3A 3CF5A 4KJOA 2N49A 5CYUA 1IYVA 3EN2A 4LFCQ 3OSOA 1QVGA 1HNZQ 5CV8A 3ZYYX 3RR5A 4A93H 2UXCL 1A15A 2EJFC 1E2WA 4PQXA 1BCPC 1DOKA 4QL5A 4DKAC 2NTSA 1ASYA 4DA2A 2PPBC 4JI3Q 2CFMA 2X6GA 2R92H 1V1OA 3S1RH 3R2TA 3H0GB 1Z9FA 2ICEC 5C0XH 1YEZA 1EYCA 2CWPA 3PGZA 2JA7G 1UEAB 2Y0SE 4RGNA 1DD2A 1IL2A 4A3DG 3T13A 4H7BA 3MWYW 2MNAA 2NZHA 3SEBA 1HNXQ 3NE5B 1I6VC 3GTLH 2ZM6L 3FP9A 4IUVA 3PCOB 4FXKC 1FNUA 5C5MA 1EQQA 2UUBL 4LW1A 1EUJA 3OMCA 3S2HH 1KHIA 1VQJA 2MGSA 1O78A 2Q2TA 3CC7A 4FXGC 3I4OA 1RF2D 3T53B 3FKIH 1T9HA 5AJ3L 2NTTA 2RHQB 1FGBD 1SJED 1QG7A 4Y52H 1YZ6A 2IX0A 2PW5A 1SE2A 4C3JH 2UXCQ 1BCPF 2XIWA 1AE2A 1G6ZA 3A55A 3KFUA 2HHHL 3PF5A 3AEVA 2B63H 4TVAB 4KD4A 1N33L 2LSSA 2BA0A 2ASBA 1S5FD 2YTYA 3PIOA 1H95A 3QOJA 1PDQA 4G57A 4ALPA 4LUOA 5D65A 2D0PA 1XNRL 5C44H 4BY7B 4XTCS 2KA7A 1HZCA 3PO3G 3RD4A 2K05A 4IUNA 2JA5G 1JWMD 4HIKA 4DV7L 1GM5A 1M4VA 3A54A 3SGIA 4F8MA 2OTLA 4CDCC 2Z8LA 2Q8RE 4A3EH 3JC66 1J8IA 3U4ZA 3FMCA 4K8IA 1VQCA 4YIJA 1C7YA 1FJGL 2ZXPA 4V190 3V2TA 2XRQD 3SK6A 3GTOB 2Z6BA 1VQ5A 5BR8Q 1AEXA 2EIFA 4A3FG 2A8VA 2WB1B 3NTIA 4RFBA 3GTGH 2K50A 1JCKB 4K0KQ 2OT2A 5COYA 2WKDA 1ZEQX 3GD7A 1IBML 2N88A 4GKJL 5E1FA 1EIFA 4B9XA 2JA7H 2K6AA 1XMOL 4X3SA 2OTJA 3G7LA 4A3DH 2QDBA 3DM1A 3SHLA 3SK5A 3HOZG 3M4OB 1SYCA 1B53A 1F9SA 1ICFB 4S3SA 5JOBA 1XPOA 4PMBA 1KAAA 4LFAQ 1FNWA 4A3BG 4RHRA 3DWQA 3T56B 5C3XA 3ULLA 3A8KE 1B44D 5C3EB 4OO1I 4GLXA 4QF4A 1SBBB 4A3MB 3CMEA 1Y1VB 3QJYA 4A3KB 1SYDA 2F0GA 1WTRA 3DEPA 3DXJC 3HOYB 4OHJA 5GROA 2MO1A 3A7LA 2F4IA 3MXNA 4IUPA 3OW2A 1HTPA 1VQGA 2Q8IB 2VUMG 2E2DC 4M1UB 3NENA 3GTMB 1TXYA 2H5XA 4IOCA 4DV5L 4GKJQ 2VW9A 4DV1L 2CW0D 1QE6A 3BDOA 5M9OA 2EYMA 3NSWA 3A7AB 5J39A 4B9WA 1GUWA 2JEAI 3UDIA 3PO3H 1I4QA 2SDFA 2Q8TA 2JA5H 2QEXA 4K6DA 1VQ6A 3M7NA 2EDGA 2PI2A 4HJ7A 4A3IG 4DR6L 2B8GA 4GNXC 4KN7C 1STYA 1PYBA 2LS01 1EY5A 5M3MB 5CV7A 1B3QA 2RCFA 3HKZG 2JA8G 4ZKCB 1YITA 5IT9c 1PH6A 1C0AA 2MP1A 3M7GA 2G5DA 2PMZE 4GNXA 4A3FH 3R8BA 3G48A 3PUWA 3GTQB 4YCWA 2JYOA 1U4PA 5C5LA 4JPBW 3EJIA 1K83B 3KYHC 2Q2IA 3KF6B 3E3XA 3KLWA 2QDLA 3FVQA 2VS1A 5IGCA 2N55A 4XXEA 5FLMG 2EQSA 2FJ2A 4OX9L 3K5OA 1N34L 3QB3A 4X3UA 3D4DA 2WIIB 4DV1Q 1K8OA 4JBMA 1IW7C 1HPCA 1RTNA 4K5VA 4QMGA 4KY6A 3TDQA 4HIMA 3HOZH 3FRPB 3S1QB 4OGQC 1WD1A 1DZ1A 4WJ3M 2K33A 4HIOA 3SK8A 2K28A 1E2ZA 2H1EA 4RA8A 1LT6D 2TSSA 2BE5C 4DR6Q 4TSSA 3BU2A 4A3BH 4JYAQ 3T1HL 5EGTA 1CKOA 3CC4A 4R4IA 2K5WA 3M4PA 3VYUA 4TKOB 2YTVA 3MHBA 1SEBD 4NXML 5GAEC 2YTXA 1HRJA 2ID0A 1LYLA 4DR1Q 2E2IH 1LTTD 1EYDA 4I7AA 5D3DA 1N36L 4KHPL 1NMGA 2QGQA 2VUMH 4GN3B 1GO3E 1O80A 2IX1A 2M2LA 2JP1A 2M9VA 2B29A 2C9OA 2ZXRA 2BH2A 4OELB 1CTMA 5KGUA 4X64Q 2PW7A 3PUYA 3STBC 3MZ5A 4DGZA 1WTOA 3MEFA 4G7OC 2YYZA 1SNPA 4HCSA 2DUDA 3CW2C 3HGBA 5ELOA 4A3IH 1SE8A 1YVCA 2JA6G 3MTSA 2XVSA 1XX8A 4LF9L 4MTNA 1CKNB 3IRBA 3MAQA 2JA8H 1EIGA 3NQTA 5K5PA 4LNQA 1I3QH 1YHAA 2D0OA 4A93B 3VYSA 1BUVT 1SYBA 2WP8J 3G6EA 5IGGA 2JXMB 1BNZA 3BDCA 1VQAA 1EEID 3H94A 4YWKA 4C1NK 3L7ZC 2K5VA 1N32L 1LTBD 5G3LF 5EBDA 3PV0A 1JB7A 3CQZH 1NAPA 4KKUA 4KHPQ 3TZUA 3HS0C 1SYFA 2R92B 3S1RB 1E2VA 1B7YB 3OPOA 5FLMH 3N52A 2KBNA 3R3OA 3CCEA 4Z9CB 4A3MG 1FVIA 5CV9A 3ULJA 4DK0A 5IT9L 3NTHA 1EFID 2RBMA 1TWFH 3HOYG 1PMRA 1B4OA 4JOIC 3GTLB 2QKIC 1B2TA 1MBYA 3EFXD 2B2UC 3J81i 2LY7A 5LMNW 3GTPH 1PH5A 3S2HB 1H9SB 2QILA 1VCIA 2Y0SG 4JOIA 5DEHA 4LF9Q 4IPCA 5JAVA 2HD3A 2B2UA 1ET6A 4GN5A 2NB0A 3B6YA 2AWOA 4KJNA 1YJ9A 3T51B 3PF4A 1F9PA 1B9MA 1H9KA 4DUZL 2V4DA 3FKIB 4DUYQ 1STHA 2UUAQ 1S40A 1EYGA 4RH6A 1DOLA 1L2FA 4C3JB 3MXPA 2OWOA 3CP0A 4NDXA 1T5EA 1C9OA 3SVMA 1AP0A 1E3PA 3TS2A 3EIVA 2B63B 5CV4A 2JA9A 4PG3A 2ICIA 2UXBL 1UNSA 1L1OB 1WYDA 5IT9E 5J1ZA 1OXVA 4MN3A 4LF5L 1PFNA 2Z0SA 5C44B 1K8AC 1ENFA 4DAVA 2Q2HA 5IY0A 2VL6A 1I4PA 2LXJA 2VZAA 4JI6L 3PO2G 3I2ZA 4A3EB 5KNDA 1LT4D 2JA6H 3S1NH 4JBKA 1K28A 5ISRA 3FDTA 3HOUG 2PI2E 4RG1A 1Q46A 2V1CC 2VQFL 5H1SE 1PTOH 4JI8Q 2CKZB 5CBAE 1CHPD 4QIWE 3GTGB 2R6GA 3RN5A 1N8RC 2GN5A 4B3TQ 3UDFA 3S16H 2B2VC 4A3GG 1SR3A 5E7NA 1EIHA 2NYZD 4DNRB 1GKHA 1I6HH 1K0SA 2LFNA 3CPWA 4L63B 4IURA 1WTVA 2JA7B 4A3DB 1QNUA 1G2SA 2B2VA 4ZUIA 1TY2A 4UDUC 4HMIA 1BCPD 3J81c 5DM63 3FHWA 1QUQA 4FO2A 1CSQA 4R8IA 5D3IB 3F8TA 4KN4C 1WTQA 4LFBQ 4RCNA 5FO9B 1U4RA 3K7UC 2KCTA 4DV2L 2F0EA 3C1EA 3G71A 4UP9A 1D6EC 3UI2A 2QA4A 1TWGH 1K8GA 4LK1C 5IYCG 1LABA 5DLQE 5A35A 2NN6I 3K81C 1X56A 4LF4L 2KEEA 4ZCKA 1PH2A 1BBWA 1R4PB 3NBIA 2Z4HA 5GAHC 4GS3A 2E75C 4DV0Q 2K14A 3RZDH 2WACA 1XWEA 4LF8L 1EL0A 2O5IC 5IWAQ 1Q7YC 4R4OA 1S5ED 5GQOA 4YHHQ 3ERQA 2A6EC 5M3FG 2ZXOA 3BYYB 4H44C 4MNOA 2R93G 4X62Q 2SEBD 3PO3B 2KCNA 2IW3A 4FF2A 1CM9A 2JA5B 2HCIA 2L5TA 2CHBD 1GJXA 4K5WA 1BBXC 3PO2H 4GLAC 1F9QA 1PFBA 5CORA 2EY1A 2OF1A 3KJPA 1EFWA 2ATWA 3T1YL 5K36G 3U9SA 3HOUH 3D6CA 4IPGA 1ZYRC 5FK9C 3SE0A 3CCJA 5JPMC 1QB5D 2R7FA 5ELFA 1TR5A 4A3FB 4IPHA 3AQQA 3S24A 4LF4Q 4HJ5A 1VQ7A 4PV1C 5CV6A 1HH2P 2RCNA 2AQ2B 4CGYB 1PH9A 1X3GA 4A3GH 3VR2A 1FYCA 1HZAA 1WTPA 2SNSA 3MXNB 4BS9A 2E2JH 5IE8A 1DOMA 3ND9A 3AB9A 1CSPA 1K3RA 1MKHA 1JJ2A 3S2DH 3CRLC 4ZAIA 4RGOS 4JI5L 1O7LA 2F03A 3HOZB 1JOOA 1GHJA 2CQAA 4LWCA 1SAPA 3S17H 2UU9L 3IFTA 1KNEA 2PZWA 5I2XA 2RKSA 1A3VA 2F0QA 3I90A 5IYCH 4A3BB 2KHIA 4AIMA 5EAYA 1DYQA 1LTRD 4IOAA 3T1YQ 3KBXA 2WKCA 1V8QA 1SFOH 2F0DA 1Q81C 3PUXA 3QO2A 4BY1G 3W2DA 1X3QA 3J81L 1SNMA 1VQ8A 4LF7L 2E2IB 1RL2A 4O42A 3KLSX 4P2CB 4IFDJ 1SSOA 2VUMB 1XXGA 2F3IA 5AFWA 2X69A 5CV5A 3GTKH 1E1OA 2BDOA 2F1MA 4K2KA 1IYJB 4OEMB 1WTXA 5M3FH 1A8VA 4JW0A 4A75A 3QIAA 4ZKBB 2NZOA 2A74C 1HZBA 4DU9A 2R93H 4ZUJA 3MFGA 1IBLL
chains in the Genus database with same CATH topology
1JR0D 2F0IA 1IKLA 4A3IB 3KUPA 4CKEA 5K36H 3HKZB 3VA7A 2JA8B 3E6ZX 3G6JB 4H13C 3RMHA 1I3QB 3NUCA 3TP8A 3J81E 1BQQT 4I65A 4IN3A 1TU2B 1ENCA 3CQZB 1F2YA 2EYJA 1EEFD 2OXPA 2HCCA 4H0LC 1XTCD 3L9AX 1TWFB 2F0VA 1H9JA 4C56C 2DY8A 1Y69U 4XQJA 3GTPB 5J22A 3PIP3 2J7ZA 2O5JC 1U4MA 4RKLA 1EQVA 3VR4A 1EYAA 1KDAA 3Q22A 1IW7D 2BCOA 1TS4A 3NTKA 1V1PB 1GUSA 5KYLA 2BE5D 4HR7B 1HTLD 2I46A 3GP7A 5KNBA 3GQBA 3OWFA 1VDZA 1QOHA 3NK9A 3CHBD 5EPKA 3R2IA 1KLGD 4EQOA 3HZXA 1A2TA 1TS5A 5KRUA 3RLFA 3TP5A 3OW7A 1BO0A 2EVBA 4KHVA 1IYUA 5CC4A 2JA6B 3S1NB 4DAPA 1HQMC 1LTGD 1EY4A 1HA6A 4BA1I 1F2MA 2JE6I 3Q0AA 5IGDA 1FR3A 2WINB 3A8JE 1PTOB 1HXYD 3F2UA 4JBWA 1Y8NB 3PUZA 3S16B 3EA6A 4G4KA 1STNA 5E4XA 2F0HA 1SNCA 2H4OA 1I6HB 1VF7A 2F3WA 3GV6A 4IFDG 5A2QL 1F2ZA 3NP8A 1O7YA 2KHSA 4MHEA 3QWNA 3Q23A 1FD7D 1EY0A 1SNDA 1JWUD 4DAYA 4FF1A 4OIJA 2Y0SB 1PRTF 1TWGB 3CRKC 3I73A 5TSSA 1PYWD 1DONA 1XYIA 3MVVA 3EVQA 1B3AA 3E0JA 1PTOD 3IL8A 2F0UA 2AUKA 3MFYA 1NSNS 4KD3A 1GHKA 3RZDB 3P7JA 5A2QE 1E0BA 2OEOA 2MJ8A 3LWUA 3ND8A 4IUQA 2FFKB 1BR9A 1U4LA 2RDGA 5T1GA 4XT1B 3PO2B 2RQXA 2RVLA 4K2LA 3HRZC 3HOUB 2JEBI 2DN8A 5IOCA 4QB4A 4F87A 3LWEA 2RDHA 3CU7A 1BF4A 3MXUA 1SNOA 2B2YC 4WFN3 5EKLA 2D2CC 1U9RA 1H9RA 1AZQA 3K5NA 4A3GB 2ZT9C 2B2YA 2E2JB 3VR6A 4ABNA 3NWSA 1D2BA 4NMZA 2K1BA 4IFDH 1CQFA 2K5QA 5DNFA 3S2DB 2KVMA 2RA4A 2NUCA 3BS1A 3WOFA 5LHY1 1LTID 3D6WA 5DAUA 3S17B 1ILQA 2K7VA 2XNAC 4PNYA 4XT3B 4GZYC 1EQTA 4QCLA 3AU7A 4R8NA 1IHZA 3URYA 2X6LA 2A5HA 4ZLTF 1SFOB 3IKJA 4WORA 2RDFA 5C0XI 3TN2A 1PLFA 1LT5D 4L8JA 4J1MA 1AW7A 4KTAA 4DFAA 2G9HD 1L0YB 2LMCB 1TS2A 3MC0B 1YNNC 5I9PA 2D62A 2VB2X 4KKSA 4J8QA 1CHQD 3GTKB 4C1NI 1A2UA 3QG1A 1JC7A 5M3FB 5C6AA 2KJXA 1F2LA 3FPUB 2R93B 4O1NA 4BA2I 4PMWA 1HQRD 3KK7A 2K03A 5JPNC 3J7AF 2KUMA 1EWCA 5C4JB 4R9WA 2AQ1B 4RGMA 2A6ED 4K6LA 3A8IE 1WVLA 1PXUA 1MSHA 3I8ZA 1EZ6A 1QILA 3D4RA 3PMFA 4ZYSA 1CZGA 5I6WA 2EYOA 2PMZB 1ZYRD 2L12A 2NZ1D 4C3IG 2NVQB 3NWTA 3HG9A 2B8FA 2TMPA 5HGTA 2DY7A 3SR1A 4G7HC 1CZWA 4N9PA 2B2TC 1STGA 1W6KA 4OO1G 1BCPB 3TSSA 2B2TA 1T5XD 5CR3A 4RCOA 1JICA 4RHSA 1HUNA 5I9OA 4BY1B 2PCFB 1RD9D 4K14A 4KY5A 1TQOA 4DNTB 2YU9B 2A69C 5EPJA 1KNAA 1TS3A 3SXHA 2WV6D 4HSVA 3C3LA 1HCZA 2F0TA 3K7AB 1S5BD 1MSGA 4XIGS 2EYPA 4F88A 2R61A 2PYKA 3GO5A 3P20A 1X32A 3I4MB 3K6OA 1HA5A 5BN5A 1SE4A 4OIKA 5D14A 1OXXK 1EU4A 5CGKA 2IX3A 3BYTB 1WD0A 5JJZA 4LJZC 3EROA 2B39A 3VR5A 4I7ZC 1YNJC 3ONAB 3J7YW 2AUJD 3U9OA 3GTJB 4DN4M 3PUVA 1IKMA 2VXWA 2AWNA 5JVH3 1TY0A 5FKAC 1A3TA 1DXMA 1LT3D 2K01A 4OO1H 4KI0A 1MI2A 1EWHA 4N9TA 1D1IA 3KF8A 4C3HG 3LNNA 1SYGA 1JB3A 4JK1C 2J4XA 2IWHA 2A68C 1RHPA 1F9RA 2K5DA 2G9DA 3Q24A 5NUCA 3OIQA 4RKBA 4ODGA 2F0SA 1L0XB 3DWAA 2L4NA 1QNKA 3VA5A 5EKIA 2EYLA 3QOLA 1KTKA 2MUYA 3JAML 3D8GA 4CBVA 2BA1A 2HQEA 3I3CA 5I4DA 2F0OA 3E5SA 1V43A 2EPBA 2D9UA 3H91A 1G2TA 2L11A 2K32A 4WJWA 1SMYC 2ENBA 1G91A 3SK4A 1TWHB 1WTWA 5CBEE 1I4HA 3C1FA 5IGFA 1LACA 4QIWB 3X3MA 1PZID 5C4ZA 5ELCA 1ZXTA 4IALA 1BOSA 3GV3A 1H9MA 3JAME 5T1IA 2Z1CA 1QCBD 1TKWB 2EY2A 3BVZA 3I4NB 1UUPA 4DXFA 1SDFA 2EJGC 1NR2A 2F3VA 1PZJD 1M8AA 3NQIA 3S9WA 1BXTA 1UAPA 1CA5A 5E4WC 4DF7A 2IL8A 2FINB 1C4QA 1I50B 2EZVA 3K5LA 3CKIB 4IUTA 1NCVA 5IGBA 3K58A 1CFMA 4CHTB 4NP5A 2F0KA 4TRDA 1DCZA 3P1HA 2J0TD 4HEDA 3HP3A 2NBFA 1C8CA 3C46A 1EY6A 2GA4B 3TMEA 4XDXA 5I6YA 1D5XC 1D5MC 2A6HC 1CK1A 1AZPA 4XQNA 3RZOB 3TP7A 1S5DD 2EOTA 4ILWA 1VMCA 3K57A 3WDNA 4TQUS 3SDZA 4HN7A 2F0WA 4FP5D 5KIXA 1D1KA 4FXDA 2B2WC 4EQPA 3A56A 4CJ1B 1F77A 3OWEB 3NBHA 1JQYD 2RSNA 2XWJB 2B2WA 2DNCA 2L55A 2NN6G 5BN3A 2PZTA 3LX0A 1GUOA 3RUZA 3OHXC 5M5WB 5G3LD 4OL7A 1GUNA 1TVXA 4Q0FA 1STBA 1ONLA 4IUUA 1PRTC 1GUGA 5CMDA 1B50A 2F0MA 1GOZA 5EKKA 3I4LA 1MGSA 3DEOA 3VYTA 4IZ8A 4U673 5ELDA 3OMGA 3L3OC 1ICWA 1CQVA 2R7ZB 1ESRA 3S1MB 5FOBB 4L6TB 1ESFA 4KKTA 1YNND 1QWYA 4NKLA 1A6XA 5EJWA 4EVOA 2IJ0A 3OIPA 2FHTA 1ZKOA 3PIO3 5KNCA 3MA2B 4AYBB 2KCCA 1I4RA 4ZRZA 2NWGA 3T16A 4KHZA 1SNQA 3MXGA 2L0CA 1HFGA 5ELEA 1AFPA 4C3IB 4NW2A 4RWSC 3Q6SA 1ILPA 3C2PA 1LV9A 3BDLA 4CJ2C 4FF3A 3NPPA 5C4XB 2FMCA 3D3RA 1Q90A 1KDBA 5BN4A 4Y7NB 3M4YA 1QJOA 2QEJC 3ITPA 2K04A 2NN6H 2AQ3B 2WAQB 1TIID 4RAUC 2VNUD 3DMUA 3KBGA 1GUTA 3BVMA 3HEJA 4ULLA 3AMUA 2PZUA 2VB3X 3D4WA 2BOSA 1LLRD 1MD2D 3I91A 3X3NA 1S4ZA 5KEEA 1O7ZA 3OOCA 1ML0D 1X3PA 3KLSA 2F0JA 3DUZA 3P75A 2E2HB 3K59A 3V05A 1AN8A 3DHQA 4HAEA 2A69D 1NR4A 5EBCA 1S5CD 1RJTA 3HOWB 3BZDB 1LTAD 5KYIA 1TWAB 2PO4A 2XWBB 1HFNA 1EZ8A 2XSCA 1EU3A 1DM0B 4Q5VA 5E3FA 3FEWX 1Y8OB 4FYDA 3R93A 5JEAJ 2A73B 5HURA 1BDOA 1Z47A 4ME5A 1CI3M 4C2MB 1ET9A 4XYOA 4KMUC 4KY7A 2NVTB 5DM73 2EE1A 4CKCA 1JORA 1Z7TA 1YNJD 1PFMA 4MIUA 4QUFA 2MHVA 1J9OA 1RTOA 1OO9B 1Q12A 2DNEA 3T4AC 2O4XA 4C3HB 2SOBA 1VF5C 1V1PA 4V0BA 4XQQA 2D5DA 2QF7A 3H6MA 5LL6S 3V96A 2QCPX 4CJ0B 3MEHA 2HUGA 1JOKA 2EYHA 2CW0C 1KABA 5FO8B 2KECA 3BVGA 4WRDA 2A68D 1Z6HA 1RDPD 5C0XJ 2SNMA 1II3A 3WOEA 5IODA 5EPLA 1STEA 1B1ZA 3S15B 2RSOA 1PTOC 4PMCA 1STAA 3FPPA 5IGEA 4HMJA 1HHVA 4ZK9B 1EY7A 4HCEA 3HOVB 3BG3A 1R9TB 3TBIB 2L1BA 4FF4A 3KLRA 3VYRA 4DK1A 4CKBA 3NHHA 1A3UA 3J80L 1D5ZC 2PQEA 2JSOA 1KDCA 1Y8PB 4EGVA 1Q1BA 5IIFA 1CA6A 1SMYD 1I4XA 3M3YB 1W6JA 1ENAA 1RCVD 2L9HA 1VMPA 1SYEA 3IFDA 3I70A 3N6RA 4BWGB 2MPMA 1LTSD 1PTOF 1EY8A 1NUCA 2CVRA 1DJRD 1OXSC 1WCMB 3DWPA 2HDMA 1I4GA 2F0FA 1LO5D 4E6IA 3I72A 4M8AA 4FNFA 3J80E 3M85A 2KEDA 3VR3A 1RODA 2E74C 2KOLA 5FLXL 2LKVA 5JEAG 2EJMA 1SJHD 3NXWA 4ID6A 1GXDC 3EQLC 3K5MA 2IPKD 4IQZA 1JE4A 1OXUA 5LL6X 1K8MA 4G7ZC 2EXZA 4FVMA 4B08A 2FMMA 2I07B 3H09A 5F2DA 5EQ0A 4KV6A 2C5CA 2M00A 3TP6A 3HOXB 1OXTA 2E76C 2EY5A 2XN9C 2HDLA 2XRSD 5C4HA 3TZDA 2F0LA 5FLXE 2A6HD 4HTHA 4KK7A 1PRTB 3H3VC 2IT1A 4QUCA 1KLUD 4RGTA 2NVYB 2EYFA 4A3JB 4J6HA 5M5YB 4X3TA 5C0XG 5C3WA 2R3ZA 1IL8A 4UAIA 5M5XB 2BDNA 1JWSD 4BBSB 4IFDI 3IAYA 2F0PA 1Q1EA 4BBRB 1Q3LA 1HUMA 1B9NA 2NVXB 1G291 3K0YA 4K8JA 5ELBA 3W3AA 4HSPA 1Q8IA 4U68A 2O2LD 1TWCB 2Z4IA 4DXGA 1G8ZD 1TT2A 2PNRC 4LMQD 5JEAH 1JOQA 1PRTD 2F0NA 4K5XA 1CT1D 1FNVA 5JVG3 1C48A 4C3JG 1SE3A 4EQNA 1PZKD 1EOTA 1Y1WB 3S14B 5FO7B 4X3KA 4XYQA 4LAAA 4F7XA 1EY9A 3J7AV 1SXTA 5I2YA 3D31A 4ZQ3A 1RKNA 2EY6A 1H9SA 3O13A 1R4QB 2KQ3A 4KJOA 5CYUA 1IYVA 3OSOA 5CV8A 3ZYYX 1A15A 2EJFC 1E2WA 4PQXA 1BCPC 1DOKA 2NTSA 2PPBC 4DA2A 2X6GA 1V1OA 3R2TA 3H0GB 2ICEC 5C0XH 1EYCA 1UEAB 1DD2A 4RGNA 3T13A 4H7BA 3MWYW 3SEBA 3NE5B 1I6VC 4IUVA 4FXKC 1FNUA 5C5MA 3OMCA 2MGSA 1O78A 4FXGC 1RF2D 3T53B 2NTTA 1FGBD 1SJED 1QG7A 2IX0A 2PW5A 1SE2A 1BCPF 2XIWA 1G6ZA 3A55A 4KD4A 2BA0A 1S5FD 3QOJA 1PDQA 4G57A 5D65A 4BY7B 4XTCS 2KA7A 3RD4A 2K05A 4IUNA 1JWMD 1M4VA 3A54A 4F8MA 2Z8LA 2Q8RE 1J8IA 3FMCA 4K8IA 4YIJA 2ZXPA 4V190 3V2TA 2XRQD 3SK6A 3GTOB 1AEXA 2WB1B 3NTIA 4RFBA 1JCKB 2OT2A 5COYA 2WKDA 1ZEQX 3GD7A 2N88A 5E1FA 4B9XA 2K6AA 4X3SA 3G7LA 2QDBA 3DM1A 3SHLA 3SK5A 3M4OB 1SYCA 5JOBA 1B53A 1F9SA 4S3SA 4PMBA 1KAAA 1FNWA 4RHRA 3DWQA 3T56B 5C3XA 3A8KE 1B44D 5C3EB 4OO1I 4QF4A 1SBBB 4A3MB 1Y1VB 3QJYA 4A3KB 1SYDA 2F0GA 1WTRA 3DEPA 3DXJC 3HOYB 4OHJA 3A7LA 2F4IA 3MXNA 4IUPA 1HTPA 2Q8IB 2E2DC 4M1UB 3GTMB 2CW0D 1QE6A 3BDOA 5M9OA 2EYMA 3NSWA 3A7AB 5J39A 4B9WA 1GUWA 2JEAI 1I4QA 2SDFA 2Q8TA 4K6DA 3M7NA 2EDGA 2B8GA 4KN7C 1STYA 2LS01 1EY5A 5M3MB 5CV7A 4ZKCB 2MP1A 3M7GA 3R8BA 3PUWA 3GTQB 2JYOA 1U4PA 5C5LA 3EJIA 1K83B 3FVQA 5IGCA 2N55A 4XXEA 2FJ2A 3K5OA 3QB3A 4X3UA 3D4DA 2WIIB 1K8OA 1IW7C 1HPCA 1RTNA 4K5VA 4QMGA 4KY6A 3TDQA 3FRPB 3S1QB 4OGQC 1WD1A 1DZ1A 2K33A 3SK8A 2K28A 1E2ZA 2H1EA 4RA8A 1LT6D 2TSSA 2BE5C 4TSSA 5EGTA 2K5WA 3VYUA 4TKOB 3MHBA 1SEBD 1HRJA 2ID0A 1LTTD 1EYDA 5D3DA 1O80A 2IX1A 2M2LA 2JP1A 2M9VA 2C9OA 2ZXRA 1CTMA 5KGUA 2PW7A 3PUYA 3MZ5A 4DGZA 1WTOA 4G7OC 2YYZA 1SNPA 4HCSA 3HGBA 3MTSA 2XVSA 1XX8A 3MAQA 1EIGA 3NQTA 5K5PA 4A93B 3VYSA 1BUVT 1SYBA 2WP8J 5IGGA 2JXMB 1BNZA 3BDCA 1EEID 3H94A 4C1NK 3L7ZC 1LTBD 5G3LF 5EBDA 3PV0A 4KKUA 1NAPA 3TZUA 3HS0C 1SYFA 2R92B 3S1RB 1E2VA 3OPOA 3N52A 3R3OA 4Z9CB 5CV9A 4DK0A 5IT9L 3NTHA 1EFID 2RBMA 1PMRA 1B4OA 3GTLB 2QKIC 1B2TA 1MBYA 3EFXD 2B2UC 2LY7A 3S2HB 1H9SB 2QILA 1VCIA 5DEHA 5JAVA 2B2UA 1ET6A 2NB0A 2AWOA 4KJNA 3T51B 1F9PA 1B9MA 1H9KA 2V4DA 3FKIB 1STHA 4RH6A 1DOLA 4C3JB 3MXPA 4NDXA 1T5EA 3SVMA 1AP0A 2B63B 5CV4A 2ICIA 1UNSA 5IT9E 5J1ZA 1OXVA 4MN3A 1PFNA 5C44B 1ENFA 4DAVA 1I4PA 4A3EB 5KNDA 1LT4D 5ISRA 3FDTA 1PTOH 5CBAE 1CHPD 3GTGB 2R6GA 2B2VC 1EIHA 2NYZD 4DNRB 2LFNA 4L63B 4IURA 1WTVA 2JA7B 4A3DB 1QNUA 1G2SA 2B2VA 4ZUIA 1TY2A 4UDUC 4HMIA 1BCPD 5DM63 4FO2A 4R8IA 5D3IB 4KN4C 1WTQA 4RCNA 5FO9B 1U4RA 2F0EA 3C1EA 1D6EC 3UI2A 4LK1C 1LABA 5A35A 2NN6I 2KEEA 1R4PB 3NBIA 2Z4HA 2E75C 1EL0A 2WACA 1XWEA 2O5IC 1S5ED 3ERQA 2A6EC 2ZXOA 3BYYB 4H44C 2SEBD 3PO3B 2KCNA 2IW3A 4FF2A 1CM9A 2JA5B 2HCIA 2L5TA 2CHBD 1GJXA 4K5WA 1BBXC 1F9QA 1PFBA 5CORA 2EY1A 2OF1A 5K36G 3U9SA 3D6CA 1ZYRC 5FK9C 3SE0A 5JPMC 1QB5D 5ELFA 1TR5A 4A3FB 4PV1C 5CV6A 2AQ2B 4CGYB 3VR2A 1FYCA 1WTPA 2SNSA 4BS9A 1DOMA 3ND9A 3AB9A 3CRLC 4ZAIA 4RGOS 1O7LA 2F03A 3HOZB 1JOOA 1GHJA 2CQAA 1SAPA 3IFTA 1KNEA 2PZWA 5I2XA 2RKSA 1A3VA 2F0QA 3I90A 4A3BB 1DYQA 1LTRD 3KBXA 2WKCA 1V8QA 2F0DA 3PUXA 3QO2A 3W2DA 1X3QA 3J81L 1SNMA 2E2IB 4O42A 3KLSX 4P2CB 4IFDJ 1SSOA 2VUMB 1XXGA 5AFWA 2X69A 5CV5A 2BDOA 2F1MA 4K2KA 1WTXA 3QIAA 4ZKBB 2A74C 4DU9A 4ZUJA 3MFGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4Z A;  5CV4 A;  4QB4 A;  3ITP A;  2F0I A;  4IAL A;  3PMF A;  1EY4 A;  1F2M A;  2F0F A;  1SYD A;  2O4X A;  5J1Z A;  4E6I A;  3U9O A;  2SOB A;  2F0G A;  1SNO A;  5EKL A;  4K5W A;  5I6W A;  5IGD A;  2EYO A;  1TT2 A;  3DMU A;  2PZT A;  3H6M A;  3LX0 A;  1JOQ A;  1U9R A;  3HEJ A;  3RUZ A;  2EY1 A;  2PZU A;  2PW5 A;  2OF1 A;  3NUC A;  3D4W A;  2F0N A;  4K5X A;  5KGU A;  1A3T A;  2EY2 A;  2PW7 A;  3TP8 A;  4OL7 A;  2LKV A;  3MZ5 A;  4DGZ A;  1STN A;  3MEH A;  3NXW A;  4ID6 A;  4NMZ A;  2EYM A;  5M9O A;  2F0H A;  3D6C A;  5HGT A;  4EQN A;  2F3V A;  1SNC A;  1STB A;  1JOK A;  1SNP A;  2EYH A;  4I65 A;  4B9W A;  5ISR A;  1TR5 A;  3SR1 A;  1ENC A;  2NUC A;  4KD4 A;  5KEE A;  2F3W A;  4LAA A;  3S9W A;  5CV6 A;  4K8J A;  4N9P A;  4F7X A;  1KAB A;  1F2Y A;  4K6D A;  1F2Z A;  1EY9 A;  1STG A;  2F0M A;  3NP8 A;  3QOJ A;  4G57 A;  2KHS A;  2EYJ A;  4WRD A;  5DAU A;  2F0J A;  4N9T A;  4DF7 A;  2EXZ A;  5EKK A;  2OXP A;  4PNY A;  3NQT A;  3P75 A;  4IUN A;  5K5P A;  1SYG A;  1EY0 A;  1SND A;  4R8N A;  1STY A;  4F8M A;  1IHZ A;  2SNM A;  1II3 A;  1SYB A;  2SNS A;  1EY5 A;  4IZ8 A;  5IOD A;  5CV7 A;  5F2D A;  5CR3 A;  5IGG A;  3DHQ A;  3OMG A;  4ZQ3 A;  4KV6 A;  1RKN A;  2F0V A;  5I9O A;  2EY6 A;  4K8I A;  4PMC A;  3BDC A;  1STA A;  2M00 A;  4YIJ A;  3TP6 A;  5IGE A;  4WOR A;  2RDF A;  4HMJ A;  4K14 A;  2KQ3 A;  3V2T A;  5IGB A;  4KY5 A;  5J22 A;  1JOO A;  1TQO A;  1EY7 A;  4KJO A;  5C5L A;  1SYF A;  3SK6 A;  5KYI A;  2EY5 A;  3EJI A;  4NKL A;  5IOC A;  4J1M A;  3R3O A;  1AEX A;  3MVV A;  4KTA A;  4ZUI A;  5NUC A;  4NP5 A;  3OSO A;  1EQV A;  4RKL A;  2F0K A;  3EVQ A;  4HMI A;  4TRD A;  1EYA A;  1KDA A;  5CV8 A;  4DFA A;  5IGC A;  4EVO A;  2PZW A;  4RKB A;  5CV9 A;  5C4H A;  4ODG A;  2RKS A;  3P1H A;  1A3V A;  2F0S A;  2F0L A;  2F0Q A;  3SXH A;  5I9P A;  2F0U A;  2RBM A;  1EZ8 A;  4HTH A;  3VA5 A;  3NHH A;  1A3U A;  2EYL A;  3QB3 A;  3QOL A;  2F0E A;  1NSN S;  3D4D A;  3C1E A;  3D8G A;  1A2U A;  2PQE A;  2F0D A;  2F0T A;  1EY6 A;  1KDC A;  2HQE A;  4KD3 A;  2F0O A;  5E3F A;  5E1F A;  5KYL A;  5C6A A;  3E5S A;  4K5V A;  4QMG A;  3TME A;  4B9X A;  4KY6 A;  5I6Y A;  2EYP A;  3T16 A;  5HUR A;  1SNQ A;  1SNM A;  5IIF A;  2OEO A;  2QDB A;  5DEH A;  2EYF A;  3SHL A;  1EYC A;  4J6H A;  3SK5 A;  3SK8 A;  1ENA A;  4ME5 A;  2PYK A;  5JAV A;  3OWF A;  3NK9 A;  1SYE A;  4KY7 A;  3TP7 A;  3T13 A;  1SYC A;  5JOB A;  4KJN A;  4S3S A;  5CV5 A;  4H7B A;  5C3W A;  5EGT A;  4EQO A;  1JOR A;  2ENB A;  3HZX A;  3SK4 A;  1STH A;  1A2T A;  4PMB A;  5KRU A;  1KAA A;  2F0W A;  3MHB A;  4K2K A;  5C5M A;  5CGK A;  1EY8 A;  2WAC A;  3BDL A;  3MXP A;  3TP5 A;  1NUC A;  5KIX A;  4NDX A;  2F0P A;  5C3X A;  4K2L A;  3OMC A;  4MIU A;  4DU9 A;  1KDB A;  3C1F A;  4KHV A;  4ZUJ A;  5IGF A;  3ERQ A;  4EQP A;  3ERO A;  1EZ6 A;  5CC4 A;  1EYD A;  5J39 A;  4QF4 A; 
#chains in the Genus database with same CATH topology
 1JR0 D;  2F0I A;  1IKL A;  4AYB E;  5FJ8 G;  5C4J H;  4A3I B;  3KUP A;  4CKE A;  4R1J A;  1VQP A;  5K36 H;  3HKZ B;  3VA7 A;  3I4M G;  2JA8 B;  3E6Z X;  3G6J B;  4H13 C;  3RMH A;  1I3Q B;  2I0Q A;  3NUC A;  3A0J A;  3TP8 A;  2ZTC A;  3E9H A;  1I94 L;  3J81 E;  1MJC A;  1BQQ T;  4OON A;  3CCV A;  4I65 A;  3CCQ A;  4DV3 L;  1A63 A;  4IN3 A;  1TU2 B;  1ENC A;  2CWA A;  3CQZ B;  3KDF A;  3QR8 A;  1JMC A;  1K73 C;  4X6A H;  1F2Y A;  2EYJ A;  1EEF D;  2OXP A;  2HCC A;  4H0L C;  1XTC D;  2WAQ E;  2NVQ H;  3L9A X;  1TWF B;  1HR0 L;  2F0V A;  1H9J A;  3TQY A;  1FGU A;  4C56 C;  2A19 A;  2DY8 A;  1Y69 U;  4XQJ A;  3GTP B;  5J22 A;  3PIP 3;  2J7Z A;  2O5J C;  1U4M A;  4RKL A;  1EQV A;  1J6Q A;  3VR4 A;  3RNU A;  1EYA A;  1KDA A;  3Q22 A;  1PH7 A;  1IW7 D;  2BCO A;  1TS4 A;  2ZM6 Q;  3NTK A;  1V1P B;  4L5R C;  4BY1 H;  1KQS A;  4HJ8 A;  2UUB Q;  2VY3 A;  1OTC A;  1GUS A;  5KYL A;  4HJA A;  1M90 C;  1UE1 A;  1EOV A;  2BE5 D;  4HR7 B;  4DV3 Q;  1HTL D;  2YU9 H;  2I46 A;  3GP7 A;  4APV A;  4DR2 L;  5KNB A;  3OTO L;  3GQB A;  3OWF A;  1VDZ A;  1QOH A;  3NK9 A;  1KRT A;  3CHB D;  5EPK A;  5AJ3 Q;  3R2I A;  1E24 A;  1KLG D;  3CC2 A;  4EQO A;  3HZX A;  1A2T A;  1TS5 A;  5KRU A;  3RLF A;  1HR0 Q;  3K7A H;  3TP5 A;  2HHH Q;  3OW7 A;  2WFW A;  5FJ8 H;  1BO0 A;  2EVB A;  1VQN A;  4KHV A;  1IYU A;  5CC4 A;  2JA6 B;  3S1N B;  1SN8 A;  4DAP A;  2XGT A;  1HQM C;  1LTG D;  1N33 Q;  1EY4 A;  1HA6 A;  4BA1 I;  1F2M A;  2JE6 I;  1YIJ A;  3I4M H;  3AFQ A;  1XNR Q;  4RMF A;  3STB D;  3Q0A A;  5IGD A;  4X65 L;  1FR3 A;  2WIN B;  3A8J E;  3A5U A;  1PTO B;  3WWV A;  1HXY D;  3F2U A;  4DV7 Q;  3U50 C;  2K75 A;  4JBW A;  1JJC B;  1Y8N B;  3PUZ A;  3J81 j;  3EA6 A;  4G4K A;  3S16 B;  1STN A;  3W1G A;  5E4X A;  2F0H A;  1FJG Q;  1SNC A;  2H4O A;  1I6H B;  3PQI A;  1VF7 A;  2F3W A;  3GV6 A;  4IFD G;  3GTJ H;  5A2Q L;  1F2Z A;  3NP8 A;  1O7Y A;  2KHS A;  4MHE A;  3QWN A;  3Q23 A;  1I5F A;  2GVB A;  1FD7 D;  2Z6K C;  1EY0 A;  1A62 A;  1SND A;  1VQB A;  1JWU D;  4DAY A;  4FF1 A;  3RLN A;  1IBM Q;  4OIJ A;  2Y0S B;  1PRT F;  1TWG B;  3CRK C;  3I4N G;  2Z6K A;  1XMO Q;  3I73 A;  5TSS A;  1PYW D;  1DON A;  1XYI A;  3MVV A;  1LUZ A;  1W2B A;  3EVQ A;  1VS0 A;  1B3A A;  3E0J A;  1PTO D;  3VDY A;  3IL8 A;  5IYD H;  4PZ7 A;  2F0U A;  2AUK A;  1IZ6 A;  3G4S A;  2E5L L;  3MFY A;  1NSN S;  4KD3 A;  1GHK A;  3GDE A;  3RZD B;  4YY3 L;  1SLJ A;  5ELN A;  4A3L G;  2LXK A;  3P7J A;  5A2Q E;  1E0B A;  2OEO A;  2MJ8 A;  3LWU A;  3ND8 A;  4IUQ A;  2FFK B;  3E9I A;  1K3B C;  1BR9 A;  1U4L A;  2RDG A;  1PFS A;  4P75 A;  5T1G A;  4XT1 B;  3PO2 B;  4GN4 B;  5LMU L;  1QUQ B;  1HNW L;  3M9B A;  1K0R A;  2RQX A;  2RVL A;  4DV5 Q;  5IP9 G;  4K2L A;  3HRZ C;  3HOU B;  2JEB I;  2DN8 A;  5IOC A;  4QB4 A;  4F87 A;  3H3V I;  3LWE A;  2RDH A;  3CU7 A;  1BF4 A;  3MXU A;  1EWI A;  1SNO A;  2B2Y C;  4WFN 3;  5EKL A;  4B3S L;  4DR3 L;  4CDD C;  2D2C C;  1U9R A;  1TWH H;  1H9R A;  1AZQ A;  3K5N A;  4A3G B;  1VQL A;  2KHJ A;  2ZT9 C;  4OWX B;  2B2Y A;  2E2J B;  3VR6 A;  4ABN A;  3NWS A;  3CCL A;  1D2B A;  3HFZ B;  4NMZ A;  2K1B A;  4IFD H;  1CQF A;  2K5Q A;  5DNF A;  3S2D B;  2KVM A;  2RA4 A;  2NUC A;  1G51 A;  4QJF A;  3U58 A;  3BS1 A;  3WOF A;  5LHY 1;  1LTI D;  3D6W A;  5DAU A;  3S17 B;  1ILQ A;  2K7V A;  2XNA C;  3AYH B;  4PNY A;  4XT3 B;  4GZY C;  1EQT A;  4QCL A;  3AU7 A;  4R8N A;  4A3C G;  4OX9 Q;  1IHZ A;  3URY A;  1N34 Q;  3I4N H;  2X6L A;  1BKB A;  1PA6 A;  2DGY A;  2K5H A;  3L0O A;  2IHF A;  2A5H A;  4ZLT F;  1SFO B;  3IKJ A;  1YJW A;  4WOR A;  2RDF A;  4JI1 L;  4CDF C;  5C0X I;  4UP8 A;  2UUC L;  3TN2 A;  1PLF A;  1LT5 D;  4L8J A;  4J1M A;  1AW7 A;  4KTA A;  4B3S Q;  1EIY B;  4DFA A;  4DR3 Q;  2G9H D;  1L0Y B;  2LMC B;  3T1H Q;  1TS2 A;  3MC0 B;  1YNN C;  3JAM i;  5I9P A;  4MZ9 A;  2D62 A;  2VB2 X;  4KKS A;  4J8Q A;  1CHQ D;  4OXP A;  4A3L H;  3GTK B;  1LM0 A;  4NXM Q;  4C1N I;  1A2U A;  1I50 H;  3QG1 A;  1JC7 A;  1MJE A;  2OCE A;  5M3F B;  5C6A A;  1SMX A;  1M1K C;  2KJX A;  1F2L A;  3FPU B;  4GKK L;  2R93 B;  1N36 Q;  1GVP A;  4O1N A;  4BA2 I;  4PMW A;  1HQR D;  3KK7 A;  2K03 A;  5JPN C;  3J7A F;  2ALY B;  2KUM A;  1EWC A;  5C4J B;  4R9W A;  1ASZ A;  1PVO A;  1SRO A;  4LUV A;  5IP9 H;  2AQ1 B;  4RGM A;  2A6E D;  1NY4 A;  4K6L A;  1X9N A;  5JJL A;  3A8I E;  1WVL A;  1PXU A;  1MSH A;  4AYB G;  3I8Z A;  1XPR A;  1EZ6 A;  3U4V A;  1QIL A;  3D4R A;  3PMF A;  4A4I A;  4ZYS A;  3RZO H;  4IJH A;  2PNH A;  1EQR A;  1CZG A;  5I6W A;  2EYO A;  2PMZ B;  1ZYR D;  2L12 A;  2NZ1 D;  1JT8 A;  4C3I G;  1PV4 A;  2NVQ B;  3NWT A;  1JJG A;  1N9W A;  3HG9 A;  1KIX A;  2B8F A;  1X3E A;  2TMP A;  5HGT A;  1N32 Q;  2HQL A;  5C4X G;  2DY7 A;  3SR1 A;  4G7H C;  1CZW A;  4N9P A;  2B2T C;  4A3C H;  1STG A;  3K0X A;  1W6K A;  2WAQ G;  4OO1 G;  1BCP B;  1VQ9 A;  2KEN A;  3TSS A;  5M5W H;  3Q8D A;  2AKW B;  2B2T A;  1T5X D;  5CR3 A;  4RCO A;  1JIC A;  4RHS A;  3CCS A;  1HUN A;  5I9O A;  4BY1 B;  2PCF B;  1KD1 C;  1RD9 D;  3JAM c;  4K14 A;  4KY5 A;  1TQO A;  4DNT B;  2ZJR A;  5GAD C;  2YU9 B;  2A69 C;  5EPJ A;  3KDF B;  2AHO B;  1KNA A;  4DK3 C;  1TS3 A;  4DUZ Q;  2CCZ A;  3SXH A;  4L5S A;  2WV6 D;  4HSV A;  3C3L A;  1HCZ A;  3A5Z B;  2F0T A;  3K7A B;  2R7Z H;  1S5B D;  3S1M H;  5IP7 G;  1MSG A;  4XIG S;  2EYP A;  2N3S A;  1NJI C;  4JI7 L;  4A76 A;  4DAM A;  4F88 A;  2MO0 A;  2UXB Q;  2R61 A;  2PYK A;  3GO5 A;  3P20 A;  4YWL A;  1X32 A;  4LF5 Q;  3I4M B;  3K6O A;  1HA5 A;  5BN5 A;  1SE4 A;  4OIK A;  5D14 A;  1OXX K;  2IHE A;  4LUZ A;  1GD7 A;  2MQH A;  1EU4 A;  5CGK A;  4JI6 Q;  2IX3 A;  1YJN A;  3BYT B;  1WD0 A;  5JJZ A;  4LJZ C;  3KF6 A;  3ERO A;  4AQY L;  2B39 A;  3VR5 A;  4DV4 L;  4I7Z C;  3CCR A;  1UEB A;  1YNJ C;  1AE3 A;  3ONA B;  3J7Y W;  2AUJ D;  2QW7 A;  3U9O A;  4C3I H;  3GTJ B;  2VQF Q;  4DR4 L;  4DN4 M;  3PUV A;  1IKM A;  2VXW A;  2AWN A;  5JVH 3;  2DJF C;  5C4X H;  1TY0 A;  5FKA C;  2HT1 A;  1A3T A;  1DXM A;  4AH6 A;  1RIP A;  4Y7N H;  1LT3 D;  3TRE A;  4X66 L;  2K01 A;  3H15 A;  4OO1 H;  4KI0 A;  1MI2 A;  1UWV A;  2VQE L;  1EWH A;  4JCV E;  3OYY A;  4JBJ A;  4N9T A;  4R4C A;  1D1I A;  4P71 A;  1V9P A;  3KF8 A;  4UHV A;  4C3H G;  3LNN A;  2MFI A;  1SYG A;  1JB3 A;  5J3B A;  1IBK L;  2OQ0 A;  4OWT B;  4DV2 Q;  4JK1 C;  2J4X A;  2IWH A;  2A68 C;  1RHP A;  4B3M L;  1F9R A;  4DR7 L;  4DV4 Q;  2K5D A;  2AMC B;  2G9D A;  3Q24 A;  1NBW A;  4YCU A;  5NUC A;  2ZTD A;  3OIQ A;  4DR4 Q;  2E2H H;  4RKB A;  1PH1 A;  1XNQ L;  2F4V L;  4ODG A;  2F0S A;  1L0X B;  4L5T A;  3DWA A;  2L4N A;  1QNK A;  4JG2 A;  3VA5 A;  5EKI A;  5IP7 H;  2EYL A;  3QOL A;  1KTK A;  2MUY A;  3JAM L;  3D8G A;  4LF8 Q;  4JVZ A;  4CBV A;  2BA1 A;  2HQE A;  3I3C A;  5I4D A;  2F0O A;  2F52 A;  4DAY B;  3E5S A;  3HKS A;  3HOW H;  1V43 A;  2EPB A;  2Q2U A;  2D9U A;  1QZG A;  2ZTE A;  1X6O A;  2VQE Q;  3H91 A;  1G2T A;  1TWA H;  4LFC L;  4CDE C;  3HOV G;  1HNZ L;  2K4K A;  2L11 A;  2K32 A;  4LF6 L;  2C35 B;  4WJW A;  1SMY C;  2ENB A;  1G91 A;  3SK4 A;  1TWH B;  1WTW A;  2WB1 E;  5CBE E;  1I4H A;  3CAM A;  2IY5 B;  3C1F A;  4PZ6 A;  4JI3 L;  4DR7 Q;  5IGF A;  1LAC A;  4QIW B;  3X3M A;  1PZI D;  5C4Z A;  4EX5 A;  5ELC A;  1ZXT A;  4IAL A;  4C2M H;  1BOS A;  3GV3 A;  4YWM A;  4GNX B;  2NVT H;  4ME3 A;  4WJ4 A;  1O7I A;  1H9M A;  1XNQ Q;  2F4V Q;  3JAM E;  1HNX L;  5T1I A;  1VQO A;  2Z1C A;  2I5L X;  1QCB D;  1TKW B;  2CQO A;  2EY2 A;  3BVZ A;  3I4N B;  2XTI A;  1UUP A;  1SDF A;  2EJG C;  4DXF A;  1NR2 A;  2F3V A;  1W3S A;  1PZJ D;  4JI5 Q;  1M8A A;  4GOP C;  1WCM G;  3NQI A;  3S9W A;  4DR5 L;  4C3H H;  2UU9 Q;  1BXT A;  1UAP A;  1CA5 A;  5E4W C;  4DF7 A;  3PSI A;  2RF4 A;  3F2C A;  1D7Q A;  4LF6 Q;  2IL8 A;  4GOP A;  1L1O C;  2K52 A;  2FIN B;  2JN4 A;  4DNI A;  1C4Q A;  1Y14 B;  1I50 B;  1U5K A;  2EZV A;  3K5L A;  3CKI B;  4IUT A;  1NCV A;  5IGB A;  1L1O A;  4LF7 Q;  3K58 A;  3CPF A;  4JC0 A;  4IJL A;  1CFM A;  4CHT B;  4NP5 A;  2F0K A;  4TRD A;  1PH8 A;  4JI2 L;  1DCZ A;  1YNX A;  3P1H A;  2J0T D;  4NXN L;  4HED A;  3HP3 A;  2NBF A;  3S15 H;  2KCM A;  1C8C A;  4O0A A;  3C46 A;  1EY6 A;  2GA4 B;  3TME A;  1BVS A;  4XDX A;  5I6Y A;  1G6P A;  1D5X C;  1Q82 C;  5HY6 A;  3HOV H;  1D5M C;  2A6H C;  1PH4 A;  1IBL Q;  3AFP A;  3J7Z C;  4DR5 Q;  1CK1 A;  4HJ9 A;  1R9T H;  3HOX G;  1AZP A;  5BR8 L;  4XQN A;  4N8F A;  3RZO B;  1LTL A;  3TP7 A;  3CD6 A;  2CH4 A;  1MHW C;  3NEL A;  1S5D D;  3BZK A;  2EOT A;  4ILW A;  1VMC A;  4K0K L;  3K57 A;  3WDN A;  4TQU S;  3KOJ A;  3SDZ A;  4HN7 A;  2F0W A;  4FP5 D;  2ZJP A;  1I94 Q;  5KIX A;  1D1K A;  5IYD G;  2UXD L;  3LGJ A;  4FXD A;  3RN2 A;  2B2W C;  4EQP A;  3A56 A;  4CJ1 B;  3M3Y H;  1F77 A;  2RHS B;  3OWE B;  3NBH A;  1JQY D;  2RSN A;  2B3G A;  4A3J G;  4JI2 Q;  2XWJ B;  4OWW B;  2B2W A;  1MIU A;  2DNC A;  2L55 A;  1X65 A;  2NN6 G;  5BN3 A;  3I7F A;  4NXN Q;  2PZT A;  3LX0 A;  1GUO A;  3RUZ A;  3OHX C;  4LFA L;  5M5W B;  5G3L D;  2I5M X;  4OL7 A;  1GUN A;  1TVX A;  4Q0F A;  1WCM H;  1AH9 A;  4BBS G;  4J15 A;  1STB A;  4BBR G;  1ONL A;  3K80 C;  4IUU A;  1PRT C;  3ZJY C;  1GUG A;  5CMD A;  1B50 A;  2F0M A;  4NPS A;  1GOZ A;  5EKK A;  3KJO A;  4BXX G;  1VQI A;  3I4L A;  3L2P A;  1MGS A;  3DEO A;  3D0F A;  4PZ8 A;  3VYT A;  4IZ8 A;  4U67 3;  5GAG C;  5ELD A;  3OMG A;  3L3O C;  2UXD Q;  1ICW A;  1KC8 C;  1CQV A;  2R7Z B;  1ESR A;  3S1M B;  5FOB B;  1KAW A;  4L6T B;  1ESF A;  4KKT A;  1YNN D;  1QWY A;  4NKL A;  4DR2 Q;  1A6X A;  5EJW A;  3OTO Q;  3I56 A;  1Y1W G;  1WTH A;  2L15 A;  4FDB A;  3E0E A;  4EVO A;  3J80 i;  1VQK A;  1QVF A;  2IJ0 A;  3OIP A;  1FL0 A;  1ZKO A;  2FHT A;  2PQA A;  5IYB G;  3PIO 3;  5KNC A;  3MA2 B;  4GLV B;  4AYB B;  4DV6 L;  2KCC A;  1I4R A;  4ZRZ A;  4IPD A;  2NWG A;  3HOX H;  3T16 A;  4KHZ A;  3DM3 A;  1SNQ A;  4QGU A;  1YI2 A;  4JI4 L;  3MXG A;  2L0C A;  1HFG A;  5ELE A;  5LMN L;  3UDX A;  3J7A 5;  2JQO A;  1AFP A;  1U0L A;  4JV5 L;  4X65 Q;  4C3I B;  1WFQ A;  4NW2 A;  4RWS C;  1B70 B;  3Q6S A;  4IO9 A;  4UPA A;  1ILP A;  3C2P A;  1BBU A;  4DPG A;  1NMF A;  1LV9 A;  3BDL A;  4CJ2 C;  4FF3 A;  3NPP A;  5C4X B;  2FMC A;  2R7D A;  3D3R A;  1Q90 A;  3CMA A;  2NVY H;  1KDB A;  5BN4 A;  4Y7N B;  4P73 A;  3M4Y A;  1QJO A;  2QEJ C;  4A3J H;  3ITP A;  2K04 A;  2NN6 H;  2AQ3 B;  2WAQ B;  5M5Y H;  1TII D;  1XPU A;  3H0G G;  4RAU C;  4JYA L;  2VNU D;  3DMU A;  5M5X H;  3KBG A;  1GUT A;  3BVM A;  3HEJ A;  4ULL A;  3AMU A;  2PZU A;  4BBS H;  4R4Q A;  2VB3 X;  4DV6 Q;  3D4W A;  4BBR H;  2BOS A;  1PHJ A;  2NVX H;  1LLR D;  4DR1 L;  1MD2 D;  2EXD A;  3I91 A;  2Z9H A;  4QQB X;  3M4Q A;  4JI4 Q;  3X3N A;  1S4Z A;  5KEE A;  4BXX H;  2DJG C;  5LMN Q;  1TWC H;  1O7Z A;  1E22 A;  3OOC A;  1ML0 D;  1DGS A;  1X3P A;  3KLS A;  4JV5 Q;  1HR0 W;  2F0J A;  3DUZ A;  3P75 A;  2E2H B;  3K59 A;  3V05 A;  2E5L Q;  1AN8 A;  1UE7 A;  4X64 L;  3DHQ A;  4HAE A;  3UDG A;  3EBE A;  2A69 D;  1NR4 A;  4YY3 Q;  5EBC A;  3F1Z A;  1Y1W H;  3S14 H;  1S5C D;  3J80 c;  3F2B A;  1RJT A;  3HOW B;  4UP7 A;  1PH3 A;  1UE6 A;  3BZD B;  1LTA D;  1X3F A;  5IYB H;  4DK6 C;  5KYI A;  1TWA B;  4POG A;  2PO4 A;  2XWB B;  4BY7 G;  5LMU Q;  1EZ8 A;  1HNW Q;  2XSC A;  1HFN A;  3KF8 B;  1EU3 A;  3W1B A;  1DM0 B;  2BH8 A;  4Q5V A;  5E3F A;  3FEW X;  1Y8O B;  4FYD A;  1VQM A;  3R93 A;  5JEA J;  2A73 B;  1IXR A;  1B8A A;  5HUR A;  1D8L A;  1BDO A;  1CKM A;  3BJU A;  1Z47 A;  4ME5 A;  1CI3 M;  4C2M B;  1ET9 A;  4XYO A;  4KMU C;  2A1A A;  4KY7 A;  2NVT B;  5DM7 3;  2EE1 A;  1WOC A;  2OQK A;  4CKC A;  2WB1 G;  3A74 A;  1JOR A;  1Z7T A;  1YNJ D;  1PFM A;  4L5Q A;  3ERS X;  4MIU A;  4QUF A;  2MHV A;  1J9O A;  1RTO A;  3H0G H;  1OO9 B;  5FLX c;  1E7Z A;  3ICE A;  1Q12 A;  2R7Z G;  2DNE A;  3BZC A;  3T4A C;  2O4X A;  1QZH A;  4C3H B;  1KL9 A;  2SOB A;  1VF5 C;  1V1P A;  4V0B A;  4XQQ A;  2D5D A;  2QF7 A;  3H6M A;  4DUY L;  2UUA L;  5LL6 S;  3V96 A;  2QCP X;  1XMQ L;  5JJI A;  4CJ0 B;  3MEH A;  4H02 A;  2HUG A;  1JOK A;  2EYH A;  4JI1 Q;  1YHQ A;  2UUC Q;  5C3E G;  1X54 A;  2CW0 C;  1KAB A;  5FO8 B;  1L0W A;  1YHB A;  4EQ5 A;  2KEC A;  3BVG A;  3TS0 A;  4WRD A;  1Y1V G;  4A3K G;  1KRS A;  2A68 D;  1Z6H A;  1Q86 C;  1RDP D;  5C0X J;  2SNM A;  1II3 A;  3WOE A;  5IOD A;  5EPL A;  1STE A;  4P72 A;  1B1Z A;  3S15 B;  2RSO A;  1PTO C;  4PMC A;  1STA A;  3FPP A;  5IGE A;  4GKK Q;  4HMJ A;  1HHV A;  4ZK9 B;  1EY7 A;  4HCE A;  1E1T A;  3HOV B;  3BG3 A;  1R9T B;  3TBI B;  4BY7 H;  4B3R L;  1NE3 A;  2L1B A;  3K8A A;  4FF4 A;  3KLR A;  1VQH A;  1QVC A;  4JI8 L;  3VYR A;  4DK1 A;  1XJV A;  4CKB A;  1S3O A;  3NHH A;  1A3U A;  4N8X 1;  3J80 L;  4B3T L;  4KLK A;  1D5Z C;  4GOP B;  1XMQ Q;  2PQE A;  1YBY A;  2JSO A;  1KDC A;  1Y8P B;  5JJK A;  5M3M G;  4EGV A;  2E8G A;  3GTO H;  1Q1B A;  5IIF A;  1CA6 A;  1SMY D;  3CCM A;  4POF A;  2HIX A;  1I4X A;  1HZ9 A;  3M3Y B;  3ER0 A;  1W6J A;  1ENA A;  1RCV D;  2L9H A;  1VMP A;  1SYE A;  3IFD A;  2K5N A;  3I70 A;  4UY8 C;  3N6R A;  4BWG B;  2MPM A;  4LFB L;  1LTS D;  1PTO F;  1EY8 A;  1NUC A;  2CVR A;  3CCU A;  1DJR D;  1OXS C;  1NTG A;  2CH4 W;  1WCM B;  3UE0 A;  1J5E L;  3DWP A;  2HDM A;  3ULP A;  1I4G A;  4NB3 A;  2F0F A;  3M4O H;  4B3R Q;  1LO5 D;  4E6I A;  3HOW G;  3I72 A;  4M8A A;  3NEM A;  1NNX A;  4FNF A;  3J80 E;  3M85 A;  2KED A;  2HIV A;  3VR3 A;  1ROD A;  4DV0 L;  2E74 C;  2KOL A;  1Q8K A;  5FLX L;  5C3E H;  2LKV A;  5L37 A;  5JEA G;  5IWA L;  1XTD A;  1SJH D;  2EJM A;  3NXW A;  3DLL A;  4ID6 A;  1GXD C;  4YHH L;  3EQL C;  4A3M H;  1Y1V H;  4A3K H;  3K5M A;  2IPK D;  4IQZ A;  2JJQ A;  1JE4 A;  4X62 L;  3HOY H;  1OXU A;  5LL6 X;  1K8M A;  4G7Z C;  2EXZ A;  4FVM A;  4B08 A;  3NBH B;  1VQE A;  1KXL A;  2FMM A;  2I07 B;  3H09 A;  3GTM H;  5F2D A;  5EQ0 A;  1JE5 A;  4KV6 A;  2C5C A;  3UE1 A;  1J5E Q;  2M00 A;  3TP6 A;  1WJJ A;  4QY7 A;  3HKZ E;  3HOX B;  1OXT A;  3TEH B;  3TRZ A;  2E76 C;  4JI7 Q;  2EY5 A;  3W5O A;  2XN9 C;  2HDL A;  2XRS D;  5C4H A;  3TZD A;  2F0L A;  4MTK A;  5FLX E;  5M3M H;  2A6H D;  4HTH A;  1VQF A;  4KK7 A;  1PRT B;  3H3V C;  2IT1 A;  1UE5 A;  4A93 G;  4HID A;  3I55 A;  4QUC A;  1KLU D;  3GTQ H;  1PYS B;  4RGT A;  4R4T A;  2NVY B;  4AQY Q;  1K83 H;  2GVA A;  1SRU A;  2EYF A;  4A3J B;  4J6H A;  5M5Y B;  4X3T A;  2R92 G;  5C0X G;  5C3W A;  2R3Z A;  5HGQ A;  2ES2 A;  1IL8 A;  4UAI A;  4YCV A;  1K9M C;  2I5H A;  1VQ4 A;  5M5X B;  4P74 A;  3F2D A;  2BDN A;  4JI0 L;  1JWS D;  2PQA B;  4BBS B;  4O2D A;  4IFD I;  3IAY A;  2F0P A;  1Q1E A;  4BBR B;  1Q3L A;  1HUM A;  1B9N A;  1CUK A;  3S1Q H;  4X66 Q;  2NVX B;  3CXC A;  1G29 1;  3K0Y A;  4K8J A;  5ELB A;  1CKN A;  3W3A A;  4HSP A;  1Q8I A;  4U68 A;  2O2L D;  1P16 A;  2Z4I A;  1TWC B;  4DXG A;  2ZJQ A;  1WI5 A;  1G8Z D;  1TT2 A;  2PNR C;  4LMQ D;  5JEA H;  1JOQ A;  3RLO A;  1PRT D;  1IBK Q;  2F0N A;  4K5X A;  3FKI G;  1CT1 D;  1FNV A;  1A0I A;  2N78 A;  5JVG 3;  1P8L A;  1C48 A;  1V1Q A;  1VQD A;  4C3J G;  2JK8 A;  1SE3 A;  4EQN A;  1PZK D;  4B3M Q;  1S72 A;  1EOT A;  1Y1W B;  3S14 B;  5FO7 B;  4X3K A;  4XYQ A;  4LAA A;  4F7X A;  3H3V H;  2B63 G;  1EY9 A;  3J7A V;  1SXT A;  2P5Z X;  1HJP A;  2FXQ A;  4JI0 Q;  5C44 G;  5I2Y A;  3D31 A;  2YV5 A;  4ZQ3 A;  1RKN A;  2EY6 A;  1H9S A;  3O13 A;  3PIP A;  1X55 A;  2N8N A;  1R4Q B;  4A3E G;  2KQ3 A;  3CF5 A;  4KJO A;  2N49 A;  5CYU A;  1IYV A;  3EN2 A;  4LFC Q;  3OSO A;  1QVG A;  1HNZ Q;  5CV8 A;  3ZYY X;  3RR5 A;  4A93 H;  2UXC L;  1A15 A;  2EJF C;  1E2W A;  4PQX A;  1BCP C;  1DOK A;  4QL5 A;  4DKA C;  2NTS A;  1ASY A;  4DA2 A;  2PPB C;  4JI3 Q;  2CFM A;  2X6G A;  2R92 H;  1V1O A;  3S1R H;  3R2T A;  3H0G B;  1Z9F A;  2ICE C;  5C0X H;  1YEZ A;  1EYC A;  2CWP A;  3PGZ A;  2JA7 G;  1UEA B;  2Y0S E;  4RGN A;  1DD2 A;  1IL2 A;  4A3D G;  3T13 A;  4H7B A;  3MWY W;  2MNA A;  2NZH A;  3SEB A;  1HNX Q;  3NE5 B;  1I6V C;  3GTL H;  2ZM6 L;  3FP9 A;  4IUV A;  3PCO B;  4FXK C;  1FNU A;  5C5M A;  1EQQ A;  2UUB L;  4LW1 A;  1EUJ A;  3OMC A;  3S2H H;  1KHI A;  1VQJ A;  2MGS A;  1O78 A;  2Q2T A;  3CC7 A;  4FXG C;  3I4O A;  1RF2 D;  3T53 B;  3FKI H;  1T9H A;  5AJ3 L;  2NTT A;  2RHQ B;  1FGB D;  1SJE D;  1QG7 A;  4Y52 H;  1YZ6 A;  2IX0 A;  2PW5 A;  1SE2 A;  4C3J H;  2UXC Q;  1BCP F;  2XIW A;  1AE2 A;  1G6Z A;  3A55 A;  3KFU A;  2HHH L;  3PF5 A;  3AEV A;  2B63 H;  4TVA B;  4KD4 A;  1N33 L;  2LSS A;  2BA0 A;  2ASB A;  1S5F D;  2YTY A;  3PIO A;  1H95 A;  3QOJ A;  1PDQ A;  4G57 A;  4ALP A;  4LUO A;  5D65 A;  2D0P A;  1XNR L;  5C44 H;  4BY7 B;  4XTC S;  2KA7 A;  1HZC A;  3PO3 G;  3RD4 A;  2K05 A;  4IUN A;  2JA5 G;  1JWM D;  4HIK A;  4DV7 L;  1GM5 A;  1M4V A;  3A54 A;  3SGI A;  4F8M A;  2OTL A;  4CDC C;  2Z8L A;  2Q8R E;  4A3E H;  3JC6 6;  1J8I A;  3U4Z A;  3FMC A;  4K8I A;  1VQC A;  4YIJ A;  1C7Y A;  1FJG L;  2ZXP A;  4V19 0;  3V2T A;  2XRQ D;  3SK6 A;  3GTO B;  2Z6B A;  1VQ5 A;  5BR8 Q;  1AEX A;  2EIF A;  4A3F G;  2A8V A;  2WB1 B;  3NTI A;  4RFB A;  3GTG H;  2K50 A;  1JCK B;  4K0K Q;  2OT2 A;  5COY A;  2WKD A;  1ZEQ X;  3GD7 A;  1IBM L;  2N88 A;  4GKJ L;  5E1F A;  1EIF A;  4B9X A;  2JA7 H;  2K6A A;  1XMO L;  4X3S A;  2OTJ A;  3G7L A;  4A3D H;  2QDB A;  3DM1 A;  3SHL A;  3SK5 A;  3HOZ G;  3M4O B;  1SYC A;  1B53 A;  1F9S A;  1ICF B;  4S3S A;  5JOB A;  1XPO A;  4PMB A;  1KAA A;  4LFA Q;  1FNW A;  4A3B G;  4RHR A;  3DWQ A;  3T56 B;  5C3X A;  3ULL A;  3A8K E;  1B44 D;  5C3E B;  4OO1 I;  4GLX A;  4QF4 A;  1SBB B;  4A3M B;  3CME A;  1Y1V B;  3QJY A;  4A3K B;  1SYD A;  2F0G A;  1WTR A;  3DEP A;  3DXJ C;  3HOY B;  4OHJ A;  5GRO A;  2MO1 A;  3A7L A;  2F4I A;  3MXN A;  4IUP A;  3OW2 A;  1HTP A;  1VQG A;  2Q8I B;  2VUM G;  2E2D C;  4M1U B;  3NEN A;  3GTM B;  1TXY A;  2H5X A;  4IOC A;  4DV5 L;  4GKJ Q;  2VW9 A;  4DV1 L;  2CW0 D;  1QE6 A;  3BDO A;  5M9O A;  2EYM A;  3NSW A;  3A7A B;  5J39 A;  4B9W A;  1GUW A;  2JEA I;  3UDI A;  3PO3 H;  1I4Q A;  2SDF A;  2Q8T A;  2JA5 H;  2QEX A;  4K6D A;  1VQ6 A;  3M7N A;  2EDG A;  2PI2 A;  4HJ7 A;  4A3I G;  4DR6 L;  2B8G A;  4GNX C;  4KN7 C;  1STY A;  1PYB A;  2LS0 1;  1EY5 A;  5M3M B;  5CV7 A;  1B3Q A;  2RCF A;  3HKZ G;  2JA8 G;  4ZKC B;  1YIT A;  5IT9 c;  1PH6 A;  1C0A A;  2MP1 A;  3M7G A;  2G5D A;  2PMZ E;  4GNX A;  4A3F H;  3R8B A;  3G48 A;  3PUW A;  3GTQ B;  4YCW A;  2JYO A;  1U4P A;  5C5L A;  4JPB W;  3EJI A;  1K83 B;  3KYH C;  2Q2I A;  3KF6 B;  3E3X A;  3KLW A;  2QDL A;  3FVQ A;  2VS1 A;  5IGC A;  2N55 A;  4XXE A;  5FLM G;  2EQS A;  2FJ2 A;  4OX9 L;  3K5O A;  1N34 L;  3QB3 A;  4X3U A;  3D4D A;  2WII B;  4DV1 Q;  1K8O A;  4JBM A;  1IW7 C;  1HPC A;  1RTN A;  4K5V A;  4QMG A;  4KY6 A;  3TDQ A;  4HIM A;  3HOZ H;  3FRP B;  3S1Q B;  4OGQ C;  1WD1 A;  1DZ1 A;  4WJ3 M;  2K33 A;  4HIO A;  3SK8 A;  2K28 A;  1E2Z A;  2H1E A;  4RA8 A;  1LT6 D;  2TSS A;  2BE5 C;  4DR6 Q;  4TSS A;  3BU2 A;  4A3B H;  4JYA Q;  3T1H L;  5EGT A;  1CKO A;  3CC4 A;  4R4I A;  2K5W A;  3M4P A;  3VYU A;  4TKO B;  2YTV A;  3MHB A;  1SEB D;  4NXM L;  5GAE C;  2YTX A;  1HRJ A;  2ID0 A;  1LYL A;  4DR1 Q;  2E2I H;  1LTT D;  1EYD A;  4I7A A;  5D3D A;  1N36 L;  4KHP L;  1NMG A;  2QGQ A;  2VUM H;  4GN3 B;  1GO3 E;  1O80 A;  2IX1 A;  2M2L A;  2JP1 A;  2M9V A;  2B29 A;  2C9O A;  2ZXR A;  2BH2 A;  4OEL B;  1CTM A;  5KGU A;  4X64 Q;  2PW7 A;  3PUY A;  3STB C;  3MZ5 A;  4DGZ A;  1WTO A;  3MEF A;  4G7O C;  2YYZ A;  1SNP A;  4HCS A;  2DUD A;  3CW2 C;  3HGB A;  5ELO A;  4A3I H;  1SE8 A;  1YVC A;  2JA6 G;  3MTS A;  2XVS A;  1XX8 A;  4LF9 L;  4MTN A;  1CKN B;  3IRB A;  3MAQ A;  2JA8 H;  1EIG A;  3NQT A;  5K5P A;  4LNQ A;  1I3Q H;  1YHA A;  2D0O A;  4A93 B;  3VYS A;  1BUV T;  1SYB A;  2WP8 J;  3G6E A;  5IGG A;  2JXM B;  1BNZ A;  3BDC A;  1VQA A;  1EEI D;  3H94 A;  4YWK A;  4C1N K;  3L7Z C;  2K5V A;  1N32 L;  1LTB D;  5G3L F;  5EBD A;  3PV0 A;  1JB7 A;  3CQZ H;  1NAP A;  4KKU A;  4KHP Q;  3TZU A;  3HS0 C;  1SYF A;  2R92 B;  3S1R B;  1E2V A;  1B7Y B;  3OPO A;  5FLM H;  3N52 A;  2KBN A;  3R3O A;  3CCE A;  4Z9C B;  4A3M G;  1FVI A;  5CV9 A;  3ULJ A;  4DK0 A;  5IT9 L;  3NTH A;  1EFI D;  2RBM A;  1TWF H;  3HOY G;  1PMR A;  1B4O A;  4JOI C;  3GTL B;  2QKI C;  1B2T A;  1MBY A;  3EFX D;  2B2U C;  3J81 i;  2LY7 A;  5LMN W;  3GTP H;  1PH5 A;  3S2H B;  1H9S B;  2QIL A;  1VCI A;  2Y0S G;  4JOI A;  5DEH A;  4LF9 Q;  4IPC A;  5JAV A;  2HD3 A;  2B2U A;  1ET6 A;  4GN5 A;  2NB0 A;  3B6Y A;  2AWO A;  4KJN A;  1YJ9 A;  3T51 B;  3PF4 A;  1F9P A;  1B9M A;  1H9K A;  4DUZ L;  2V4D A;  3FKI B;  4DUY Q;  1STH A;  2UUA Q;  1S40 A;  1EYG A;  4RH6 A;  1DOL A;  1L2F A;  4C3J B;  3MXP A;  2OWO A;  3CP0 A;  4NDX A;  1T5E A;  1C9O A;  3SVM A;  1AP0 A;  1E3P A;  3TS2 A;  3EIV A;  2B63 B;  5CV4 A;  2JA9 A;  4PG3 A;  2ICI A;  2UXB L;  1UNS A;  1L1O B;  1WYD A;  5IT9 E;  5J1Z A;  1OXV A;  4MN3 A;  4LF5 L;  1PFN A;  2Z0S A;  5C44 B;  1K8A C;  1ENF A;  4DAV A;  2Q2H A;  5IY0 A;  2VL6 A;  1I4P A;  2LXJ A;  2VZA A;  4JI6 L;  3PO2 G;  3I2Z A;  4A3E B;  5KND A;  1LT4 D;  2JA6 H;  3S1N H;  4JBK A;  1K28 A;  5ISR A;  3FDT A;  3HOU G;  2PI2 E;  4RG1 A;  1Q46 A;  2V1C C;  2VQF L;  5H1S E;  1PTO H;  4JI8 Q;  2CKZ B;  5CBA E;  1CHP D;  4QIW E;  3GTG B;  2R6G A;  3RN5 A;  1N8R C;  2GN5 A;  4B3T Q;  3UDF A;  3S16 H;  2B2V C;  4A3G G;  1SR3 A;  5E7N A;  1EIH A;  2NYZ D;  4DNR B;  1GKH A;  1I6H H;  1K0S A;  2LFN A;  3CPW A;  4L63 B;  4IUR A;  1WTV A;  2JA7 B;  4A3D B;  1QNU A;  1G2S A;  2B2V A;  4ZUI A;  1TY2 A;  4UDU C;  4HMI A;  1BCP D;  3J81 c;  5DM6 3;  3FHW A;  1QUQ A;  4FO2 A;  1CSQ A;  4R8I A;  5D3I B;  3F8T A;  4KN4 C;  1WTQ A;  4LFB Q;  4RCN A;  5FO9 B;  1U4R A;  3K7U C;  2KCT A;  4DV2 L;  2F0E A;  3C1E A;  3G71 A;  4UP9 A;  1D6E C;  3UI2 A;  2QA4 A;  1TWG H;  1K8G A;  4LK1 C;  5IYC G;  1LAB A;  5DLQ E;  5A35 A;  2NN6 I;  3K81 C;  1X56 A;  4LF4 L;  2KEE A;  4ZCK A;  1PH2 A;  1BBW A;  1R4P B;  3NBI A;  2Z4H A;  5GAH C;  4GS3 A;  2E75 C;  4DV0 Q;  2K14 A;  3RZD H;  2WAC A;  1XWE A;  4LF8 L;  1EL0 A;  2O5I C;  5IWA Q;  1Q7Y C;  4R4O A;  1S5E D;  5GQO A;  4YHH Q;  3ERQ A;  2A6E C;  5M3F G;  2ZXO A;  3BYY B;  4H44 C;  4MNO A;  2R93 G;  4X62 Q;  2SEB D;  3PO3 B;  2KCN A;  2IW3 A;  4FF2 A;  1CM9 A;  2JA5 B;  2HCI A;  2L5T A;  2CHB D;  1GJX A;  4K5W A;  1BBX C;  3PO2 H;  4GLA C;  1F9Q A;  1PFB A;  5COR A;  2EY1 A;  2OF1 A;  3KJP A;  1EFW A;  2ATW A;  3T1Y L;  5K36 G;  3U9S A;  3HOU H;  3D6C A;  4IPG A;  1ZYR C;  5FK9 C;  3SE0 A;  3CCJ A;  5JPM C;  1QB5 D;  2R7F A;  5ELF A;  1TR5 A;  4A3F B;  4IPH A;  3AQQ A;  3S24 A;  4LF4 Q;  4HJ5 A;  1VQ7 A;  4PV1 C;  5CV6 A;  1HH2 P;  2RCN A;  2AQ2 B;  4CGY B;  1PH9 A;  1X3G A;  4A3G H;  3VR2 A;  1FYC A;  1HZA A;  1WTP A;  2SNS A;  3MXN B;  4BS9 A;  2E2J H;  5IE8 A;  1DOM A;  3ND9 A;  3AB9 A;  1CSP A;  1K3R A;  1MKH A;  1JJ2 A;  3S2D H;  3CRL C;  4ZAI A;  4RGO S;  4JI5 L;  1O7L A;  2F03 A;  3HOZ B;  1JOO A;  1GHJ A;  2CQA A;  4LWC A;  1SAP A;  3S17 H;  2UU9 L;  3IFT A;  1KNE A;  2PZW A;  5I2X A;  2RKS A;  1A3V A;  2F0Q A;  3I90 A;  5IYC H;  4A3B B;  2KHI A;  4AIM A;  5EAY A;  1DYQ A;  1LTR D;  4IOA A;  3T1Y Q;  3KBX A;  2WKC A;  1V8Q A;  1SFO H;  2F0D A;  1Q81 C;  3PUX A;  3QO2 A;  4BY1 G;  3W2D A;  1X3Q A;  3J81 L;  1SNM A;  1VQ8 A;  4LF7 L;  2E2I B;  1RL2 A;  4O42 A;  3KLS X;  4P2C B;  4IFD J;  1SSO A;  2VUM B;  1XXG A;  2F3I A;  5AFW A;  2X69 A;  5CV5 A;  3GTK H;  1E1O A;  2BDO A;  2F1M A;  4K2K A;  1IYJ B;  4OEM B;  1WTX A;  5M3F H;  1A8V A;  4JW0 A;  4A75 A;  3QIA A;  4ZKB B;  2NZO A;  2A74 C;  1HZB A;  4DU9 A;  2R93 H;  4ZUJ A;  3MFG A;  1IBL L; 
#chains in the Genus database with same CATH homology
 1JR0 D;  2F0I A;  1IKL A;  4A3I B;  3KUP A;  4CKE A;  5K36 H;  3HKZ B;  3VA7 A;  2JA8 B;  3E6Z X;  3G6J B;  4H13 C;  3RMH A;  1I3Q B;  3NUC A;  3TP8 A;  3J81 E;  1BQQ T;  4I65 A;  4IN3 A;  1TU2 B;  1ENC A;  3CQZ B;  1F2Y A;  2EYJ A;  1EEF D;  2OXP A;  2HCC A;  4H0L C;  1XTC D;  3L9A X;  1TWF B;  2F0V A;  1H9J A;  4C56 C;  2DY8 A;  1Y69 U;  4XQJ A;  3GTP B;  5J22 A;  3PIP 3;  2J7Z A;  2O5J C;  1U4M A;  4RKL A;  1EQV A;  3VR4 A;  1EYA A;  1KDA A;  3Q22 A;  1IW7 D;  2BCO A;  1TS4 A;  3NTK A;  1V1P B;  1GUS A;  5KYL A;  2BE5 D;  4HR7 B;  1HTL D;  2I46 A;  3GP7 A;  5KNB A;  3GQB A;  3OWF A;  1VDZ A;  1QOH A;  3NK9 A;  3CHB D;  5EPK A;  3R2I A;  1KLG D;  4EQO A;  3HZX A;  1A2T A;  1TS5 A;  5KRU A;  3RLF A;  3TP5 A;  3OW7 A;  1BO0 A;  2EVB A;  4KHV A;  1IYU A;  5CC4 A;  2JA6 B;  3S1N B;  4DAP A;  1HQM C;  1LTG D;  1EY4 A;  1HA6 A;  4BA1 I;  1F2M A;  2JE6 I;  3Q0A A;  5IGD A;  1FR3 A;  2WIN B;  3A8J E;  1PTO B;  1HXY D;  3F2U A;  4JBW A;  1Y8N B;  3PUZ A;  3S16 B;  3EA6 A;  4G4K A;  1STN A;  5E4X A;  2F0H A;  1SNC A;  2H4O A;  1I6H B;  1VF7 A;  2F3W A;  3GV6 A;  4IFD G;  5A2Q L;  1F2Z A;  3NP8 A;  1O7Y A;  2KHS A;  4MHE A;  3QWN A;  3Q23 A;  1FD7 D;  1EY0 A;  1SND A;  1JWU D;  4DAY A;  4FF1 A;  4OIJ A;  2Y0S B;  1PRT F;  1TWG B;  3CRK C;  3I73 A;  5TSS A;  1PYW D;  1DON A;  1XYI A;  3MVV A;  3EVQ A;  1B3A A;  3E0J A;  1PTO D;  3IL8 A;  2F0U A;  2AUK A;  3MFY A;  1NSN S;  4KD3 A;  1GHK A;  3RZD B;  3P7J A;  5A2Q E;  1E0B A;  2OEO A;  2MJ8 A;  3LWU A;  3ND8 A;  4IUQ A;  2FFK B;  1BR9 A;  1U4L A;  2RDG A;  5T1G A;  4XT1 B;  3PO2 B;  2RQX A;  2RVL A;  4K2L A;  3HRZ C;  3HOU B;  2JEB I;  2DN8 A;  5IOC A;  4QB4 A;  4F87 A;  3LWE A;  2RDH A;  3CU7 A;  1BF4 A;  3MXU A;  1SNO A;  2B2Y C;  4WFN 3;  5EKL A;  2D2C C;  1U9R A;  1H9R A;  1AZQ A;  3K5N A;  4A3G B;  2ZT9 C;  2B2Y A;  2E2J B;  3VR6 A;  4ABN A;  3NWS A;  1D2B A;  4NMZ A;  2K1B A;  4IFD H;  1CQF A;  2K5Q A;  5DNF A;  3S2D B;  2KVM A;  2RA4 A;  2NUC A;  3BS1 A;  3WOF A;  5LHY 1;  1LTI D;  3D6W A;  5DAU A;  3S17 B;  1ILQ A;  2K7V A;  2XNA C;  4PNY A;  4XT3 B;  4GZY C;  1EQT A;  4QCL A;  3AU7 A;  4R8N A;  1IHZ A;  3URY A;  2X6L A;  2A5H A;  4ZLT F;  1SFO B;  3IKJ A;  4WOR A;  2RDF A;  5C0X I;  3TN2 A;  1PLF A;  1LT5 D;  4L8J A;  4J1M A;  1AW7 A;  4KTA A;  4DFA A;  2G9H D;  1L0Y B;  2LMC B;  1TS2 A;  3MC0 B;  1YNN C;  5I9P A;  2D62 A;  2VB2 X;  4KKS A;  4J8Q A;  1CHQ D;  3GTK B;  4C1N I;  1A2U A;  3QG1 A;  1JC7 A;  5M3F B;  5C6A A;  2KJX A;  1F2L A;  3FPU B;  2R93 B;  4O1N A;  4BA2 I;  4PMW A;  1HQR D;  3KK7 A;  2K03 A;  5JPN C;  3J7A F;  2KUM A;  1EWC A;  5C4J B;  4R9W A;  2AQ1 B;  4RGM A;  2A6E D;  4K6L A;  3A8I E;  1WVL A;  1PXU A;  1MSH A;  3I8Z A;  1EZ6 A;  1QIL A;  3D4R A;  3PMF A;  4ZYS A;  1CZG A;  5I6W A;  2EYO A;  2PMZ B;  1ZYR D;  2L12 A;  2NZ1 D;  4C3I G;  2NVQ B;  3NWT A;  3HG9 A;  2B8F A;  2TMP A;  5HGT A;  2DY7 A;  3SR1 A;  4G7H C;  1CZW A;  4N9P A;  2B2T C;  1STG A;  1W6K A;  4OO1 G;  1BCP B;  3TSS A;  2B2T A;  1T5X D;  5CR3 A;  4RCO A;  1JIC A;  4RHS A;  1HUN A;  5I9O A;  4BY1 B;  2PCF B;  1RD9 D;  4K14 A;  4KY5 A;  1TQO A;  4DNT B;  2YU9 B;  2A69 C;  5EPJ A;  1KNA A;  1TS3 A;  3SXH A;  2WV6 D;  4HSV A;  3C3L A;  1HCZ A;  2F0T A;  3K7A B;  1S5B D;  1MSG A;  4XIG S;  2EYP A;  4F88 A;  2R61 A;  2PYK A;  3GO5 A;  3P20 A;  1X32 A;  3I4M B;  3K6O A;  1HA5 A;  5BN5 A;  1SE4 A;  4OIK A;  5D14 A;  1OXX K;  1EU4 A;  5CGK A;  2IX3 A;  3BYT B;  1WD0 A;  5JJZ A;  4LJZ C;  3ERO A;  2B39 A;  3VR5 A;  4I7Z C;  1YNJ C;  3ONA B;  3J7Y W;  2AUJ D;  3U9O A;  3GTJ B;  4DN4 M;  3PUV A;  1IKM A;  2VXW A;  2AWN A;  5JVH 3;  1TY0 A;  5FKA C;  1A3T A;  1DXM A;  1LT3 D;  2K01 A;  4OO1 H;  4KI0 A;  1MI2 A;  1EWH A;  4N9T A;  1D1I A;  3KF8 A;  4C3H G;  3LNN A;  1SYG A;  1JB3 A;  4JK1 C;  2J4X A;  2IWH A;  2A68 C;  1RHP A;  1F9R A;  2K5D A;  2G9D A;  3Q24 A;  5NUC A;  3OIQ A;  4RKB A;  4ODG A;  2F0S A;  1L0X B;  3DWA A;  2L4N A;  1QNK A;  3VA5 A;  5EKI A;  2EYL A;  3QOL A;  1KTK A;  2MUY A;  3JAM L;  3D8G A;  4CBV A;  2BA1 A;  2HQE A;  3I3C A;  5I4D A;  2F0O A;  3E5S A;  1V43 A;  2EPB A;  2D9U A;  3H91 A;  1G2T A;  2L11 A;  2K32 A;  4WJW A;  1SMY C;  2ENB A;  1G91 A;  3SK4 A;  1TWH B;  1WTW A;  5CBE E;  1I4H A;  3C1F A;  5IGF A;  1LAC A;  4QIW B;  3X3M A;  1PZI D;  5C4Z A;  5ELC A;  1ZXT A;  4IAL A;  1BOS A;  3GV3 A;  1H9M A;  3JAM E;  5T1I A;  2Z1C A;  1QCB D;  1TKW B;  2EY2 A;  3BVZ A;  3I4N B;  1UUP A;  4DXF A;  1SDF A;  2EJG C;  1NR2 A;  2F3V A;  1PZJ D;  1M8A A;  3NQI A;  3S9W A;  1BXT A;  1UAP A;  1CA5 A;  5E4W C;  4DF7 A;  2IL8 A;  2FIN B;  1C4Q A;  1I50 B;  2EZV A;  3K5L A;  3CKI B;  4IUT A;  1NCV A;  5IGB A;  3K58 A;  1CFM A;  4CHT B;  4NP5 A;  2F0K A;  4TRD A;  1DCZ A;  3P1H A;  2J0T D;  4HED A;  3HP3 A;  2NBF A;  1C8C A;  3C46 A;  1EY6 A;  2GA4 B;  3TME A;  4XDX A;  5I6Y A;  1D5X C;  1D5M C;  2A6H C;  1CK1 A;  1AZP A;  4XQN A;  3RZO B;  3TP7 A;  1S5D D;  2EOT A;  4ILW A;  1VMC A;  3K57 A;  3WDN A;  4TQU S;  3SDZ A;  4HN7 A;  2F0W A;  4FP5 D;  5KIX A;  1D1K A;  4FXD A;  2B2W C;  4EQP A;  3A56 A;  4CJ1 B;  1F77 A;  3OWE B;  3NBH A;  1JQY D;  2RSN A;  2XWJ B;  2B2W A;  2DNC A;  2L55 A;  2NN6 G;  5BN3 A;  2PZT A;  3LX0 A;  1GUO A;  3RUZ A;  3OHX C;  5M5W B;  5G3L D;  4OL7 A;  1GUN A;  1TVX A;  4Q0F A;  1STB A;  1ONL A;  4IUU A;  1PRT C;  1GUG A;  5CMD A;  1B50 A;  2F0M A;  1GOZ A;  5EKK A;  3I4L A;  1MGS A;  3DEO A;  3VYT A;  4IZ8 A;  4U67 3;  5ELD A;  3OMG A;  3L3O C;  1ICW A;  1CQV A;  2R7Z B;  1ESR A;  3S1M B;  5FOB B;  4L6T B;  1ESF A;  4KKT A;  1YNN D;  1QWY A;  4NKL A;  1A6X A;  5EJW A;  4EVO A;  2IJ0 A;  3OIP A;  2FHT A;  1ZKO A;  3PIO 3;  5KNC A;  3MA2 B;  4AYB B;  2KCC A;  1I4R A;  4ZRZ A;  2NWG A;  3T16 A;  4KHZ A;  1SNQ A;  3MXG A;  2L0C A;  1HFG A;  5ELE A;  1AFP A;  4C3I B;  4NW2 A;  4RWS C;  3Q6S A;  1ILP A;  3C2P A;  1LV9 A;  3BDL A;  4CJ2 C;  4FF3 A;  3NPP A;  5C4X B;  2FMC A;  3D3R A;  1Q90 A;  1KDB A;  5BN4 A;  4Y7N B;  3M4Y A;  1QJO A;  2QEJ C;  3ITP A;  2K04 A;  2NN6 H;  2AQ3 B;  2WAQ B;  1TII D;  4RAU C;  2VNU D;  3DMU A;  3KBG A;  1GUT A;  3BVM A;  3HEJ A;  4ULL A;  3AMU A;  2PZU A;  2VB3 X;  3D4W A;  2BOS A;  1LLR D;  1MD2 D;  3I91 A;  3X3N A;  1S4Z A;  5KEE A;  1O7Z A;  3OOC A;  1ML0 D;  1X3P A;  3KLS A;  2F0J A;  3DUZ A;  3P75 A;  2E2H B;  3K59 A;  3V05 A;  1AN8 A;  3DHQ A;  4HAE A;  2A69 D;  1NR4 A;  5EBC A;  1S5C D;  1RJT A;  3HOW B;  3BZD B;  1LTA D;  5KYI A;  1TWA B;  2PO4 A;  2XWB B;  1HFN A;  1EZ8 A;  2XSC A;  1EU3 A;  1DM0 B;  4Q5V A;  5E3F A;  3FEW X;  1Y8O B;  4FYD A;  3R93 A;  5JEA J;  2A73 B;  5HUR A;  1BDO A;  1Z47 A;  4ME5 A;  1CI3 M;  4C2M B;  1ET9 A;  4XYO A;  4KMU C;  4KY7 A;  2NVT B;  5DM7 3;  2EE1 A;  4CKC A;  1JOR A;  1Z7T A;  1YNJ D;  1PFM A;  4MIU A;  4QUF A;  2MHV A;  1J9O A;  1RTO A;  1OO9 B;  1Q12 A;  2DNE A;  3T4A C;  2O4X A;  4C3H B;  2SOB A;  1VF5 C;  1V1P A;  4V0B A;  4XQQ A;  2D5D A;  2QF7 A;  3H6M A;  5LL6 S;  3V96 A;  2QCP X;  4CJ0 B;  3MEH A;  2HUG A;  1JOK A;  2EYH A;  2CW0 C;  1KAB A;  5FO8 B;  2KEC A;  3BVG A;  4WRD A;  2A68 D;  1Z6H A;  1RDP D;  5C0X J;  2SNM A;  1II3 A;  3WOE A;  5IOD A;  5EPL A;  1STE A;  1B1Z A;  3S15 B;  2RSO A;  1PTO C;  4PMC A;  1STA A;  3FPP A;  5IGE A;  4HMJ A;  1HHV A;  4ZK9 B;  1EY7 A;  4HCE A;  3HOV B;  3BG3 A;  1R9T B;  3TBI B;  2L1B A;  4FF4 A;  3KLR A;  3VYR A;  4DK1 A;  4CKB A;  3NHH A;  1A3U A;  3J80 L;  1D5Z C;  2PQE A;  2JSO A;  1KDC A;  1Y8P B;  4EGV A;  1Q1B A;  5IIF A;  1CA6 A;  1SMY D;  1I4X A;  3M3Y B;  1W6J A;  1ENA A;  1RCV D;  2L9H A;  1VMP A;  1SYE A;  3IFD A;  3I70 A;  3N6R A;  4BWG B;  2MPM A;  1LTS D;  1PTO F;  1EY8 A;  1NUC A;  2CVR A;  1DJR D;  1OXS C;  1WCM B;  3DWP A;  2HDM A;  1I4G A;  2F0F A;  1LO5 D;  4E6I A;  3I72 A;  4M8A A;  4FNF A;  3J80 E;  3M85 A;  2KED A;  3VR3 A;  1ROD A;  2E74 C;  2KOL A;  5FLX L;  2LKV A;  5JEA G;  2EJM A;  1SJH D;  3NXW A;  4ID6 A;  1GXD C;  3EQL C;  3K5M A;  2IPK D;  4IQZ A;  1JE4 A;  1OXU A;  5LL6 X;  1K8M A;  4G7Z C;  2EXZ A;  4FVM A;  4B08 A;  2FMM A;  2I07 B;  3H09 A;  5F2D A;  5EQ0 A;  4KV6 A;  2C5C A;  2M00 A;  3TP6 A;  3HOX B;  1OXT A;  2E76 C;  2EY5 A;  2XN9 C;  2HDL A;  2XRS D;  5C4H A;  3TZD A;  2F0L A;  5FLX E;  2A6H D;  4HTH A;  4KK7 A;  1PRT B;  3H3V C;  2IT1 A;  4QUC A;  1KLU D;  4RGT A;  2NVY B;  2EYF A;  4A3J B;  4J6H A;  5M5Y B;  4X3T A;  5C0X G;  5C3W A;  2R3Z A;  1IL8 A;  4UAI A;  5M5X B;  2BDN A;  1JWS D;  4BBS B;  4IFD I;  3IAY A;  2F0P A;  1Q1E A;  4BBR B;  1Q3L A;  1HUM A;  1B9N A;  2NVX B;  1G29 1;  3K0Y A;  4K8J A;  5ELB A;  3W3A A;  4HSP A;  1Q8I A;  4U68 A;  2O2L D;  1TWC B;  2Z4I A;  4DXG A;  1G8Z D;  1TT2 A;  2PNR C;  4LMQ D;  5JEA H;  1JOQ A;  1PRT D;  2F0N A;  4K5X A;  1CT1 D;  1FNV A;  5JVG 3;  1C48 A;  4C3J G;  1SE3 A;  4EQN A;  1PZK D;  1EOT A;  1Y1W B;  3S14 B;  5FO7 B;  4X3K A;  4XYQ A;  4LAA A;  4F7X A;  1EY9 A;  3J7A V;  1SXT A;  5I2Y A;  3D31 A;  4ZQ3 A;  1RKN A;  2EY6 A;  1H9S A;  3O13 A;  1R4Q B;  2KQ3 A;  4KJO A;  5CYU A;  1IYV A;  3OSO A;  5CV8 A;  3ZYY X;  1A15 A;  2EJF C;  1E2W A;  4PQX A;  1BCP C;  1DOK A;  2NTS A;  2PPB C;  4DA2 A;  2X6G A;  1V1O A;  3R2T A;  3H0G B;  2ICE C;  5C0X H;  1EYC A;  1UEA B;  1DD2 A;  4RGN A;  3T13 A;  4H7B A;  3MWY W;  3SEB A;  3NE5 B;  1I6V C;  4IUV A;  4FXK C;  1FNU A;  5C5M A;  3OMC A;  2MGS A;  1O78 A;  4FXG C;  1RF2 D;  3T53 B;  2NTT A;  1FGB D;  1SJE D;  1QG7 A;  2IX0 A;  2PW5 A;  1SE2 A;  1BCP F;  2XIW A;  1G6Z A;  3A55 A;  4KD4 A;  2BA0 A;  1S5F D;  3QOJ A;  1PDQ A;  4G57 A;  5D65 A;  4BY7 B;  4XTC S;  2KA7 A;  3RD4 A;  2K05 A;  4IUN A;  1JWM D;  1M4V A;  3A54 A;  4F8M A;  2Z8L A;  2Q8R E;  1J8I A;  3FMC A;  4K8I A;  4YIJ A;  2ZXP A;  4V19 0;  3V2T A;  2XRQ D;  3SK6 A;  3GTO B;  1AEX A;  2WB1 B;  3NTI A;  4RFB A;  1JCK B;  2OT2 A;  5COY A;  2WKD A;  1ZEQ X;  3GD7 A;  2N88 A;  5E1F A;  4B9X A;  2K6A A;  4X3S A;  3G7L A;  2QDB A;  3DM1 A;  3SHL A;  3SK5 A;  3M4O B;  1SYC A;  5JOB A;  1B53 A;  1F9S A;  4S3S A;  4PMB A;  1KAA A;  1FNW A;  4RHR A;  3DWQ A;  3T56 B;  5C3X A;  3A8K E;  1B44 D;  5C3E B;  4OO1 I;  4QF4 A;  1SBB B;  4A3M B;  1Y1V B;  3QJY A;  4A3K B;  1SYD A;  2F0G A;  1WTR A;  3DEP A;  3DXJ C;  3HOY B;  4OHJ A;  3A7L A;  2F4I A;  3MXN A;  4IUP A;  1HTP A;  2Q8I B;  2E2D C;  4M1U B;  3GTM B;  2CW0 D;  1QE6 A;  3BDO A;  5M9O A;  2EYM A;  3NSW A;  3A7A B;  5J39 A;  4B9W A;  1GUW A;  2JEA I;  1I4Q A;  2SDF A;  2Q8T A;  4K6D A;  3M7N A;  2EDG A;  2B8G A;  4KN7 C;  1STY A;  2LS0 1;  1EY5 A;  5M3M B;  5CV7 A;  4ZKC B;  2MP1 A;  3M7G A;  3R8B A;  3PUW A;  3GTQ B;  2JYO A;  1U4P A;  5C5L A;  3EJI A;  1K83 B;  3FVQ A;  5IGC A;  2N55 A;  4XXE A;  2FJ2 A;  3K5O A;  3QB3 A;  4X3U A;  3D4D A;  2WII B;  1K8O A;  1IW7 C;  1HPC A;  1RTN A;  4K5V A;  4QMG A;  4KY6 A;  3TDQ A;  3FRP B;  3S1Q B;  4OGQ C;  1WD1 A;  1DZ1 A;  2K33 A;  3SK8 A;  2K28 A;  1E2Z A;  2H1E A;  4RA8 A;  1LT6 D;  2TSS A;  2BE5 C;  4TSS A;  5EGT A;  2K5W A;  3VYU A;  4TKO B;  3MHB A;  1SEB D;  1HRJ A;  2ID0 A;  1LTT D;  1EYD A;  5D3D A;  1O80 A;  2IX1 A;  2M2L A;  2JP1 A;  2M9V A;  2C9O A;  2ZXR A;  1CTM A;  5KGU A;  2PW7 A;  3PUY A;  3MZ5 A;  4DGZ A;  1WTO A;  4G7O C;  2YYZ A;  1SNP A;  4HCS A;  3HGB A;  3MTS A;  2XVS A;  1XX8 A;  3MAQ A;  1EIG A;  3NQT A;  5K5P A;  4A93 B;  3VYS A;  1BUV T;  1SYB A;  2WP8 J;  5IGG A;  2JXM B;  1BNZ A;  3BDC A;  1EEI D;  3H94 A;  4C1N K;  3L7Z C;  1LTB D;  5G3L F;  5EBD A;  3PV0 A;  4KKU A;  1NAP A;  3TZU A;  3HS0 C;  1SYF A;  2R92 B;  3S1R B;  1E2V A;  3OPO A;  3N52 A;  3R3O A;  4Z9C B;  5CV9 A;  4DK0 A;  5IT9 L;  3NTH A;  1EFI D;  2RBM A;  1PMR A;  1B4O A;  3GTL B;  2QKI C;  1B2T A;  1MBY A;  3EFX D;  2B2U C;  2LY7 A;  3S2H B;  1H9S B;  2QIL A;  1VCI A;  5DEH A;  5JAV A;  2B2U A;  1ET6 A;  2NB0 A;  2AWO A;  4KJN A;  3T51 B;  1F9P A;  1B9M A;  1H9K A;  2V4D A;  3FKI B;  1STH A;  4RH6 A;  1DOL A;  4C3J B;  3MXP A;  4NDX A;  1T5E A;  3SVM A;  1AP0 A;  2B63 B;  5CV4 A;  2ICI A;  1UNS A;  5IT9 E;  5J1Z A;  1OXV A;  4MN3 A;  1PFN A;  5C44 B;  1ENF A;  4DAV A;  1I4P A;  4A3E B;  5KND A;  1LT4 D;  5ISR A;  3FDT A;  1PTO H;  5CBA E;  1CHP D;  3GTG B;  2R6G A;  2B2V C;  1EIH A;  2NYZ D;  4DNR B;  2LFN A;  4L63 B;  4IUR A;  1WTV A;  2JA7 B;  4A3D B;  1QNU A;  1G2S A;  2B2V A;  4ZUI A;  1TY2 A;  4UDU C;  4HMI A;  1BCP D;  5DM6 3;  4FO2 A;  4R8I A;  5D3I B;  4KN4 C;  1WTQ A;  4RCN A;  5FO9 B;  1U4R A;  2F0E A;  3C1E A;  1D6E C;  3UI2 A;  4LK1 C;  1LAB A;  5A35 A;  2NN6 I;  2KEE A;  1R4P B;  3NBI A;  2Z4H A;  2E75 C;  1EL0 A;  2WAC A;  1XWE A;  2O5I C;  1S5E D;  3ERQ A;  2A6E C;  2ZXO A;  3BYY B;  4H44 C;  2SEB D;  3PO3 B;  2KCN A;  2IW3 A;  4FF2 A;  1CM9 A;  2JA5 B;  2HCI A;  2L5T A;  2CHB D;  1GJX A;  4K5W A;  1BBX C;  1F9Q A;  1PFB A;  5COR A;  2EY1 A;  2OF1 A;  5K36 G;  3U9S A;  3D6C A;  1ZYR C;  5FK9 C;  3SE0 A;  5JPM C;  1QB5 D;  5ELF A;  1TR5 A;  4A3F B;  4PV1 C;  5CV6 A;  2AQ2 B;  4CGY B;  3VR2 A;  1FYC A;  1WTP A;  2SNS A;  4BS9 A;  1DOM A;  3ND9 A;  3AB9 A;  3CRL C;  4ZAI A;  4RGO S;  1O7L A;  2F03 A;  3HOZ B;  1JOO A;  1GHJ A;  2CQA A;  1SAP A;  3IFT A;  1KNE A;  2PZW A;  5I2X A;  2RKS A;  1A3V A;  2F0Q A;  3I90 A;  4A3B B;  1DYQ A;  1LTR D;  3KBX A;  2WKC A;  1V8Q A;  2F0D A;  3PUX A;  3QO2 A;  3W2D A;  1X3Q A;  3J81 L;  1SNM A;  2E2I B;  4O42 A;  3KLS X;  4P2C B;  4IFD J;  1SSO A;  2VUM B;  1XXG A;  5AFW A;  2X69 A;  5CV5 A;  2BDO A;  2F1M A;  4K2K A;  1WTX A;  3QIA A;  4ZKB B;  2A74 C;  4DU9 A;  4ZUJ A;  3MFG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...