1KABA

Stress and strain in staphylococcal nuclease
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYGPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Stress and strain in staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
total genus 41
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1992-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1kabA00
1EY9A 1F2YA 1SNDA 4NP5A 1EQVA 1EZ6A 4EVOA 1A2UA 5CR3A 1JOOA 5C3XA 1EY6A 1ENCA 1STGA 2KHSA 4KV6A 5DAUA 2KQ3A 5NUCA 5KRUA 2F0OA 5J39A 2ENBA 4KHVA 5KGUA 5CV9A 5I6WA 4HMIA 4WRDA 3PMFA 4YIJA 4ZUJA 5C5LA 3D8GA 1IHZA 5IGDA 2HQEA 1STNA 3MHBA 3DMUA 5IIFA 3QOLA 4NKLA 1SYCA 1A2TA 4DF7A 1SYBA 3R3OA 4ZQ3A 2M00A 4K5XA 1EY4A 4KJNA 1NUCA 1SNPA 4H7BA 5C3WA 3QOJA 4KY7A 5JOBA 2F0EA 4PNYA 2F3WA 5I9PA 5I9OA 4K8IA 4KY6A 3V2TA 3LX0A 5C6AA 3SXHA 3TMEA 2OXPA 2PW7A 5J22A 4G57A 4F7XA 4DFAA 1U9RA 2PQEA 4HMJA 4IALA 3SK4A 4KY5A 2EY5A 1EY8A 3D4WA 1STBA 3D4DA 4KTAA 2EY1A 4K2KA 4E6IA 2F0GA 5C4ZA 1SYEA 3EVQA 1EZ8A 2EYFA 3QB3A 5DEHA 5IGCA 3HEJA 1SYGA 3P75A 5E1FA 3ITPA 5F2DA 3SK6A 5ISRA 3EJIA 3NK9A 2F0VA 3NUCA 3NP8A 1TR5A 1SYFA 3EROA 5C5MA 3SK5A 1JOQA 1SNMA 1SNCA 2LKVA 1EY7A 2SNSA 5KEEA 4K5VA 1JORA 2F0KA 2PYKA 2F0TA 4K6DA 3P1HA 2O4XA 2F3VA 2QDBA 3TP5A 1KABA 1A3VA 1KDAA 1STYA 1F2ZA 2EYLA 3DHQA 4K5WA 4RKBA 5EKLA 1SNQA 4OL7A 3OWFA 3TP7A 2F0UA 1EYAA 5CV8A 3BDCA 4EQNA 3T16A 4B9WA 3T13A 4PMBA 5CV4A 1EYCA 1KDCA 4R8NA 4N9PA 3SR1A 4QB4A 4MIUA 4F8MA 3VA5A 1RKNA 4N9TA 4NMZA 5HURA 1STHA 4J1MA 3MEHA 4RKLA 5EGTA 5IGFA 1EY5A 1SYDA 3E5SA 4J6HA 4QF4A 3OSOA 2F0MA 4ZUIA 4PMCA 5C4HA 5M9OA 4B9XA 5KYLA 5E3FA 1SNOA 2PZWA 3SK8A 4QMGA 1A3UA 5IOCA 1AEXA 1NSNS 2F0FA 1TQOA 1TT2A 2F0JA 2F0HA 3C1FA 2F0IA 2EY2A 3TP6A 5CV6A 5CV7A 5CC4A 4DU9A 2OEOA 4S3SA 4KJOA 4KD3A 4ODGA 4ID6A 2RKSA 4ME5A 2EXZA 4HTHA 3D6CA 2RDFA 3ERQA 3U9OA 2EYHA 2EYOA 3BDLA 3NQTA 4K14A 2PZTA 5CV5A 3MXPA 2EY6A 2F0SA 4I65A 5EKKA 5CGKA 4IUNA 4EQPA 4DGZA 4TRDA 2OF1A 4K8JA 2PW5A 4NDXA 2NUCA 2PZUA 4LAAA 3OMCA 5IGGA 2F0PA 2F0NA 3H6MA 3HZXA 1EYDA 1KDBA 1STAA 4EQOA 5K5PA 5HGTA 1II3A 3NXWA 3MVVA 2F0QA 3RUZA 2EYJA 2F0WA 3TP8A 3S9WA 1A3TA 2F0DA 3MZ5A 2WACA 4KD4A 1F2MA 4K2LA 1ENAA 2F0LA 2EYPA 1EY0A 2EYMA 5J1ZA 5IGBA 1JOKA 4IZ8A 5KIXA 1KAAA 2RBMA 5JAVA 4WORA 3OMGA 5IGEA 5IODA 5KYIA 3SHLA 3NHHA 2SOBA 3C1EA 5I6YA 2SNMA
chains in the Genus database with same CATH superfamily
1EY9A 1IBML 1LM0A 2ZXPA 4DV5L 1VQ4A 4HSVA 2E2IH 1S5ED 1JICA 3M85A 2EJMA 2MFIA 2KHSA 5DAUA 2E2JH 3V05A 4L5SA 1E1TA 3J7ZC 5JJLA 3TN2A 4N8FA 3CQZH 5C5LA 3JAML 5M5XH 3I4NH 3DWQA 3X3NA 5L37A 1LTRD 1Y1VB 1MKHA 3FPPA 2L15A 2YYZA 1MJCA 3J81E 2WB1G 4KY7A 4JBKA 4KY6A 4BWGB 1TWAB 3M4OH 2PW7A 3DM1A 2NVQB 1Y1WG 1X55A 5IYDG 2UUCL 3F8TA 1XNRQ 5C0XH 4R4TA 2JA7B 4ZAIA 1QG7A 1YHBA 3ULLA 1EEID 1SROA 2F0VA 4OX9L 2IX1A 1SNCA 4U673 3TZUA 3S1NB 1A6XA 4A3KB 3QR8A 1CK1A 2VB2X 3Q22A 5JVH3 3J80i 3TP5A 1XMOL 2HDLA 1WTXA 4WJWA 4C3JH 2IX0A 2EDGA 2VL6A 1WCMG 2VNUD 4O0AA 4DR5Q 2L9HA 3ULJA 4A3EB 4AYBB 1Z7TA 2PQAA 2VQFL 2MUYA 2OT2A 4HIDA 1G6ZA 3G7LA 4A3JG 1PHJA 4ILWA 2JA5B 4X65L 2BCOA 2B63G 1BBWA 1VQKA 3KF8A 3Q8DA 2F0FA 2HCCA 2EY2A 3IL8A 5CV6A 2Z6KC 2OEOA 4G7OC 3AEVA 2RKSA 4UPAA 4ZCKA 3ERQA 3TEHB 2BH8A 1PTOH 4K14A 2EY6A 2F0SA 5IT9L 3RZOH 4DAYB 4BXXH 3IAYA 2ICEC 4ZRZA 3HFZB 4K8JA 1IBLL 2AQ3B 2VW9A 1YIJA 4IOCA 2UUAL 1ZYRC 3H6MA 2E74C 4A3GB 1ESFA 3F1ZA 3MZ5A 4OELB 4IFDI 2WINB 4HJAA 2OQ0A 3IRBA 3PUVA 3PUZA 3HOVG 2KCCA 4AH6A 1SDFA 1N9WA 1M1KC 3MXGA 5I6YA 4WFN3 2Y0SG 3HG9A 5EQ0A 4DV6Q 1EWCA 2F3IA 1WTHA 2FMMA 2ATWA 2XN9C 2RDHA 3E6ZX 2O2LD 4C3IB 3D6WA 1JCKB 2VUMH 1HRJA 5DLQE 4WRDA 5LMNQ 2WKDA 1SEBD 3PO3G 1OXSC 4DXFA 3A54A 2RVLA 1MSHA 4HJ9A 1KTKA 3RZDH 4DN4M 3FEWX 1RODA 2K4KA 2F3WA 5I9OA 3V2TA 2DY8A 1HXYD 1GUNA 3H0GH 2OCEA 3R93A 1K3RA 4IPDA 1VQ5A 2UXCL 1GUGA 1WI5A 4YCUA 3NQIA 4P75A 1CZGA 4WJ3M 5DM73 1BO0A 3GTMB 2B2TC 4F88A 4LF7Q 4ZKBB 4X66Q 1CKNA 3HOUB 4IUPA 3FHWA 5I2XA 5IP9H 4LWCA 2AQ2B 4KHZA 3KF6B 1JC7A 1L1OB 2EYLA 1KC8C 4OL7A 2PPBC 4JI5Q 1IYJB 3BJUA 2FXQA 3I91A 5ELNA 3S15H 3K5LA 5HURA 1JB7A 3ERSX 3PV0A 5CORA 2A5HA 5C4HA 2ZJRA 3CPFA 4IPGA 4XDXA 5M3FH 1JJGA 4X3KA 1LT3D 3K0XA 5I2YA 1TT2A 1EEFD 1SJHD 1G291 3PSIA 1PYWD 2J7ZA 1L2FA 4A3BB 2JA6B 1Q7YC 2EYHA 1S4ZA 2J4XA 1K8MA 1SBBB 4TRDA 4FYDA 2UUBQ 1V8QA 2I46A 1KXLA 5C0XJ 2VY3A 1X3PA 4JOIA 3J81L 4EQOA 1KHIA 3W1BA 2B2UC 4DV7L 3KLWA 1Y1VG 2F0DA 2L11A 1E2WA 2WACA 2R7ZH 4K6LA 3A56A 3A7AB 4JI7Q 1O7YA 2Z1CA 5C4XH 4CHTB 5IP7H 3CXCA 1STEA 1KL9A 2RBMA 2I5HA 3K80C 3SEBA 1OXXK 4JI4Q 1YNJC 4EQ5A 1AE2A 4JI0L 5KNCA 1RJTA 3RLFA 2JA7G 1JOOA 3M3YB 3BVMA 3MFGA 4HR7B 1CHQD 2PMZE 2A68D 2EXDA 2WB1E 3LWUA 1LT5D 1VQJA 4A3FG 1C48A 2EQSA 4HCSA 1PTOC 4TSSA 4DUZQ 1CSQA 3CHBD 3CU7A 1JWMD 2L55A 4DR6L 4IJLA 2H1EA 3JAMc 1VQGA 1HH2P 2A6HD 1RIPA 1VQPA 4IFDH 4FXGC 3KJPA 1LTID 1HUMA 3FMCA 3QOJA 1N32Q 4GKKL 5JPNC 5J3BA 4A3EG 2BH2A 4AYBG 3J7AV 4BBSB 1XNQQ 3CC2A 1DXMA 2F0GA 2KHIA 2JA5G 1TY0A 3CMAA 2PNRC 2QCPX 2M2LA 1PFSA 4POFA 1X3GA 3TQYA 5C3EG 1NCVA 4YY3L 3HP3A 1CZWA 2YTXA 3NBHB 5FJ8H 4DR7L 1TS3A 1ILPA 4R1JA 1VMCA 4A3MB 4CKEA 4AQYQ 4LF9L 3Q24A 1SMYD 5EKLA 3GTLH 3PUXA 1LTGD 3VYRA 2LMCB 4A3GG 1RL2A 4A3CG 4HJ5A 2UXBL 2RCNA 4GKJQ 1V9PA 4YHHQ 5GROA 1EIYB 4QF4A 3VYSA 1NR4A 3S1QH 4GLXA 4B9XA 3U50C 1E1OA 1GO3E 1KIXA 3RN5A 2CCZA 1B8AA 1VDZA 1ILQA 3A74A 3I72A 4JI1L 2RHSB 1LTTD 2AUJD 5HY6A 4A3IH 1X56A 4EX5A 3MXUA 4JW0A 2OF1A 5IT9c 2Z9HA 3HKSA 1V1PB 4NXNL 1JJCB 5ELFA 4H13C 2Y0SE 4GNXB 1PTOF 3U4ZA 2EYMA 3CCEA 1VQFA 3PO2H 5JJIA 1IYVA 5JVG3 1I6HH 2SNMA 1F2YA 1K0RA 1D2BA 4DV2Q 3VR2A 4DK0A 1KD1C 1H9KA 2JA8H 3BVGA 1ENCA 4L63B 3CRLC 4RFBA 4FF1A 4YIJA 1PH8A 1PV4A 1GVPA 3D0FA 1UUPA 3QOLA 1BDOA 1NMGA 4DF7A 3R3OA 4JI3Q 3E9IA 4C3HH 5JOBA 4GLAC 1G2SA 3S16B 4F87A 4HAEA 2L1BA 4A75A 4APVA 1U9RA 4JOIC 2F52A 2EY5A 3L7ZC 1Y1WH 3D4DA 4X62Q 3T53B 1EZ8A 2C9OA 3K7AH 3TS0A 5LMUL 4IUTA 4FP5D 1RTNA 3J80c 2K50A 5C5MA 1DONA 4A3BG 4DR2Q 2JA6G 1PFNA 4KKTA 1FL0A 4K6DA 2NN6G 1PH1A 2ZTCA 5FK9C 2ZXOA 3I70A 2KEDA 4CJ0B 4BBRB 2LFNA 1F2LA 4QQBX 1YNND 2EJGC 3CMEA 1E3PA 4NW2A 1FVIA 1WCMH 4CJ1B 1BCPD 1RKNA 4N9TA 1ICFB 3A5UA 5IWAQ 2K5WA 2MJ8A 2F0MA 4BY7B 4DR4Q 1DJRD 4IFDJ 1VS0A 3GTKB 2F0JA 1HFGA 3RN2A 3TP6A 4JYAL 4DU9A 4KJOA 1QB5D 3D6CA 3HOXB 4WJ4A 1RHPA 1WTRA 2PZTA 3JAME 2NVYB 4I65A 4RAUC 2BDNA 3BZKA 2MP1A 1LTSD 3I7FA 4GOPA 4LAAA 2F0PA 1PZJD 3J81c 3NXWA 1QWYA 1XTDA 4KN4C 1PH2A 2K7VA 4OWTB 3L2PA 1JWUD 2ASBA 1PRTB 4LK1C 2O5JC 1D6EC 1HQMC 5KIXA 3Q6SA 2N49A 1D5XC 1MGSA 4BBSG 3NHHA 1FD7D 2OTLA 2XNAC 1Q46A 1JQYD 1EFID 4U68A 4FXKC 1QE6A 4HMIA 1XPRA 2QGQA 4GZYC 1LACA 4H02A 2RSOA 4HJ7A 5IGDA 1STNA 4AYBE 2HDMA 1BQQT 5IYBG 3AFPA 1ICWA 1I4GA 4RG1A 4JV5L 2A68C 2EE1A 4G57A 1XTCD 4DR1L 3SGIA 3D4WA 2ICIA 4BS9A 1B70B 4UHVA 1S72A 4LF4L 5IGCA 1ET9A 3PIPA 3AB9A 4DV5Q 1LTBD 3QJYA 1WD1A 3CCLA 3KDFA 1M4VA 2NZOA 1LTLA 2L0CA 3URYA 1N34L 1J6QA 4BY1H 5IT9E 2XVSA 1PA6A 4JI2L 5M3MH 2E2HB 1X3FA 4JVZA 2N78A 4O1NA 3E3XA 1HR0W 2FJ2A 1QUQB 3QO2A 1E22A 1ESRA 4B3SL 4BA1I 1Q1EA 4K5WA 1HNXL 1W6KA 1HNZL 4PMBA 1H9JA 1KDCA 1UEAB 3SR1A 1HZ9A 3GTPH 1LO5D 3M7GA 4CKCA 3MEHA 2Z4HA 3MC0B 4CDCC 5FLMG 2A8VA 2A74C 2NZ1D 1I50H 5KYLA 2PZWA 5EPKA 2I07B 1A3UA 1EOVA 5DM63 3GTJH 1CA5A 3GTGH 1D8LA 4JBJA 5AJ3L 4B3TL 5CC4A 4OX9Q 3J7A5 4S3SA 5A2QE 4B3ML 3BYYB 1HHVA 4QIWB 4DV3L 2JA9A 4KHPL 3HOYH 3K5NA 1OTCA 1M90C 5ELOA 1EYDA 1JMCA 5HGTA 1K8GA 2A19A 2RCFA 4DV4L 4HIOA 2VQFQ 3B6YA 2KUMA 1PDQA 4P74A 5JAVA 3I3CA 3FKIB 1YHAA 5H1SE 4X65Q 3J7YW 3J80E 5EPJA 1TWHH 3GTQH 4DAPA 2L5TA 2A69D 4LFCQ 4KV6A 3UDFA 2K1BA 2KEEA 1IW7C 4N8X1 4B3RQ 1I3QB 5J39A 2ENBA 1IL8A 5I6WA 4FVMA 4A3FH 3TS2A 3KBGA 2NTSA 1IBLQ 3HOZH 2DJFC 5C4JH 1VQNA 2RDGA 1N33Q 2UUAQ 2R93G 4BBRG 3F2UA 2M00A 1WTVA 4H7BA 4C2MB 2SDFA 2LXJA 4GOPC 2XIWA 4F7XA 2JN4A 4LFBQ 1BR9A 4IJHA 4BY7G 1KAWA 2UU9Q 3WOEA 1T5EA 4UDUC 2LS01 5E1FA 3HRZC 2B2VA 3N52A 4XQJA 2ZM6Q 2M9VA 3NUCA 4LF8L 2K5QA 2EOTA 5C3EH 3KFUA 4CKBA 1TKWB 1AN8A 1VQIA 2VQEQ 2CWAA 2NTTA 5CV8A 4UP8A 4JI8L 1CM9A 4PG3A 4M8AA 1K83B 5M5WH 3H91A 3D3RA 1XJVA 1UAPA 4P72A 3I4OA 3I4MH 2R92B 1DOKA 1Q8IA 1M8AA 1LABA 2HQLA 4TKOB 1EIGA 3VDYA 3OHXC 2B2UA 5IOCA 1TQOA 1R9TB 3S1RB 5GAEC 5CV7A 4A93G 3V96A 4A3DG 2A6ED 3L9AX 3UI2A 1NJIC 2O5IC 4ME5A 2RDFA 3S2DH 2EYOA 2JYOA 3DWPA 4XXEA 1BBUA 5G3LD 1IL2A 3OW2A 4XQQA 3K7UC 1SFOH 2Z8LA 4JI6Q 3OWEB 3ICEA 4DV0Q 1FNVA 4QUFA 3MAQA 2NVXB 2IHEA 1JOKA 4UP7A 1MHWC 1X3QA 3L3OC 2AMCB 3AU7A 1TWFH 1X9NA 3DXJC 5KNBA 3F2DA 3I2ZA 1CQVA 4XT3B 1B3AA 1U0LA 3R2TA 5C3XA 2GA4B 1I4QA 2E2IB 3I55A 3M7NA 1MJEA 3K8AA 2F0OA 5IYCG 4FF4A 2E2JB 1YVCA 2CVRA 4XYQA 3CQZB 3RNUA 5M5XB 1EWIA 1UE5A 3I4NB 1A2TA 1L0XB 2FHTA 4DV7Q 3I56A 4ZQ3A 2R7FA 1VMPA 1PMRA 5M5YH 2F0EA 3T56B 3G6JB 3OYYA 5J22A 2OQKA 1VQ7A 3OIQA 3C46A 3S1MH 3M4OB 1OXUA 2EIFA 2ID0A 3C3LA 4KK7A 4LF6Q 5A2QL 4C56C 3NPPA 3HGBA 3SK6A 3H3VI 3EJIA 3SK5A 4RGNA 4A3LG 1HCZA 4OEMB 5ELCA 4K5VA 1G6PA 1F9PA 2IX3A 2NZHA 4DR6Q 2K5DA 1Q90A 2CW0C 1SNQA 3KUPA 2K28A 4B9WA 2F4IA 4QL5A 5C44H 1E2ZA 1EYCA 1BCPF 4C3JB 4R8NA 4I7AA 4QB4A 2Q2TA 1PLFA 2QEJC 4RKLA 1GHJA 3J80L 4FDBA 4LFAL 2MGSA 2JSOA 4YCWA 3FKIG 4OXPA 3H09A 1Y8PB 5CBAE 2G9HD 2WP8J 2K03A 4RGMA 3BYTB 4DPGA 3I73A 5K36H 2PQAB 4MTNA 1XNRL 2N3SA 3QIAA 2NB0A 3HOWH 2I0QA 2IL8A 2RSNA 2ZT9C 4LF9Q 1PTOB 2PW5A 5LMNW 1FJGQ 3RZOB 3KF8B 2B2VC 3CF5A 5AFWA 5EJWA 1XX8A 2WAQB 4PMWA 3A0JA 3R2IA 4MZ9A 1IKMA 1TWCH 2SEBD 1SJED 4WORA 1P16A 5EAYA 4A76A 2K01A 3KLRA 1SNDA 5GAGC 1GJXA 2X6GA 5CR3A 3G71A 2KVMA 3BZDB 2B3GA 2OWOA 2IT1A 1VQCA 3CP0A 3EQLC 2VUMB 5FO9B 4O2DA 1LUZA 3PUWA 2LSSA 4DK1A 2BOSA 2C35B 1GUTA 3I90A 3J81j 2DGYA 3RZDB 4UAIA 1HZAA 1VQMA 2OXPA 1E2VA 4Y7NH 4HMJA 1CA6A 2R92G 1PH3A 1RD9D 3H0GB 4HCEA 1OO9B 5D3DA 3HEJA 3TREA 1GKHA 3BZCA 3S17H 1D1IA 3PIP3 4RCOA 3JC66 3NK9A 2HHHQ 1TR5A 1A8VA 1SNMA 4A3KG 1WTPA 1IBKQ 5GQOA 3MFYA 1UE1A 1XXGA 2PYKA 4K0KQ 4DV6L 3P1HA 1Q1BA 1UE7A 3TRZA 2QDBA 1KRSA 1JJ2A 4RKBA 1F2ZA 1I94Q 5GAHC 1H9SA 3NTIA 4EQNA 5LMNL 1X32A 4JK1C 1K0SA 3VYUA 1WFQA 1E0BA 1TWGH 1CKNB 1ASYA 3NWSA 1DZ1A 1S40A 3GTOH 1VQ6A 5D65A 2DJGC 1NTGA 3W5OA 3S15B 1WOCA 5D3IB 1WVLA 2VS1A 3OOCA 3H3VH 1MBYA 1H9RA 5LMUQ 1GHKA 1B7YB 5M3FB 4GN5A 1G2TA 3CKIB 4XYOA 1BOSA 2Z6BA 2YU9H 1G51A 2CKZB 4JBWA 3KYHC 5EKKA 1PRTD 2MNAA 2D0OA 4LF7L 2F1MA 2XRSD 4X66L 3KK7A 3OMCA 5DNFA 4NPSA 1Y8NB 3I4NG 2EYJA 3M9BA 3S9WA 2E75C 4K2LA 1CHPD 1JE4A 1R4PB 1HTLD 3F2CA 2A6EC 5J1ZA 4ZKCB 2R7ZB 1W3SA 3K81C 1EYGA 3DWAA 1YZ6A 2RA4A 2FFKB 2KECA 3CCMA 3AYHB 2ZJQA 5C4XB 3AFQA 4Z9CB 2A1AA 1N8RC 4HEDA 1LT4D 1YJWA 3A5ZB 5I4DA 4NP5A 4JBMA 4C3IG 1A2UA 4JC0A 4LUZA 4A4IA 5C0XG 3CC4A 1XPUA 2KQ3A 4YCVA 2CFMA 3KLSX 1SR3A 3GO5A 2R3ZA 5A35A 2L4NA 2KENA 4R4OA 4C1NK 4ZK9B 2R93H 4PQXA 4OO1G 4RGOS 1OXVA 3GV6A 4GS3A 1R4QB 4C3JG 2R7DA 3S2HH 4DFAA 2HCIA 4XTCS 4KY5A 4RMFA 1O7ZA 4QIWE 4H44C 1SYGA 3A55A 1J5EL 1VQEA 3HOUG 1SYFA 3K6OA 2JEAI 2QILA 1B9MA 4JCVE 2LKVA 5IE8A 3U4VA 3OTOL 1ZEQX 2BA1A 2F3VA 1A3VA 4FXDA 3CAMA 2YV5A 3TP7A 2KCNA 3F2BA 2UXDQ 4BXXG 2AWOA 2F0UA 4M1UB 4LNQA 3BDCA 4L6TB 4DUZL 1XMQQ 2PI2E 3K5OA 3M4QA 3GTLB 2WAQG 2IY5B 3MEFA 2Z0SA 2XWBB 2KCMA 3MXNA 4L5TA 4OWXB 3T1YQ 5IYDH 4JV5Q 5EGTA 1LT6D 2EJFC 3X3MA 1PH4A 1Q12A 1RTOA 1VQ9A 4X3TA 3S1QB 3S24A 5JEAG 1XNQL 1TS2A 2E5LL 4A93H 1WTWA 4KD3A 1B50A 4A3DH 3U9OA 2JXMB 5D14A 5G3LF 1FNUA 4A3IB 1PVOA 4B3SQ 2VUMG 5IGGA 5CYUA 2QF7A 1HNZQ 3RUZA 2L12A 3PF4A 1A63A 4FNFA 1VQLA 3BVZA 1Q86C 2QW7A 2E8GA 4A3JH 3NBIA 2D5DA 2B63H 1V1QA 2V1CC 5EKIA 1WD0A 4G7HC 1HPCA 2EZVA 3PO2B 5IODA 4X64L 1KLUD 1UWVA 4YHHL 1D1KA 3H3VC 3K5MA 3R8BA 1JB3A 4IOAA 1CKMA 3PQIA 2KHJA 5AJ3Q 4B3TQ 1I6HB 1BBXC 1F9RA 1YJ9A 4B3MQ 1C9OA 2JA8B 1HNWL 4DV3Q 3QG1A 3NTHA 1U4MA 4UY8C 1Q81C 2AKWB 5HGQA 3NEMA 2MO0A 2YTVA 2C5CA 1DM0B 3WOFA 1DOMA 5IP9G 1GUWA 4KJNA 1LLRD 4K5XA 2F4VL 3HOVH 4K8IA 4DV4Q 4MN3A 4C3HB 1I4RA 3SXHA 3PIO3 3P7JA 5FO7B 1EOTA 2R61A 4LF5Q 1EY8A 2WV6D 1RCVD 3EVQA 1QVCA 4LW1A 5DEHA 2K6AA 1Y1WB 4IN3A 3S14H 3VR4A 3K7AB 1G8ZD 1YJNA 1ZYRD 1JOQA 3EROA 1FGUA 4A3MG 3PO3H 4A3LH 2XSCA 2SNSA 3D4RA 5ELEA 1DD2A 4QCLA 1U4PA 1TS4A 2K33A 3STBD 1STYA 1Q3LA 4JG2A 1N36L 2HIXA 3T16A 1YI2A 1Y69U 4DUYQ 5CV4A 4F8MA 2PI2A 3VA5A 2PNHA 2A73B 2K5NA 4JI3L 1WCMB 1IBMQ 2A6HC 1C0AA 1C7YA 3ONAB 4X3SA 3GDEA 1PH7A 2CH4W 3C1FA 2F0IA 5BN4A 3DUZA 4LUVA 2N55A 4X62L 2K75A 4ID6A 4LF8Q 1FGBD 5CGKA 2K32A 2K5VA 3KJOA 3Q0AA 1PZID 4DGZA 3OPOA 4NXML 2JE6I 3PUYA 3W3AA 1X65A 4DR2L 3KLSA 4JI8Q 1F2MA 1F9QA 2EYPA 1PH5A 4IFDG 2VB3X 2UUCQ 1YITA 2KOLA 4PV1C 1SMYC 1FR3A 3OMGA 1HUNA 4CDDC 3EIVA 5KYIA 3JAMi 4ODGA 3PCOB 2QEXA 4KI0A 5IWAL 1U5KA 2LXKA 1EZ6A 3EN2A 1WTQA 1STGA 4GLVB 4DR4L 1XMOQ 4J8QA 1Y1VH 5FJ8G 4LUOA 1O7IA 1I4PA 4CGYB 4POGA 2V4DA 5EBCA 3CPWA 1AP0A 1E24A 1EY4A 5C3WA 4CDFC 1TWAH 4HIKA 3T51B 1CSPA 3DM3A 1JT8A 4YWMA 2XTIA 2NVQH 5BR8L 4XIGS 3SK4A 4CBVA 1H9MA 4JPBW 3CCSA 2EY1A 2JA7H 2HT1A 3ITPA 2G9DA 5FLXc 1IZ6A 1PYBA 3D31A 3S1NH 1QOHA 2WAQE 3SDZA 1KNEA 1ZXTA 4A3KH 3I4LA 1HR0L 4BY1B 1A0IA 1HZBA 2DNCA 2D0PA 2NN6I 2Q2IA 2Q8IB 5M3MB 3ULPA 4A3IG 1JR0D 1KABA 3DHQA 1P8LA 3MA2B 5LHY1 1MSGA 1Z6HA 3KDFB 4A3EH 1YNJD 1B9NA 5JJZA 2Q8RE 4J1MA 4QGUA 4GN4B 3E5SA 3GTPB 3O13A 2JA5H 2NVTB 4PMCA 1SXTA 3UDGA 4MHEA 4DAYA 2B2YA 3PO2G 1I50B 2F0HA 1I4XA 1D5MC 3HOXG 3GTJB 3H15A 3GTGB 4X3UA 4GN3B 2CQAA 3T1HL 1TVXA 1PRTF 5CV5A 2JA8G 2D9UA 3A8IE 1TS5A 1EWHA 2NUCA 2PZUA 4RHRA 1NBWA 3HOYB 4A3GH 2JJQA 4A3CH 1PXUA 2H4OA 2WFWA 4DV1L 1HFNA 4QJFA 3GV3A 1A3TA 4KD4A 5ELDA 1QJOA 1MIUA 3BU2A 1KRTA 2B8GA 1EQTA 2UXCQ 3FDTA 3NE5B 5IGBA 4OGQC 4C3HG 1WYDA 3SVMA 4LFAQ 2G5DA 3TBIB 1U4LA 1YNNC 3C1EA 5LL6X 1TXYA 1EQVA 3NENA 1BCPC 1DGSA 1PFBA 2AQ1B 1TWHB 4C3IH 3GTQB 1U4RA 2MO1A 1CT1D 1VCIA 4DXGA 2B39A 4FF3A 1S5DD 3EFXD 4A3FB 2ES2A 3IFTA 1PH6A 3HOZB 5C4JB 4KLKA 1CUKA 4OO1H 3NWTA 3LX0A 1S5BD 1K9MC 3KBXA 1IYUA 4K2KA 4V190 1SYEA 2ZXRA 3QWNA 3GTMH 3HKZB 3KF6A 4ALPA 1L1OA 3U9SA 2KA7A 5C6AA 3NP8A 3HOUH 1Q82C 1BUVT 3T4AC 2IJ0A 1WTOA 2PCFB 1EY7A 5LL6S 3G4SA 1SLJA 2F0KA 4R4QA 5FO8B 5C3EB 1YHQA 1QNKA 4LFCL 4DR3L 3E0EA 4B3RL 2JP1A 3PIOA 3CCUA 1F9SA 1B53A 3C2PA 4AIMA 3E0JA 4ZYSA 2J0TD 2JK8A 5COYA 3PF5A 2X6LA 1N33L 4MIUA 5M5WB 4JI0Q 5KNDA 3I4MB 3MTSA 4MTKA 1SNOA 3SK8A 1B3QA 3STBC 2EPBA 3DEPA 1AEXA 1AZPA 4A3BH 3J81i 2JA6H 1HTPA 4LFBL 3NELA 4P73A 5JEAH 2HUGA 3FP9A 2NN6H 4IQZA 2HIVA 2UU9L 1L0YB 3NQTA 3NSWA 2ZM6L 3S2DB 3CC7A 2VZAA 3EBEA 3N6RA 1QVGA 4B08A 4GKKQ 1LTAD 1EUJA 1PH9A 1KDBA 1UNSA 5FKAC 1GM5A 1SFOB 1X54A 1KQSA 4TQUS 1CFMA 2VQEL 2JQOA 3VYTA 4Y52H 1BKBA 5E4WC 2VXWA 1GUSA 1KAAA 1FNWA 1CQFA 4R9WA 3SHLA 3M4YA 4YY3Q 5FLXE 4DA2A 3M3YH 4YWKA 1HA5A 1TWFB 2WKCA 4DR7Q 2CHBD 4CDEC 1EU3A 2GVBA 5E4XA 3ER0A 3IKJA 2OTJA 4G4KA 1GXDC 2ZTDA 3W2DA 3K59A 2B2YC 2CWPA 3PMFA 3BS1A 2QDLA 1IHZA 4KMUC 2AWNA 1SE4A 2HQEA 4BY1G 3VR3A 1EQQA 4DK3C 1EIHA 5M3MG 2UXBQ 1X6OA 5CMDA 1NUCA 3CCJA 1XWEA 2K5HA 2B29A 5E7NA 4DR5L 2LY7A 4RA8A 4JI6L 1NE3A 4HSPA 3TMEA 4BBSH 1K28A 5M5YB 1QZGA 3TDQA 3NBHA 4DV0L 1Z9FA 1C8CA 4JI1Q 5C4ZA 3QB3A 3S1MB 1ML0D 1H95A 1KLGD 1VF5C 1K8OA 1NY4A 4L5QA 2IW3A 1A62A 1GUOA 4A3MH 2XWJB 4NXNQ 5FOBB 5IYBH 1PYSB 1V1OA 1S5FD 1KDAA 3CRKC 4QY7A 2A69C 1D7QA 1S3OA 3HOYG 3BDOA 3KOJA 3LGJA 3T13A 3CCQA 4R4IA 3CW2C 4N9PA 5TSSA 4DAMA 3WDNA 5C44B 1T5XD 2QA4A 4NMZA 3CCRA 4OIKA 4J6HA 3OSOA 1QILA 3L0OA 4LMQD 3FRPB 1X3EA 4Q5VA 1NSNS 1V1PA 3ND9A 2IWHA 1ONLA 1Q8KA 1J5EQ 3AMUA 5T1GA 3VA7A 2E2DC 2K14A 2EXZA 2R6GA 1SRUA 3GP7A 3TSSA 4DK6C 5M9OA 4GNXA 3U58A 4LF6L 2QKIC 3K58A 3TZDA 3OTOQ 1BNZA 2BE5D 3HOWB 5JPMC 3MWYW 4NDXA 1L1OC 4RCNA 1B44D 1SSOA 4KN7C 3HZXA 1I5FA 3HOZG 3OW7A 1HJPA 4ME3A 3TP8A 5FLMH 1PZKD 1EY0A 1VQHA 4IZ8A 1G91A 1TWCB 1ZKOA 4YWLA 2NBFA 5BN3A 2SOBA 2FMCA 1HQRD 1HZCA 2RF4A 1O78A 4EVOA 2WIIB 3HKZG 2Q8TA 3RLOA 2E5LQ 1O7LA 1NNXA 1MI2A 1VQ8A 2Z4IA 2P5ZX 3RR5A 1Z47A 2B2WA 3DEOA 1CKOA 2Q2UA 1VQDA 4ZUJA 3D8GA 4IUUA 2NYZD 5T1IA 3UE0A 1S5CD 4I7ZC 1SYCA 1VQBA 2CQOA 3H94A 5JEAJ 4JI5L 2BDOA 1SNPA 1VQOA 1W2BA 1FJGL 3S16H 2ZJPA 1VQAA 2D62A 4DKAC 4IALA 1STBA 4Y7NB 4X64Q 4QUCA 4JYAQ 2H5XA 3I4MG 2EYFA 5CBEE 2AHOB 1A15A 2XGTA 1SE3A 5ISRA 4IUVA 4RHSA 3S17B 4L8JA 1HNWQ 1I6VC 4ZLTF 2EVBA 4RGTA 1W6JA 3G48A 4P71A 4BBRH 2O4XA 2MPMA 2UUBL 4H0LC 2TMPA 1T9HA 2F4VQ 1AH9A 3VR5A 5EPLA 2ZTEA 1EFWA 4JI7L 2RHQB 1STHA 1TWGB 4BY7H 1EY5A 1SYDA 3UDIA 4ZUIA 1IW7D 5FLXL 3GTOB 1ENFA 1DCZA 3GTKH 4JI4L 1H9SB 2I5LX 3CCVA 3CD6A 2KJXA 1B1ZA 3PGZA 3HOXH 2IPKD 4CJ2C 2NVYH 4HTHA 1JWSD 3FVQA 2YU9B 1V43A 5IY0A 2HHHL 1MD2D 1IBKL 1BVSA 1B2TA 2F0NA 1TU2B 1K8AC 4K0KL 1STAA 1N36Q 2DUDA 3MVVA 4OIJA 3E9HA 4P2CB 4DR1Q 1N32L 1ENAA 2F0LA 1I94L 4LF4Q 4IPCA 1IXRA 1LYLA 2XRQD 1J8IA 1TIID 4IO9A 3UDXA 3HS0C 3ND8A 3SE0A 3K57A 1N34Q 1SAPA 4X6AH 1QCBD 4JI2Q 2HD3A 1EY6A 1IKLA 3GD7A 5NUCA 2ALYB 5KGUA 1EQRA 1HNXQ 4HIMA 3G6EA 4AQYL 4NXMQ 1FYCA 4J15A 4NKLA 4IUQA 1SYBA 4R8IA 3VR6A 2PO4A 4DNRB 2R93B 2Q2HA 4GNXC 2KCTA 4PNYA 5I9PA 1QNUA 4GKJL 3H0GG 5C44G 1UE6A 5ELBA 4MNOA 4IPHA 1RDPD 3S2HB 1EIFA 5KEEA 3DLLA 3ZJYC 1WJJA 1QUQA 5IYCH 4KHPQ 2DY7A 2E2HH 1EU4A 4ABNA 3UE1A 1JORA 2F0TA 2N8NA 1HA6A 5K36G 2K52A 1Y8OB 4HJ8A 2NWGA 3HOWG 3FPUB 4DNIA 1EYAA 2PMZB 4Q0FA 5BN5A 1Y14B 2WB1B 4PZ7A 5JJKA 2B2WC 3RD4A 5BR8Q 3IFDA 1DYQA 4HN7A 2F03A 1SMXA 1UEBA 5M3FG 5E3FA 1XYIA 1K3BC 2I5MX 4DV2L 2GN5A 4OWWB 1TY2A 3MXNB 4OHJA 2X69A 3OIPA 2IHFA 1AZQA 3BDLA 4A93B 3MXPA 1HR0Q 4A3DB 2E76C 4XQNA 5GADC 2YTYA 1D5ZC 1DOLA 1NMFA 1J9OA 1II3A 2F0QA 2R7ZG 1YEZA 3WWVA 3HKZE 5IP7G 5C4XG 2UXDL 2GVAA 4O42A 3A8KE 2DNEA 2FINB 3FKIH 1XMQL 4FF2A 2MQHA 4A3JB 2BE5C 5IGEA 3T1YL 2B63B 4ULLA 1KNAA 4TVAB 4KKUA 3W1GA 4XT1B 2CW0D 1C4QA 1I3QH 2DN8A 5C0XI 2CH4A 1B4OA 3T1HQ 4EGVA 5KRUA 4KHVA 5CV9A 3Q23A 1RF2D 3MHBA 3DMUA 5IIFA 4DV1Q 4IURA 4PZ6A 4C2MH 2RQXA 4OONA 1JE5A 4GOPB 4DNTB 4OO1I 1YNXA 1PRTC 1BXTA 2Z6KA 1K73C 3HOVB 2PQEA 4RWSC 4KTAA 4BA2I 1L0WA 4E6IA 3RLNA 2NVTH 1GD7A 3J7AF 2Y0SB 1QZHA 4UP9A 1QVFA 3P75A 5F2DA 2MHVA 1NAPA 2B8FA 1NR2A 4FO2A 3ZYYX 3S14B 1AFPA 2JEBI 2KBNA 3A7LA 1OXTA 3GQBA 1PFMA 4DAVA 4KKSA 5EBDA 1GOZA 4R4CA 3PO3B 3EA6A 3M4PA 3RMHA 2K05A 4RH6A 4L5RC 3OWFA 2TSSA 1K83H 1VF7A 1EL0A 2BA0A 4NB3A 2R92H 2AUKA 2N88A 1F77A 1SN8A 1O80A 3BG3A 1CTMA 5IGFA 4G7ZC 1R9TH 1AE3A 4QMGA 3S1RH 4LJZC 3AQQA 3A8JE 4LF5L 1BCPB 1YBYA 3LNNA 4IUNA 4EQPA 3K0YA 4DR3Q 2D2CC 1ET6A 1AW7A 1XPOA 5K5PA 1I4HA 1SE2A 4PZ8A 3NTKA 2F0WA 1E7ZA 2NVXH 1CI3M 1SE8A 2B2TA 1ASZA 1PTOD 1BF4A 3LWEA 3P20A 4DUYL 2K04A 4V0BA 1LV9A 3I8ZA 4C1NI
chains in the Genus database with same CATH topology
1EY9A 2ZXPA 4HSVA 1S5ED 1JICA 3M85A 2EJMA 2KHSA 5DAUA 3V05A 3TN2A 5C5LA 3JAML 3DWQA 3X3NA 1LTRD 1Y1VB 3FPPA 2YYZA 3J81E 4KY7A 4KY6A 4BWGB 1TWAB 2PW7A 3DM1A 2NVQB 5C0XH 2JA7B 4ZAIA 1QG7A 1EEID 2F0VA 2IX1A 1SNCA 4U673 3TZUA 3S1NB 1A6XA 4A3KB 1CK1A 2VB2X 3Q22A 5JVH3 3TP5A 2HDLA 1WTXA 4WJWA 2IX0A 2EDGA 2VNUD 2L9HA 4A3EB 4AYBB 1Z7TA 2MUYA 2OT2A 1G6ZA 3G7LA 4ILWA 2JA5B 2BCOA 3KF8A 2F0FA 2HCCA 2EY2A 3IL8A 5CV6A 2OEOA 4G7OC 2RKSA 3ERQA 1PTOH 4K14A 2EY6A 2F0SA 5IT9L 3IAYA 2ICEC 4ZRZA 4K8JA 2AQ3B 1ZYRC 3H6MA 2E74C 4A3GB 1ESFA 3MZ5A 4IFDI 2WINB 3PUVA 3PUZA 2KCCA 1SDFA 3MXGA 5I6YA 4WFN3 3HG9A 5EQ0A 1EWCA 2FMMA 2XN9C 2RDHA 3E6ZX 2O2LD 4C3IB 3D6WA 1JCKB 1HRJA 4WRDA 2WKDA 1SEBD 1OXSC 4DXFA 3A54A 2RVLA 1MSHA 1KTKA 4DN4M 3FEWX 1RODA 2F3WA 5I9OA 3V2TA 2DY8A 1HXYD 1GUNA 3R93A 1GUGA 3NQIA 1CZGA 5DM73 1BO0A 3GTMB 2B2TC 4F88A 4ZKBB 3HOUB 4IUPA 5I2XA 2AQ2B 4KHZA 1JC7A 2EYLA 4OL7A 2PPBC 3I91A 3K5LA 5HURA 3PV0A 5CORA 2A5HA 5C4HA 4XDXA 4X3KA 1LT3D 5I2YA 1TT2A 1EEFD 1SJHD 1G291 1PYWD 2J7ZA 4A3BB 2JA6B 2EYHA 1S4ZA 2J4XA 1K8MA 1SBBB 4TRDA 4FYDA 1V8QA 2I46A 5C0XJ 1X3PA 3J81L 4EQOA 2B2UC 2F0DA 2L11A 1E2WA 2WACA 4K6LA 3A56A 3A7AB 1O7YA 2Z1CA 4CHTB 1STEA 2RBMA 3SEBA 1OXXK 1YNJC 5KNCA 1RJTA 3RLFA 1JOOA 3M3YB 3BVMA 3MFGA 4HR7B 1CHQD 2A68D 3LWUA 1LT5D 1C48A 4HCSA 1PTOC 4TSSA 3CHBD 3CU7A 1JWMD 2L55A 2H1EA 2A6HD 4IFDH 4FXGC 1LTID 1HUMA 3FMCA 3QOJA 5JPNC 3J7AV 4BBSB 1DXMA 2F0GA 1TY0A 2PNRC 2QCPX 2M2LA 1NCVA 3HP3A 1CZWA 1TS3A 1ILPA 1VMCA 4A3MB 4CKEA 3Q24A 1SMYD 5EKLA 3PUXA 1LTGD 3VYRA 2LMCB 4QF4A 3VYSA 1NR4A 4B9XA 1VDZA 1ILQA 3I72A 1LTTD 2AUJD 3MXUA 2OF1A 1V1PB 5ELFA 4H13C 1PTOF 2EYMA 1IYVA 5JVG3 1D2BA 2SNMA 1F2YA 3VR2A 4DK0A 1H9KA 3BVGA 1ENCA 4L63B 3CRLC 4RFBA 4FF1A 4YIJA 1UUPA 3QOLA 1BDOA 4DF7A 3R3OA 5JOBA 1G2SA 3S16B 4F87A 4HAEA 2L1BA 1U9RA 3L7ZC 2EY5A 3D4DA 3T53B 1EZ8A 2C9OA 4IUTA 4FP5D 1RTNA 5C5MA 1DONA 1PFNA 4KKTA 4K6DA 2NN6G 5FK9C 2ZXOA 3I70A 2KEDA 4CJ0B 4BBRB 2LFNA 1F2LA 1YNND 2EJGC 4NW2A 4CJ1B 1BCPD 1RKNA 4N9TA 2K5WA 2MJ8A 2F0MA 4BY7B 1DJRD 4IFDJ 3GTKB 2F0JA 1HFGA 3TP6A 4DU9A 4KJOA 1QB5D 3D6CA 3HOXB 1RHPA 1WTRA 2PZTA 3JAME 2NVYB 4I65A 4RAUC 2BDNA 2MP1A 1LTSD 4LAAA 2F0PA 1PZJD 3NXWA 1QWYA 4KN4C 2K7VA 1JWUD 1PRTB 4LK1C 2O5JC 1D6EC 1HQMC 5KIXA 3Q6SA 1D5XC 1MGSA 3NHHA 1FD7D 2XNAC 1JQYD 1EFID 4U68A 4FXKC 1QE6A 4HMIA 4GZYC 1LACA 2RSOA 5IGDA 1STNA 2HDMA 1BQQT 1ICWA 1I4GA 2A68C 2EE1A 4G57A 1XTCD 3D4WA 2ICIA 4BS9A 5IGCA 1ET9A 3AB9A 1LTBD 3QJYA 1WD1A 1M4VA 2L0CA 3URYA 5IT9E 2XVSA 2E2HB 4O1NA 2FJ2A 3QO2A 1ESRA 4BA1I 1Q1EA 4K5WA 1W6KA 4PMBA 1H9JA 1KDCA 1UEAB 3SR1A 1LO5D 3M7GA 4CKCA 3MEHA 2Z4HA 3MC0B 2A74C 2NZ1D 5KYLA 2PZWA 5EPKA 2I07B 1A3UA 5DM63 1CA5A 5CC4A 4S3SA 5A2QE 3BYYB 1HHVA 4QIWB 3K5NA 1EYDA 5HGTA 2KUMA 1PDQA 5JAVA 3I3CA 3FKIB 3J7YW 3J80E 5EPJA 4DAPA 2L5TA 2A69D 4KV6A 2K1BA 2KEEA 1IW7C 1I3QB 5J39A 2ENBA 1IL8A 5I6WA 4FVMA 3KBGA 2NTSA 2RDGA 3F2UA 2M00A 1WTVA 4H7BA 4C2MB 2SDFA 2XIWA 4F7XA 1BR9A 3WOEA 1T5EA 4UDUC 2LS01 5E1FA 3HRZC 2B2VA 3N52A 4XQJA 2M9VA 3NUCA 2K5QA 2EOTA 4CKBA 1TKWB 1AN8A 2NTTA 5CV8A 1CM9A 4M8AA 1K83B 3H91A 3D3RA 1UAPA 2R92B 1DOKA 1Q8IA 1M8AA 1LABA 4TKOB 1EIGA 3OHXC 2B2UA 5IOCA 1TQOA 1R9TB 3S1RB 5CV7A 3V96A 2A6ED 3L9AX 3UI2A 2O5IC 4ME5A 2RDFA 2EYOA 2JYOA 3DWPA 4XXEA 5G3LD 4XQQA 2Z8LA 3OWEB 1FNVA 4QUFA 3MAQA 2NVXB 1JOKA 1X3QA 3L3OC 3AU7A 3DXJC 5KNBA 1CQVA 4XT3B 1B3AA 3R2TA 5C3XA 2GA4B 1I4QA 2E2IB 3M7NA 2F0OA 4FF4A 2E2JB 2CVRA 4XYQA 3CQZB 5M5XB 3I4NB 1A2TA 1L0XB 2FHTA 4ZQ3A 1VMPA 1PMRA 2F0EA 3T56B 3G6JB 5J22A 3OIQA 3C46A 3M4OB 1OXUA 2ID0A 3C3LA 4KK7A 5A2QL 4C56C 3NPPA 3HGBA 3SK6A 3EJIA 3SK5A 4RGNA 1HCZA 5ELCA 4K5VA 1F9PA 2IX3A 2K5DA 1Q90A 2CW0C 1SNQA 3KUPA 2K28A 4B9WA 2F4IA 1E2ZA 1EYCA 1BCPF 4C3JB 4R8NA 4QB4A 1PLFA 2QEJC 4RKLA 1GHJA 3J80L 2MGSA 2JSOA 3H09A 1Y8PB 5CBAE 2G9HD 2WP8J 2K03A 4RGMA 3BYTB 3I73A 5K36H 3QIAA 2NB0A 2IL8A 2RSNA 2ZT9C 1PTOB 2PW5A 3RZOB 2B2VC 5AFWA 5EJWA 1XX8A 2WAQB 4PMWA 3R2IA 1IKMA 2SEBD 1SJED 4WORA 2K01A 3KLRA 1SNDA 1GJXA 5CR3A 2X6GA 2KVMA 3BZDB 2IT1A 3EQLC 2VUMB 5FO9B 3PUWA 4DK1A 2BOSA 1GUTA 3I90A 3RZDB 4UAIA 2OXPA 1E2VA 4HMJA 1CA6A 1RD9D 3H0GB 4HCEA 1OO9B 5D3DA 3HEJA 1D1IA 3PIP3 4RCOA 3NK9A 1TR5A 1SNMA 1WTPA 3MFYA 1XXGA 2PYKA 3P1HA 1Q1BA 2QDBA 4RKBA 1F2ZA 1H9SA 3NTIA 4EQNA 1X32A 4JK1C 3VYUA 1E0BA 3NWSA 1DZ1A 5D65A 3S15B 5D3IB 1WVLA 3OOCA 1MBYA 1H9RA 1GHKA 5M3FB 1G2TA 3CKIB 4XYOA 1BOSA 4JBWA 5EKKA 1PRTD 2F1MA 2XRSD 3KK7A 3OMCA 5DNFA 1Y8NB 2EYJA 3S9WA 2E75C 4K2LA 1CHPD 1R4PB 1JE4A 1HTLD 2A6EC 5J1ZA 4ZKCB 2R7ZB 3DWAA 2RA4A 2FFKB 2KECA 5C4XB 4Z9CB 4HEDA 1LT4D 5I4DA 4NP5A 4C3IG 1A2UA 5C0XG 2KQ3A 3KLSX 3GO5A 2R3ZA 5A35A 2L4NA 4C1NK 4ZK9B 4PQXA 4OO1G 4RGOS 1OXVA 3GV6A 1R4QB 4C3JG 4DFAA 2HCIA 4XTCS 4KY5A 1O7ZA 4H44C 1SYGA 3A55A 1SYFA 3K6OA 2JEAI 2QILA 1B9MA 2LKVA 1ZEQX 2BA1A 2F3VA 1A3VA 4FXDA 3TP7A 2KCNA 2AWOA 2F0UA 4M1UB 3BDCA 4L6TB 3K5OA 3GTLB 2XWBB 3MXNA 5EGTA 1LT6D 2EJFC 3X3MA 1Q12A 1RTOA 4X3TA 3S1QB 5JEAG 1TS2A 1WTWA 4KD3A 1B50A 3U9OA 2JXMB 5D14A 5G3LF 1FNUA 4A3IB 5IGGA 5CYUA 2QF7A 3RUZA 2L12A 4FNFA 3BVZA 3NBIA 2D5DA 5EKIA 1WD0A 4G7HC 1HPCA 2EZVA 3PO2B 5IODA 1KLUD 1D1KA 3H3VC 3K5MA 3R8BA 1JB3A 1I6HB 1BBXC 1F9RA 2JA8B 3QG1A 3NTHA 1U4MA 2C5CA 1DM0B 3WOFA 1DOMA 1GUWA 4KJNA 1LLRD 4K5XA 4K8IA 4MN3A 4C3HB 1I4RA 3SXHA 3PIO3 3P7JA 5FO7B 1EOTA 2R61A 1EY8A 2WV6D 1RCVD 3EVQA 5DEHA 2K6AA 1Y1WB 4IN3A 3VR4A 3K7AB 1G8ZD 1ZYRD 1JOQA 3EROA 2XSCA 2SNSA 3D4RA 5ELEA 1DD2A 4QCLA 1U4PA 1TS4A 2K33A 1STYA 1Q3LA 3T16A 1Y69U 5CV4A 4F8MA 3VA5A 2A73B 1WCMB 2A6HC 3ONAB 4X3SA 3C1FA 2F0IA 5BN4A 3DUZA 2N55A 4ID6A 1FGBD 5CGKA 2K32A 3Q0AA 1PZID 4DGZA 3OPOA 2JE6I 3PUYA 3W3AA 3KLSA 1F2MA 1F9QA 2EYPA 4IFDG 2VB3X 2KOLA 4PV1C 1SMYC 1FR3A 3OMGA 1HUNA 5KYIA 4ODGA 4KI0A 1EZ6A 1WTQA 1STGA 4J8QA 4CGYB 1I4PA 2V4DA 5EBCA 1AP0A 1EY4A 5C3WA 3T51B 4XIGS 3SK4A 4CBVA 1H9MA 2EY1A 3ITPA 2G9DA 3D31A 1QOHA 3SDZA 1KNEA 1ZXTA 3I4LA 4BY1B 2DNCA 2NN6I 2Q8IB 5M3MB 1JR0D 1KABA 3DHQA 3MA2B 5LHY1 1MSGA 1Z6HA 1YNJD 1B9NA 5JJZA 2Q8RE 4J1MA 3E5SA 3GTPB 3O13A 2NVTB 4PMCA 1SXTA 4MHEA 4DAYA 2B2YA 1I50B 2F0HA 1I4XA 1D5MC 3GTJB 3GTGB 4X3UA 2CQAA 1TVXA 1PRTF 5CV5A 2D9UA 3A8IE 1TS5A 1EWHA 2NUCA 2PZUA 4RHRA 3HOYB 1PXUA 2H4OA 1HFNA 3GV3A 1A3TA 4KD4A 5ELDA 1QJOA 2B8GA 1EQTA 3FDTA 3NE5B 5IGBA 4OGQC 4C3HG 3SVMA 3TBIB 1U4LA 1YNNC 3C1EA 5LL6X 1EQVA 1BCPC 1PFBA 2AQ1B 1TWHB 3GTQB 1U4RA 1CT1D 1VCIA 4DXGA 2B39A 4FF3A 1S5DD 3EFXD 4A3FB 3IFTA 3HOZB 5C4JB 4OO1H 3NWTA 3LX0A 1S5BD 3KBXA 1IYUA 4K2KA 4V190 1SYEA 2ZXRA 3QWNA 3HKZB 3U9SA 5C6AA 2KA7A 3NP8A 1BUVT 3T4AC 2IJ0A 1WTOA 2PCFB 1EY7A 5LL6S 2F0KA 5FO8B 5C3EB 1QNKA 2JP1A 1F9SA 1B53A 3C2PA 3E0JA 4ZYSA 2J0TD 5COYA 2X6LA 4MIUA 5M5WB 5KNDA 3I4MB 3MTSA 1SNOA 3SK8A 2EPBA 3DEPA 1AEXA 1AZPA 1HTPA 5JEAH 2HUGA 2NN6H 4IQZA 1L0YB 3NQTA 3NSWA 3S2DB 3N6RA 4B08A 1LTAD 1KDBA 1UNSA 5FKAC 1SFOB 4TQUS 1CFMA 3VYTA 5E4WC 1GUSA 1KAAA 2VXWA 1FNWA 1CQFA 4R9WA 3SHLA 3M4YA 5FLXE 4DA2A 1HA5A 1TWFB 2WKCA 2CHBD 1EU3A 5E4XA 3IKJA 4G4KA 1GXDC 3W2DA 3K59A 2B2YC 3PMFA 3BS1A 1IHZA 4KMUC 2AWNA 1SE4A 2HQEA 3VR3A 1EIHA 5CMDA 1NUCA 1XWEA 2LY7A 4RA8A 4HSPA 3TMEA 5M5YB 3TDQA 3NBHA 1C8CA 5C4ZA 3QB3A 3S1MB 1ML0D 1KLGD 1VF5C 1K8OA 2IW3A 1GUOA 2XWJB 5FOBB 1V1OA 1S5FD 1KDAA 3CRKC 2A69C 3BDOA 3T13A 4N9PA 5TSSA 3WDNA 5C44B 1T5XD 4NMZA 4OIKA 4J6HA 3OSOA 1QILA 4LMQD 3FRPB 4Q5VA 1NSNS 1V1PA 3ND9A 2IWHA 1ONLA 3AMUA 5T1GA 3VA7A 2E2DC 2R6GA 2EXZA 3GP7A 3TSSA 5M9OA 2QKIC 3K58A 3TZDA 1BNZA 2BE5D 3HOWB 5JPMC 3MWYW 4NDXA 4RCNA 1B44D 1SSOA 4KN7C 3HZXA 3OW7A 3TP8A 1PZKD 1EY0A 4IZ8A 1G91A 1TWCB 1ZKOA 2NBFA 5BN3A 2SOBA 2FMCA 1HQRD 1O78A 4EVOA 2WIIB 2Q8TA 1O7LA 1MI2A 2Z4IA 1Z47A 2B2WA 3DEOA 4ZUJA 3D8GA 4IUUA 2NYZD 5T1IA 1S5CD 4I7ZC 1SYCA 3H94A 5JEAJ 2BDOA 1SNPA 2D62A 4IALA 1STBA 4Y7NB 4QUCA 2EYFA 5CBEE 1A15A 1SE3A 5ISRA 4IUVA 4RHSA 3S17B 4L8JA 1I6VC 4ZLTF 2EVBA 4RGTA 1W6JA 2O4XA 2MPMA 4H0LC 2TMPA 3VR5A 5EPLA 1STHA 1TWGB 1EY5A 1SYDA 4ZUIA 1IW7D 5FLXL 3GTOB 1ENFA 1DCZA 1H9SB 2KJXA 1B1ZA 2IPKD 4CJ2C 4HTHA 1JWSD 3FVQA 2YU9B 1V43A 1MD2D 1B2TA 2F0NA 1TU2B 1STAA 3MVVA 4OIJA 4P2CB 1ENAA 2F0LA 2XRQD 1J8IA 1TIID 3HS0C 3ND8A 3SE0A 3K57A 1SAPA 1QCBD 1EY6A 1IKLA 3GD7A 5NUCA 5KGUA 1FYCA 4NKLA 4IUQA 1SYBA 4R8IA 3VR6A 2PO4A 4DNRB 2R93B 4PNYA 5I9PA 1QNUA 5ELBA 1RDPD 3S2HB 5KEEA 2DY7A 1EU4A 4ABNA 1JORA 2F0TA 1HA6A 5K36G 1Y8OB 2NWGA 3FPUB 1EYAA 2PMZB 4Q0FA 5BN5A 2WB1B 2B2WC 3RD4A 3IFDA 1DYQA 4HN7A 2F03A 5E3FA 1XYIA 1TY2A 4OHJA 2X69A 3OIPA 1AZQA 3BDLA 4A93B 3MXPA 4A3DB 2E76C 4XQNA 1D5ZC 1DOLA 1J9OA 1II3A 2F0QA 4O42A 3A8KE 2DNEA 2FINB 4FF2A 4A3JB 2BE5C 5IGEA 2B63B 4ULLA 1KNAA 4KKUA 4XT1B 2CW0D 1C4QA 2DN8A 5C0XI 1B4OA 4EGVA 5KRUA 4KHVA 5CV9A 3Q23A 1RF2D 3MHBA 3DMUA 5IIFA 4IURA 2RQXA 4DNTB 4OO1I 1PRTC 1BXTA 3HOVB 2PQEA 4RWSC 4KTAA 4BA2I 4E6IA 3J7AF 2Y0SB 3P75A 5F2DA 2MHVA 1NAPA 2B8FA 1NR2A 4FO2A 3ZYYX 3S14B 1AFPA 2JEBI 3A7LA 1OXTA 3GQBA 1PFMA 4DAVA 4KKSA 5EBDA 1GOZA 3PO3B 3EA6A 3RMHA 2K05A 4RH6A 3OWFA 2TSSA 1VF7A 1EL0A 2BA0A 2AUKA 2N88A 1F77A 1O80A 3BG3A 1CTMA 5IGFA 4G7ZC 4QMGA 4LJZC 3A8JE 1BCPB 3LNNA 4IUNA 4EQPA 3K0YA 2D2CC 1ET6A 1AW7A 5K5PA 1I4HA 1SE2A 3NTKA 2F0WA 1CI3M 2B2TA 1PTOD 1BF4A 3LWEA 3P20A 2K04A 4V0BA 1LV9A 3I8ZA 4C1NI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY9 A;  1F2Y A;  1SND A;  4NP5 A;  1EQV A;  1EZ6 A;  4EVO A;  1A2U A;  5CR3 A;  1JOO A;  5C3X A;  1EY6 A;  1ENC A;  1STG A;  2KHS A;  4KV6 A;  5DAU A;  2KQ3 A;  5NUC A;  5KRU A;  2F0O A;  5J39 A;  2ENB A;  4KHV A;  5KGU A;  5CV9 A;  5I6W A;  4HMI A;  4WRD A;  3PMF A;  4YIJ A;  4ZUJ A;  5C5L A;  3D8G A;  1IHZ A;  5IGD A;  2HQE A;  1STN A;  3MHB A;  3DMU A;  5IIF A;  3QOL A;  4NKL A;  1SYC A;  1A2T A;  4DF7 A;  1SYB A;  3R3O A;  4ZQ3 A;  2M00 A;  4K5X A;  1EY4 A;  4KJN A;  1NUC A;  1SNP A;  4H7B A;  5C3W A;  3QOJ A;  4KY7 A;  5JOB A;  2F0E A;  4PNY A;  2F3W A;  5I9P A;  5I9O A;  4K8I A;  4KY6 A;  3V2T A;  3LX0 A;  5C6A A;  3SXH A;  3TME A;  2OXP A;  2PW7 A;  5J22 A;  4G57 A;  4F7X A;  4DFA A;  1U9R A;  2PQE A;  4HMJ A;  4IAL A;  3SK4 A;  4KY5 A;  2EY5 A;  1EY8 A;  3D4W A;  1STB A;  3D4D A;  4KTA A;  2EY1 A;  4K2K A;  4E6I A;  2F0G A;  5C4Z A;  1SYE A;  3EVQ A;  1EZ8 A;  2EYF A;  3QB3 A;  5DEH A;  5IGC A;  3HEJ A;  1SYG A;  3P75 A;  5E1F A;  3ITP A;  5F2D A;  3SK6 A;  5ISR A;  3EJI A;  3NK9 A;  2F0V A;  3NUC A;  3NP8 A;  1TR5 A;  1SYF A;  3ERO A;  5C5M A;  3SK5 A;  1JOQ A;  1SNM A;  1SNC A;  2LKV A;  1EY7 A;  2SNS A;  5KEE A;  4K5V A;  1JOR A;  2F0K A;  2PYK A;  2F0T A;  4K6D A;  3P1H A;  2O4X A;  2F3V A;  2QDB A;  3TP5 A;  1KAB A;  1A3V A;  1KDA A;  1STY A;  1F2Z A;  2EYL A;  3DHQ A;  4K5W A;  4RKB A;  5EKL A;  1SNQ A;  4OL7 A;  3OWF A;  3TP7 A;  2F0U A;  1EYA A;  5CV8 A;  3BDC A;  4EQN A;  3T16 A;  4B9W A;  3T13 A;  4PMB A;  5CV4 A;  1EYC A;  1KDC A;  4R8N A;  4N9P A;  3SR1 A;  4QB4 A;  4MIU A;  4F8M A;  3VA5 A;  1RKN A;  4N9T A;  4NMZ A;  5HUR A;  1STH A;  4J1M A;  3MEH A;  4RKL A;  5EGT A;  5IGF A;  1EY5 A;  1SYD A;  3E5S A;  4J6H A;  4QF4 A;  3OSO A;  2F0M A;  4ZUI A;  4PMC A;  5C4H A;  5M9O A;  4B9X A;  5KYL A;  5E3F A;  1SNO A;  2PZW A;  3SK8 A;  4QMG A;  1A3U A;  5IOC A;  1AEX A;  1NSN S;  2F0F A;  1TQO A;  1TT2 A;  2F0J A;  2F0H A;  3C1F A;  2F0I A;  2EY2 A;  3TP6 A;  5CV6 A;  5CV7 A;  5CC4 A;  4DU9 A;  2OEO A;  4S3S A;  4KJO A;  4KD3 A;  4ODG A;  4ID6 A;  2RKS A;  4ME5 A;  2EXZ A;  4HTH A;  3D6C A;  2RDF A;  3ERQ A;  3U9O A;  2EYH A;  2EYO A;  3BDL A;  3NQT A;  4K14 A;  2PZT A;  5CV5 A;  3MXP A;  2EY6 A;  2F0S A;  4I65 A;  5EKK A;  5CGK A;  4IUN A;  4EQP A;  4DGZ A;  4TRD A;  2OF1 A;  4K8J A;  2PW5 A;  4NDX A;  2NUC A;  2PZU A;  4LAA A;  3OMC A;  5IGG A;  2F0P A;  2F0N A;  3H6M A;  3HZX A;  1EYD A;  1KDB A;  1STA A;  4EQO A;  5K5P A;  5HGT A;  1II3 A;  3NXW A;  3MVV A;  2F0Q A;  3RUZ A;  2EYJ A;  2F0W A;  3TP8 A;  3S9W A;  1A3T A;  2F0D A;  3MZ5 A;  2WAC A;  4KD4 A;  1F2M A;  4K2L A;  1ENA A;  2F0L A;  2EYP A;  1EY0 A;  2EYM A;  5J1Z A;  5IGB A;  1JOK A;  4IZ8 A;  5KIX A;  1KAA A;  2RBM A;  5JAV A;  4WOR A;  3OMG A;  5IGE A;  5IOD A;  5KYI A;  3SHL A;  3NHH A;  2SOB A;  3C1E A;  5I6Y A;  2SNM A; 
#chains in the Genus database with same CATH topology
 1EY9 A;  1IBM L;  1LM0 A;  2ZXP A;  4DV5 L;  1VQ4 A;  4HSV A;  2E2I H;  1S5E D;  1JIC A;  3M85 A;  2EJM A;  2MFI A;  2KHS A;  5DAU A;  2E2J H;  3V05 A;  4L5S A;  1E1T A;  3J7Z C;  5JJL A;  3TN2 A;  4N8F A;  3CQZ H;  5C5L A;  3JAM L;  5M5X H;  3I4N H;  3DWQ A;  3X3N A;  5L37 A;  1LTR D;  1Y1V B;  1MKH A;  3FPP A;  2L15 A;  2YYZ A;  1MJC A;  3J81 E;  2WB1 G;  4KY7 A;  4JBK A;  4KY6 A;  4BWG B;  1TWA B;  3M4O H;  2PW7 A;  3DM1 A;  2NVQ B;  1Y1W G;  1X55 A;  5IYD G;  2UUC L;  3F8T A;  1XNR Q;  5C0X H;  4R4T A;  2JA7 B;  4ZAI A;  1QG7 A;  1YHB A;  3ULL A;  1EEI D;  1SRO A;  2F0V A;  4OX9 L;  2IX1 A;  1SNC A;  4U67 3;  3TZU A;  3S1N B;  1A6X A;  4A3K B;  3QR8 A;  1CK1 A;  2VB2 X;  3Q22 A;  5JVH 3;  3J80 i;  3TP5 A;  1XMO L;  2HDL A;  1WTX A;  4WJW A;  4C3J H;  2IX0 A;  2EDG A;  2VL6 A;  1WCM G;  2VNU D;  4O0A A;  4DR5 Q;  2L9H A;  3ULJ A;  4A3E B;  4AYB B;  1Z7T A;  2PQA A;  2VQF L;  2MUY A;  2OT2 A;  4HID A;  1G6Z A;  3G7L A;  4A3J G;  1PHJ A;  4ILW A;  2JA5 B;  4X65 L;  2BCO A;  2B63 G;  1BBW A;  1VQK A;  3KF8 A;  3Q8D A;  2F0F A;  2HCC A;  2EY2 A;  3IL8 A;  5CV6 A;  2Z6K C;  2OEO A;  4G7O C;  3AEV A;  2RKS A;  4UPA A;  4ZCK A;  3ERQ A;  3TEH B;  2BH8 A;  1PTO H;  4K14 A;  2EY6 A;  2F0S A;  5IT9 L;  3RZO H;  4DAY B;  4BXX H;  3IAY A;  2ICE C;  4ZRZ A;  3HFZ B;  4K8J A;  1IBL L;  2AQ3 B;  2VW9 A;  1YIJ A;  4IOC A;  2UUA L;  1ZYR C;  3H6M A;  2E74 C;  4A3G B;  1ESF A;  3F1Z A;  3MZ5 A;  4OEL B;  4IFD I;  2WIN B;  4HJA A;  2OQ0 A;  3IRB A;  3PUV A;  3PUZ A;  3HOV G;  2KCC A;  4AH6 A;  1SDF A;  1N9W A;  1M1K C;  3MXG A;  5I6Y A;  4WFN 3;  2Y0S G;  3HG9 A;  5EQ0 A;  4DV6 Q;  1EWC A;  2F3I A;  1WTH A;  2FMM A;  2ATW A;  2XN9 C;  2RDH A;  3E6Z X;  2O2L D;  4C3I B;  3D6W A;  1JCK B;  2VUM H;  1HRJ A;  5DLQ E;  4WRD A;  5LMN Q;  2WKD A;  1SEB D;  3PO3 G;  1OXS C;  4DXF A;  3A54 A;  2RVL A;  1MSH A;  4HJ9 A;  1KTK A;  3RZD H;  4DN4 M;  3FEW X;  1ROD A;  2K4K A;  2F3W A;  5I9O A;  3V2T A;  2DY8 A;  1HXY D;  1GUN A;  3H0G H;  2OCE A;  3R93 A;  1K3R A;  4IPD A;  1VQ5 A;  2UXC L;  1GUG A;  1WI5 A;  4YCU A;  3NQI A;  4P75 A;  1CZG A;  4WJ3 M;  5DM7 3;  1BO0 A;  3GTM B;  2B2T C;  4F88 A;  4LF7 Q;  4ZKB B;  4X66 Q;  1CKN A;  3HOU B;  4IUP A;  3FHW A;  5I2X A;  5IP9 H;  4LWC A;  2AQ2 B;  4KHZ A;  3KF6 B;  1JC7 A;  1L1O B;  2EYL A;  1KC8 C;  4OL7 A;  2PPB C;  4JI5 Q;  1IYJ B;  3BJU A;  2FXQ A;  3I91 A;  5ELN A;  3S15 H;  3K5L A;  5HUR A;  1JB7 A;  3ERS X;  3PV0 A;  5COR A;  2A5H A;  5C4H A;  2ZJR A;  3CPF A;  4IPG A;  4XDX A;  5M3F H;  1JJG A;  4X3K A;  1LT3 D;  3K0X A;  5I2Y A;  1TT2 A;  1EEF D;  1SJH D;  1G29 1;  3PSI A;  1PYW D;  2J7Z A;  1L2F A;  4A3B B;  2JA6 B;  1Q7Y C;  2EYH A;  1S4Z A;  2J4X A;  1K8M A;  1SBB B;  4TRD A;  4FYD A;  2UUB Q;  1V8Q A;  2I46 A;  1KXL A;  5C0X J;  2VY3 A;  1X3P A;  4JOI A;  3J81 L;  4EQO A;  1KHI A;  3W1B A;  2B2U C;  4DV7 L;  3KLW A;  1Y1V G;  2F0D A;  2L11 A;  1E2W A;  2WAC A;  2R7Z H;  4K6L A;  3A56 A;  3A7A B;  4JI7 Q;  1O7Y A;  2Z1C A;  5C4X H;  4CHT B;  5IP7 H;  3CXC A;  1STE A;  1KL9 A;  2RBM A;  2I5H A;  3K80 C;  3SEB A;  1OXX K;  4JI4 Q;  1YNJ C;  4EQ5 A;  1AE2 A;  4JI0 L;  5KNC A;  1RJT A;  3RLF A;  2JA7 G;  1JOO A;  3M3Y B;  3BVM A;  3MFG A;  4HR7 B;  1CHQ D;  2PMZ E;  2A68 D;  2EXD A;  2WB1 E;  3LWU A;  1LT5 D;  1VQJ A;  4A3F G;  1C48 A;  2EQS A;  4HCS A;  1PTO C;  4TSS A;  4DUZ Q;  1CSQ A;  3CHB D;  3CU7 A;  1JWM D;  2L55 A;  4DR6 L;  4IJL A;  2H1E A;  3JAM c;  1VQG A;  1HH2 P;  2A6H D;  1RIP A;  1VQP A;  4IFD H;  4FXG C;  3KJP A;  1LTI D;  1HUM A;  3FMC A;  3QOJ A;  1N32 Q;  4GKK L;  5JPN C;  5J3B A;  4A3E G;  2BH2 A;  4AYB G;  3J7A V;  4BBS B;  1XNQ Q;  3CC2 A;  1DXM A;  2F0G A;  2KHI A;  2JA5 G;  1TY0 A;  3CMA A;  2PNR C;  2QCP X;  2M2L A;  1PFS A;  4POF A;  1X3G A;  3TQY A;  5C3E G;  1NCV A;  4YY3 L;  3HP3 A;  1CZW A;  2YTX A;  3NBH B;  5FJ8 H;  4DR7 L;  1TS3 A;  1ILP A;  4R1J A;  1VMC A;  4A3M B;  4CKE A;  4AQY Q;  4LF9 L;  3Q24 A;  1SMY D;  5EKL A;  3GTL H;  3PUX A;  1LTG D;  3VYR A;  2LMC B;  4A3G G;  1RL2 A;  4A3C G;  4HJ5 A;  2UXB L;  2RCN A;  4GKJ Q;  1V9P A;  4YHH Q;  5GRO A;  1EIY B;  4QF4 A;  3VYS A;  1NR4 A;  3S1Q H;  4GLX A;  4B9X A;  3U50 C;  1E1O A;  1GO3 E;  1KIX A;  3RN5 A;  2CCZ A;  1B8A A;  1VDZ A;  1ILQ A;  3A74 A;  3I72 A;  4JI1 L;  2RHS B;  1LTT D;  2AUJ D;  5HY6 A;  4A3I H;  1X56 A;  4EX5 A;  3MXU A;  4JW0 A;  2OF1 A;  5IT9 c;  2Z9H A;  3HKS A;  1V1P B;  4NXN L;  1JJC B;  5ELF A;  4H13 C;  2Y0S E;  4GNX B;  1PTO F;  3U4Z A;  2EYM A;  3CCE A;  1VQF A;  3PO2 H;  5JJI A;  1IYV A;  5JVG 3;  1I6H H;  2SNM A;  1F2Y A;  1K0R A;  1D2B A;  4DV2 Q;  3VR2 A;  4DK0 A;  1KD1 C;  1H9K A;  2JA8 H;  3BVG A;  1ENC A;  4L63 B;  3CRL C;  4RFB A;  4FF1 A;  4YIJ A;  1PH8 A;  1PV4 A;  1GVP A;  3D0F A;  1UUP A;  3QOL A;  1BDO A;  1NMG A;  4DF7 A;  3R3O A;  4JI3 Q;  3E9I A;  4C3H H;  5JOB A;  4GLA C;  1G2S A;  3S16 B;  4F87 A;  4HAE A;  2L1B A;  4A75 A;  4APV A;  1U9R A;  4JOI C;  2F52 A;  2EY5 A;  3L7Z C;  1Y1W H;  3D4D A;  4X62 Q;  3T53 B;  1EZ8 A;  2C9O A;  3K7A H;  3TS0 A;  5LMU L;  4IUT A;  4FP5 D;  1RTN A;  3J80 c;  2K50 A;  5C5M A;  1DON A;  4A3B G;  4DR2 Q;  2JA6 G;  1PFN A;  4KKT A;  1FL0 A;  4K6D A;  2NN6 G;  1PH1 A;  2ZTC A;  5FK9 C;  2ZXO A;  3I70 A;  2KED A;  4CJ0 B;  4BBR B;  2LFN A;  1F2L A;  4QQB X;  1YNN D;  2EJG C;  3CME A;  1E3P A;  4NW2 A;  1FVI A;  1WCM H;  4CJ1 B;  1BCP D;  1RKN A;  4N9T A;  1ICF B;  3A5U A;  5IWA Q;  2K5W A;  2MJ8 A;  2F0M A;  4BY7 B;  4DR4 Q;  1DJR D;  4IFD J;  1VS0 A;  3GTK B;  2F0J A;  1HFG A;  3RN2 A;  3TP6 A;  4JYA L;  4DU9 A;  4KJO A;  1QB5 D;  3D6C A;  3HOX B;  4WJ4 A;  1RHP A;  1WTR A;  2PZT A;  3JAM E;  2NVY B;  4I65 A;  4RAU C;  2BDN A;  3BZK A;  2MP1 A;  1LTS D;  3I7F A;  4GOP A;  4LAA A;  2F0P A;  1PZJ D;  3J81 c;  3NXW A;  1QWY A;  1XTD A;  4KN4 C;  1PH2 A;  2K7V A;  4OWT B;  3L2P A;  1JWU D;  2ASB A;  1PRT B;  4LK1 C;  2O5J C;  1D6E C;  1HQM C;  5KIX A;  3Q6S A;  2N49 A;  1D5X C;  1MGS A;  4BBS G;  3NHH A;  1FD7 D;  2OTL A;  2XNA C;  1Q46 A;  1JQY D;  1EFI D;  4U68 A;  4FXK C;  1QE6 A;  4HMI A;  1XPR A;  2QGQ A;  4GZY C;  1LAC A;  4H02 A;  2RSO A;  4HJ7 A;  5IGD A;  1STN A;  4AYB E;  2HDM A;  1BQQ T;  5IYB G;  3AFP A;  1ICW A;  1I4G A;  4RG1 A;  4JV5 L;  2A68 C;  2EE1 A;  4G57 A;  1XTC D;  4DR1 L;  3SGI A;  3D4W A;  2ICI A;  4BS9 A;  1B70 B;  4UHV A;  1S72 A;  4LF4 L;  5IGC A;  1ET9 A;  3PIP A;  3AB9 A;  4DV5 Q;  1LTB D;  3QJY A;  1WD1 A;  3CCL A;  3KDF A;  1M4V A;  2NZO A;  1LTL A;  2L0C A;  3URY A;  1N34 L;  1J6Q A;  4BY1 H;  5IT9 E;  2XVS A;  1PA6 A;  4JI2 L;  5M3M H;  2E2H B;  1X3F A;  4JVZ A;  2N78 A;  4O1N A;  3E3X A;  1HR0 W;  2FJ2 A;  1QUQ B;  3QO2 A;  1E22 A;  1ESR A;  4B3S L;  4BA1 I;  1Q1E A;  4K5W A;  1HNX L;  1W6K A;  1HNZ L;  4PMB A;  1H9J A;  1KDC A;  1UEA B;  3SR1 A;  1HZ9 A;  3GTP H;  1LO5 D;  3M7G A;  4CKC A;  3MEH A;  2Z4H A;  3MC0 B;  4CDC C;  5FLM G;  2A8V A;  2A74 C;  2NZ1 D;  1I50 H;  5KYL A;  2PZW A;  5EPK A;  2I07 B;  1A3U A;  1EOV A;  5DM6 3;  3GTJ H;  1CA5 A;  3GTG H;  1D8L A;  4JBJ A;  5AJ3 L;  4B3T L;  5CC4 A;  4OX9 Q;  3J7A 5;  4S3S A;  5A2Q E;  4B3M L;  3BYY B;  1HHV A;  4QIW B;  4DV3 L;  2JA9 A;  4KHP L;  3HOY H;  3K5N A;  1OTC A;  1M90 C;  5ELO A;  1EYD A;  1JMC A;  5HGT A;  1K8G A;  2A19 A;  2RCF A;  4DV4 L;  4HIO A;  2VQF Q;  3B6Y A;  2KUM A;  1PDQ A;  4P74 A;  5JAV A;  3I3C A;  3FKI B;  1YHA A;  5H1S E;  4X65 Q;  3J7Y W;  3J80 E;  5EPJ A;  1TWH H;  3GTQ H;  4DAP A;  2L5T A;  2A69 D;  4LFC Q;  4KV6 A;  3UDF A;  2K1B A;  2KEE A;  1IW7 C;  4N8X 1;  4B3R Q;  1I3Q B;  5J39 A;  2ENB A;  1IL8 A;  5I6W A;  4FVM A;  4A3F H;  3TS2 A;  3KBG A;  2NTS A;  1IBL Q;  3HOZ H;  2DJF C;  5C4J H;  1VQN A;  2RDG A;  1N33 Q;  2UUA Q;  2R93 G;  4BBR G;  3F2U A;  2M00 A;  1WTV A;  4H7B A;  4C2M B;  2SDF A;  2LXJ A;  4GOP C;  2XIW A;  4F7X A;  2JN4 A;  4LFB Q;  1BR9 A;  4IJH A;  4BY7 G;  1KAW A;  2UU9 Q;  3WOE A;  1T5E A;  4UDU C;  2LS0 1;  5E1F A;  3HRZ C;  2B2V A;  3N52 A;  4XQJ A;  2ZM6 Q;  2M9V A;  3NUC A;  4LF8 L;  2K5Q A;  2EOT A;  5C3E H;  3KFU A;  4CKB A;  1TKW B;  1AN8 A;  1VQI A;  2VQE Q;  2CWA A;  2NTT A;  5CV8 A;  4UP8 A;  4JI8 L;  1CM9 A;  4PG3 A;  4M8A A;  1K83 B;  5M5W H;  3H91 A;  3D3R A;  1XJV A;  1UAP A;  4P72 A;  3I4O A;  3I4M H;  2R92 B;  1DOK A;  1Q8I A;  1M8A A;  1LAB A;  2HQL A;  4TKO B;  1EIG A;  3VDY A;  3OHX C;  2B2U A;  5IOC A;  1TQO A;  1R9T B;  3S1R B;  5GAE C;  5CV7 A;  4A93 G;  3V96 A;  4A3D G;  2A6E D;  3L9A X;  3UI2 A;  1NJI C;  2O5I C;  4ME5 A;  2RDF A;  3S2D H;  2EYO A;  2JYO A;  3DWP A;  4XXE A;  1BBU A;  5G3L D;  1IL2 A;  3OW2 A;  4XQQ A;  3K7U C;  1SFO H;  2Z8L A;  4JI6 Q;  3OWE B;  3ICE A;  4DV0 Q;  1FNV A;  4QUF A;  3MAQ A;  2NVX B;  2IHE A;  1JOK A;  4UP7 A;  1MHW C;  1X3Q A;  3L3O C;  2AMC B;  3AU7 A;  1TWF H;  1X9N A;  3DXJ C;  5KNB A;  3F2D A;  3I2Z A;  1CQV A;  4XT3 B;  1B3A A;  1U0L A;  3R2T A;  5C3X A;  2GA4 B;  1I4Q A;  2E2I B;  3I55 A;  3M7N A;  1MJE A;  3K8A A;  2F0O A;  5IYC G;  4FF4 A;  2E2J B;  1YVC A;  2CVR A;  4XYQ A;  3CQZ B;  3RNU A;  5M5X B;  1EWI A;  1UE5 A;  3I4N B;  1A2T A;  1L0X B;  2FHT A;  4DV7 Q;  3I56 A;  4ZQ3 A;  2R7F A;  1VMP A;  1PMR A;  5M5Y H;  2F0E A;  3T56 B;  3G6J B;  3OYY A;  5J22 A;  2OQK A;  1VQ7 A;  3OIQ A;  3C46 A;  3S1M H;  3M4O B;  1OXU A;  2EIF A;  2ID0 A;  3C3L A;  4KK7 A;  4LF6 Q;  5A2Q L;  4C56 C;  3NPP A;  3HGB A;  3SK6 A;  3H3V I;  3EJI A;  3SK5 A;  4RGN A;  4A3L G;  1HCZ A;  4OEM B;  5ELC A;  4K5V A;  1G6P A;  1F9P A;  2IX3 A;  2NZH A;  4DR6 Q;  2K5D A;  1Q90 A;  2CW0 C;  1SNQ A;  3KUP A;  2K28 A;  4B9W A;  2F4I A;  4QL5 A;  5C44 H;  1E2Z A;  1EYC A;  1BCP F;  4C3J B;  4R8N A;  4I7A A;  4QB4 A;  2Q2T A;  1PLF A;  2QEJ C;  4RKL A;  1GHJ A;  3J80 L;  4FDB A;  4LFA L;  2MGS A;  2JSO A;  4YCW A;  3FKI G;  4OXP A;  3H09 A;  1Y8P B;  5CBA E;  2G9H D;  2WP8 J;  2K03 A;  4RGM A;  3BYT B;  4DPG A;  3I73 A;  5K36 H;  2PQA B;  4MTN A;  1XNR L;  2N3S A;  3QIA A;  2NB0 A;  3HOW H;  2I0Q A;  2IL8 A;  2RSN A;  2ZT9 C;  4LF9 Q;  1PTO B;  2PW5 A;  5LMN W;  1FJG Q;  3RZO B;  3KF8 B;  2B2V C;  3CF5 A;  5AFW A;  5EJW A;  1XX8 A;  2WAQ B;  4PMW A;  3A0J A;  3R2I A;  4MZ9 A;  1IKM A;  1TWC H;  2SEB D;  1SJE D;  4WOR A;  1P16 A;  5EAY A;  4A76 A;  2K01 A;  3KLR A;  1SND A;  5GAG C;  1GJX A;  2X6G A;  5CR3 A;  3G71 A;  2KVM A;  3BZD B;  2B3G A;  2OWO A;  2IT1 A;  1VQC A;  3CP0 A;  3EQL C;  2VUM B;  5FO9 B;  4O2D A;  1LUZ A;  3PUW A;  2LSS A;  4DK1 A;  2BOS A;  2C35 B;  1GUT A;  3I90 A;  3J81 j;  2DGY A;  3RZD B;  4UAI A;  1HZA A;  1VQM A;  2OXP A;  1E2V A;  4Y7N H;  4HMJ A;  1CA6 A;  2R92 G;  1PH3 A;  1RD9 D;  3H0G B;  4HCE A;  1OO9 B;  5D3D A;  3HEJ A;  3TRE A;  1GKH A;  3BZC A;  3S17 H;  1D1I A;  3PIP 3;  4RCO A;  3JC6 6;  3NK9 A;  2HHH Q;  1TR5 A;  1A8V A;  1SNM A;  4A3K G;  1WTP A;  1IBK Q;  5GQO A;  3MFY A;  1UE1 A;  1XXG A;  2PYK A;  4K0K Q;  4DV6 L;  3P1H A;  1Q1B A;  1UE7 A;  3TRZ A;  2QDB A;  1KRS A;  1JJ2 A;  4RKB A;  1F2Z A;  1I94 Q;  5GAH C;  1H9S A;  3NTI A;  4EQN A;  5LMN L;  1X32 A;  4JK1 C;  1K0S A;  3VYU A;  1WFQ A;  1E0B A;  1TWG H;  1CKN B;  1ASY A;  3NWS A;  1DZ1 A;  1S40 A;  3GTO H;  1VQ6 A;  5D65 A;  2DJG C;  1NTG A;  3W5O A;  3S15 B;  1WOC A;  5D3I B;  1WVL A;  2VS1 A;  3OOC A;  3H3V H;  1MBY A;  1H9R A;  5LMU Q;  1GHK A;  1B7Y B;  5M3F B;  4GN5 A;  1G2T A;  3CKI B;  4XYO A;  1BOS A;  2Z6B A;  2YU9 H;  1G51 A;  2CKZ B;  4JBW A;  3KYH C;  5EKK A;  1PRT D;  2MNA A;  2D0O A;  4LF7 L;  2F1M A;  2XRS D;  4X66 L;  3KK7 A;  3OMC A;  5DNF A;  4NPS A;  1Y8N B;  3I4N G;  2EYJ A;  3M9B A;  3S9W A;  2E75 C;  4K2L A;  1CHP D;  1JE4 A;  1R4P B;  1HTL D;  3F2C A;  2A6E C;  5J1Z A;  4ZKC B;  2R7Z B;  1W3S A;  3K81 C;  1EYG A;  3DWA A;  1YZ6 A;  2RA4 A;  2FFK B;  2KEC A;  3CCM A;  3AYH B;  2ZJQ A;  5C4X B;  3AFQ A;  4Z9C B;  2A1A A;  1N8R C;  4HED A;  1LT4 D;  1YJW A;  3A5Z B;  5I4D A;  4NP5 A;  4JBM A;  4C3I G;  1A2U A;  4JC0 A;  4LUZ A;  4A4I A;  5C0X G;  3CC4 A;  1XPU A;  2KQ3 A;  4YCV A;  2CFM A;  3KLS X;  1SR3 A;  3GO5 A;  2R3Z A;  5A35 A;  2L4N A;  2KEN A;  4R4O A;  4C1N K;  4ZK9 B;  2R93 H;  4PQX A;  4OO1 G;  4RGO S;  1OXV A;  3GV6 A;  4GS3 A;  1R4Q B;  4C3J G;  2R7D A;  3S2H H;  4DFA A;  2HCI A;  4XTC S;  4KY5 A;  4RMF A;  1O7Z A;  4QIW E;  4H44 C;  1SYG A;  3A55 A;  1J5E L;  1VQE A;  3HOU G;  1SYF A;  3K6O A;  2JEA I;  2QIL A;  1B9M A;  4JCV E;  2LKV A;  5IE8 A;  3U4V A;  3OTO L;  1ZEQ X;  2BA1 A;  2F3V A;  1A3V A;  4FXD A;  3CAM A;  2YV5 A;  3TP7 A;  2KCN A;  3F2B A;  2UXD Q;  4BXX G;  2AWO A;  2F0U A;  4M1U B;  4LNQ A;  3BDC A;  4L6T B;  4DUZ L;  1XMQ Q;  2PI2 E;  3K5O A;  3M4Q A;  3GTL B;  2WAQ G;  2IY5 B;  3MEF A;  2Z0S A;  2XWB B;  2KCM A;  3MXN A;  4L5T A;  4OWX B;  3T1Y Q;  5IYD H;  4JV5 Q;  5EGT A;  1LT6 D;  2EJF C;  3X3M A;  1PH4 A;  1Q12 A;  1RTO A;  1VQ9 A;  4X3T A;  3S1Q B;  3S24 A;  5JEA G;  1XNQ L;  1TS2 A;  2E5L L;  4A93 H;  1WTW A;  4KD3 A;  1B50 A;  4A3D H;  3U9O A;  2JXM B;  5D14 A;  5G3L F;  1FNU A;  4A3I B;  1PVO A;  4B3S Q;  2VUM G;  5IGG A;  5CYU A;  2QF7 A;  1HNZ Q;  3RUZ A;  2L12 A;  3PF4 A;  1A63 A;  4FNF A;  1VQL A;  3BVZ A;  1Q86 C;  2QW7 A;  2E8G A;  4A3J H;  3NBI A;  2D5D A;  2B63 H;  1V1Q A;  2V1C C;  5EKI A;  1WD0 A;  4G7H C;  1HPC A;  2EZV A;  3PO2 B;  5IOD A;  4X64 L;  1KLU D;  1UWV A;  4YHH L;  1D1K A;  3H3V C;  3K5M A;  3R8B A;  1JB3 A;  4IOA A;  1CKM A;  3PQI A;  2KHJ A;  5AJ3 Q;  4B3T Q;  1I6H B;  1BBX C;  1F9R A;  1YJ9 A;  4B3M Q;  1C9O A;  2JA8 B;  1HNW L;  4DV3 Q;  3QG1 A;  3NTH A;  1U4M A;  4UY8 C;  1Q81 C;  2AKW B;  5HGQ A;  3NEM A;  2MO0 A;  2YTV A;  2C5C A;  1DM0 B;  3WOF A;  1DOM A;  5IP9 G;  1GUW A;  4KJN A;  1LLR D;  4K5X A;  2F4V L;  3HOV H;  4K8I A;  4DV4 Q;  4MN3 A;  4C3H B;  1I4R A;  3SXH A;  3PIO 3;  3P7J A;  5FO7 B;  1EOT A;  2R61 A;  4LF5 Q;  1EY8 A;  2WV6 D;  1RCV D;  3EVQ A;  1QVC A;  4LW1 A;  5DEH A;  2K6A A;  1Y1W B;  4IN3 A;  3S14 H;  3VR4 A;  3K7A B;  1G8Z D;  1YJN A;  1ZYR D;  1JOQ A;  3ERO A;  1FGU A;  4A3M G;  3PO3 H;  4A3L H;  2XSC A;  2SNS A;  3D4R A;  5ELE A;  1DD2 A;  4QCL A;  1U4P A;  1TS4 A;  2K33 A;  3STB D;  1STY A;  1Q3L A;  4JG2 A;  1N36 L;  2HIX A;  3T16 A;  1YI2 A;  1Y69 U;  4DUY Q;  5CV4 A;  4F8M A;  2PI2 A;  3VA5 A;  2PNH A;  2A73 B;  2K5N A;  4JI3 L;  1WCM B;  1IBM Q;  2A6H C;  1C0A A;  1C7Y A;  3ONA B;  4X3S A;  3GDE A;  1PH7 A;  2CH4 W;  3C1F A;  2F0I A;  5BN4 A;  3DUZ A;  4LUV A;  2N55 A;  4X62 L;  2K75 A;  4ID6 A;  4LF8 Q;  1FGB D;  5CGK A;  2K32 A;  2K5V A;  3KJO A;  3Q0A A;  1PZI D;  4DGZ A;  3OPO A;  4NXM L;  2JE6 I;  3PUY A;  3W3A A;  1X65 A;  4DR2 L;  3KLS A;  4JI8 Q;  1F2M A;  1F9Q A;  2EYP A;  1PH5 A;  4IFD G;  2VB3 X;  2UUC Q;  1YIT A;  2KOL A;  4PV1 C;  1SMY C;  1FR3 A;  3OMG A;  1HUN A;  4CDD C;  3EIV A;  5KYI A;  3JAM i;  4ODG A;  3PCO B;  2QEX A;  4KI0 A;  5IWA L;  1U5K A;  2LXK A;  1EZ6 A;  3EN2 A;  1WTQ A;  1STG A;  4GLV B;  4DR4 L;  1XMO Q;  4J8Q A;  1Y1V H;  5FJ8 G;  4LUO A;  1O7I A;  1I4P A;  4CGY B;  4POG A;  2V4D A;  5EBC A;  3CPW A;  1AP0 A;  1E24 A;  1EY4 A;  5C3W A;  4CDF C;  1TWA H;  4HIK A;  3T51 B;  1CSP A;  3DM3 A;  1JT8 A;  4YWM A;  2XTI A;  2NVQ H;  5BR8 L;  4XIG S;  3SK4 A;  4CBV A;  1H9M A;  4JPB W;  3CCS A;  2EY1 A;  2JA7 H;  2HT1 A;  3ITP A;  2G9D A;  5FLX c;  1IZ6 A;  1PYB A;  3D31 A;  3S1N H;  1QOH A;  2WAQ E;  3SDZ A;  1KNE A;  1ZXT A;  4A3K H;  3I4L A;  1HR0 L;  4BY1 B;  1A0I A;  1HZB A;  2DNC A;  2D0P A;  2NN6 I;  2Q2I A;  2Q8I B;  5M3M B;  3ULP A;  4A3I G;  1JR0 D;  1KAB A;  3DHQ A;  1P8L A;  3MA2 B;  5LHY 1;  1MSG A;  1Z6H A;  3KDF B;  4A3E H;  1YNJ D;  1B9N A;  5JJZ A;  2Q8R E;  4J1M A;  4QGU A;  4GN4 B;  3E5S A;  3GTP B;  3O13 A;  2JA5 H;  2NVT B;  4PMC A;  1SXT A;  3UDG A;  4MHE A;  4DAY A;  2B2Y A;  3PO2 G;  1I50 B;  2F0H A;  1I4X A;  1D5M C;  3HOX G;  3GTJ B;  3H15 A;  3GTG B;  4X3U A;  4GN3 B;  2CQA A;  3T1H L;  1TVX A;  1PRT F;  5CV5 A;  2JA8 G;  2D9U A;  3A8I E;  1TS5 A;  1EWH A;  2NUC A;  2PZU A;  4RHR A;  1NBW A;  3HOY B;  4A3G H;  2JJQ A;  4A3C H;  1PXU A;  2H4O A;  2WFW A;  4DV1 L;  1HFN A;  4QJF A;  3GV3 A;  1A3T A;  4KD4 A;  5ELD A;  1QJO A;  1MIU A;  3BU2 A;  1KRT A;  2B8G A;  1EQT A;  2UXC Q;  3FDT A;  3NE5 B;  5IGB A;  4OGQ C;  4C3H G;  1WYD A;  3SVM A;  4LFA Q;  2G5D A;  3TBI B;  1U4L A;  1YNN C;  3C1E A;  5LL6 X;  1TXY A;  1EQV A;  3NEN A;  1BCP C;  1DGS A;  1PFB A;  2AQ1 B;  1TWH B;  4C3I H;  3GTQ B;  1U4R A;  2MO1 A;  1CT1 D;  1VCI A;  4DXG A;  2B39 A;  4FF3 A;  1S5D D;  3EFX D;  4A3F B;  2ES2 A;  3IFT A;  1PH6 A;  3HOZ B;  5C4J B;  4KLK A;  1CUK A;  4OO1 H;  3NWT A;  3LX0 A;  1S5B D;  1K9M C;  3KBX A;  1IYU A;  4K2K A;  4V19 0;  1SYE A;  2ZXR A;  3QWN A;  3GTM H;  3HKZ B;  3KF6 A;  4ALP A;  1L1O A;  3U9S A;  2KA7 A;  5C6A A;  3NP8 A;  3HOU H;  1Q82 C;  1BUV T;  3T4A C;  2IJ0 A;  1WTO A;  2PCF B;  1EY7 A;  5LL6 S;  3G4S A;  1SLJ A;  2F0K A;  4R4Q A;  5FO8 B;  5C3E B;  1YHQ A;  1QNK A;  4LFC L;  4DR3 L;  3E0E A;  4B3R L;  2JP1 A;  3PIO A;  3CCU A;  1F9S A;  1B53 A;  3C2P A;  4AIM A;  3E0J A;  4ZYS A;  2J0T D;  2JK8 A;  5COY A;  3PF5 A;  2X6L A;  1N33 L;  4MIU A;  5M5W B;  4JI0 Q;  5KND A;  3I4M B;  3MTS A;  4MTK A;  1SNO A;  3SK8 A;  1B3Q A;  3STB C;  2EPB A;  3DEP A;  1AEX A;  1AZP A;  4A3B H;  3J81 i;  2JA6 H;  1HTP A;  4LFB L;  3NEL A;  4P73 A;  5JEA H;  2HUG A;  3FP9 A;  2NN6 H;  4IQZ A;  2HIV A;  2UU9 L;  1L0Y B;  3NQT A;  3NSW A;  2ZM6 L;  3S2D B;  3CC7 A;  2VZA A;  3EBE A;  3N6R A;  1QVG A;  4B08 A;  4GKK Q;  1LTA D;  1EUJ A;  1PH9 A;  1KDB A;  1UNS A;  5FKA C;  1GM5 A;  1SFO B;  1X54 A;  1KQS A;  4TQU S;  1CFM A;  2VQE L;  2JQO A;  3VYT A;  4Y52 H;  1BKB A;  5E4W C;  2VXW A;  1GUS A;  1KAA A;  1FNW A;  1CQF A;  4R9W A;  3SHL A;  3M4Y A;  4YY3 Q;  5FLX E;  4DA2 A;  3M3Y H;  4YWK A;  1HA5 A;  1TWF B;  2WKC A;  4DR7 Q;  2CHB D;  4CDE C;  1EU3 A;  2GVB A;  5E4X A;  3ER0 A;  3IKJ A;  2OTJ A;  4G4K A;  1GXD C;  2ZTD A;  3W2D A;  3K59 A;  2B2Y C;  2CWP A;  3PMF A;  3BS1 A;  2QDL A;  1IHZ A;  4KMU C;  2AWN A;  1SE4 A;  2HQE A;  4BY1 G;  3VR3 A;  1EQQ A;  4DK3 C;  1EIH A;  5M3M G;  2UXB Q;  1X6O A;  5CMD A;  1NUC A;  3CCJ A;  1XWE A;  2K5H A;  2B29 A;  5E7N A;  4DR5 L;  2LY7 A;  4RA8 A;  4JI6 L;  1NE3 A;  4HSP A;  3TME A;  4BBS H;  1K28 A;  5M5Y B;  1QZG A;  3TDQ A;  3NBH A;  4DV0 L;  1Z9F A;  1C8C A;  4JI1 Q;  5C4Z A;  3QB3 A;  3S1M B;  1ML0 D;  1H95 A;  1KLG D;  1VF5 C;  1K8O A;  1NY4 A;  4L5Q A;  2IW3 A;  1A62 A;  1GUO A;  4A3M H;  2XWJ B;  4NXN Q;  5FOB B;  5IYB H;  1PYS B;  1V1O A;  1S5F D;  1KDA A;  3CRK C;  4QY7 A;  2A69 C;  1D7Q A;  1S3O A;  3HOY G;  3BDO A;  3KOJ A;  3LGJ A;  3T13 A;  3CCQ A;  4R4I A;  3CW2 C;  4N9P A;  5TSS A;  4DAM A;  3WDN A;  5C44 B;  1T5X D;  2QA4 A;  4NMZ A;  3CCR A;  4OIK A;  4J6H A;  3OSO A;  1QIL A;  3L0O A;  4LMQ D;  3FRP B;  1X3E A;  4Q5V A;  1NSN S;  1V1P A;  3ND9 A;  2IWH A;  1ONL A;  1Q8K A;  1J5E Q;  3AMU A;  5T1G A;  3VA7 A;  2E2D C;  2K14 A;  2EXZ A;  2R6G A;  1SRU A;  3GP7 A;  3TSS A;  4DK6 C;  5M9O A;  4GNX A;  3U58 A;  4LF6 L;  2QKI C;  3K58 A;  3TZD A;  3OTO Q;  1BNZ A;  2BE5 D;  3HOW B;  5JPM C;  3MWY W;  4NDX A;  1L1O C;  4RCN A;  1B44 D;  1SSO A;  4KN7 C;  3HZX A;  1I5F A;  3HOZ G;  3OW7 A;  1HJP A;  4ME3 A;  3TP8 A;  5FLM H;  1PZK D;  1EY0 A;  1VQH A;  4IZ8 A;  1G91 A;  1TWC B;  1ZKO A;  4YWL A;  2NBF A;  5BN3 A;  2SOB A;  2FMC A;  1HQR D;  1HZC A;  2RF4 A;  1O78 A;  4EVO A;  2WII B;  3HKZ G;  2Q8T A;  3RLO A;  2E5L Q;  1O7L A;  1NNX A;  1MI2 A;  1VQ8 A;  2Z4I A;  2P5Z X;  3RR5 A;  1Z47 A;  2B2W A;  3DEO A;  1CKO A;  2Q2U A;  1VQD A;  4ZUJ A;  3D8G A;  4IUU A;  2NYZ D;  5T1I A;  3UE0 A;  1S5C D;  4I7Z C;  1SYC A;  1VQB A;  2CQO A;  3H94 A;  5JEA J;  4JI5 L;  2BDO A;  1SNP A;  1VQO A;  1W2B A;  1FJG L;  3S16 H;  2ZJP A;  1VQA A;  2D62 A;  4DKA C;  4IAL A;  1STB A;  4Y7N B;  4X64 Q;  4QUC A;  4JYA Q;  2H5X A;  3I4M G;  2EYF A;  5CBE E;  2AHO B;  1A15 A;  2XGT A;  1SE3 A;  5ISR A;  4IUV A;  4RHS A;  3S17 B;  4L8J A;  1HNW Q;  1I6V C;  4ZLT F;  2EVB A;  4RGT A;  1W6J A;  3G48 A;  4P71 A;  4BBR H;  2O4X A;  2MPM A;  2UUB L;  4H0L C;  2TMP A;  1T9H A;  2F4V Q;  1AH9 A;  3VR5 A;  5EPL A;  2ZTE A;  1EFW A;  4JI7 L;  2RHQ B;  1STH A;  1TWG B;  4BY7 H;  1EY5 A;  1SYD A;  3UDI A;  4ZUI A;  1IW7 D;  5FLX L;  3GTO B;  1ENF A;  1DCZ A;  3GTK H;  4JI4 L;  1H9S B;  2I5L X;  3CCV A;  3CD6 A;  2KJX A;  1B1Z A;  3PGZ A;  3HOX H;  2IPK D;  4CJ2 C;  2NVY H;  4HTH A;  1JWS D;  3FVQ A;  2YU9 B;  1V43 A;  5IY0 A;  2HHH L;  1MD2 D;  1IBK L;  1BVS A;  1B2T A;  2F0N A;  1TU2 B;  1K8A C;  4K0K L;  1STA A;  1N36 Q;  2DUD A;  3MVV A;  4OIJ A;  3E9H A;  4P2C B;  4DR1 Q;  1N32 L;  1ENA A;  2F0L A;  1I94 L;  4LF4 Q;  4IPC A;  1IXR A;  1LYL A;  2XRQ D;  1J8I A;  1TII D;  4IO9 A;  3UDX A;  3HS0 C;  3ND8 A;  3SE0 A;  3K57 A;  1N34 Q;  1SAP A;  4X6A H;  1QCB D;  4JI2 Q;  2HD3 A;  1EY6 A;  1IKL A;  3GD7 A;  5NUC A;  2ALY B;  5KGU A;  1EQR A;  1HNX Q;  4HIM A;  3G6E A;  4AQY L;  4NXM Q;  1FYC A;  4J15 A;  4NKL A;  4IUQ A;  1SYB A;  4R8I A;  3VR6 A;  2PO4 A;  4DNR B;  2R93 B;  2Q2H A;  4GNX C;  2KCT A;  4PNY A;  5I9P A;  1QNU A;  4GKJ L;  3H0G G;  5C44 G;  1UE6 A;  5ELB A;  4MNO A;  4IPH A;  1RDP D;  3S2H B;  1EIF A;  5KEE A;  3DLL A;  3ZJY C;  1WJJ A;  1QUQ A;  5IYC H;  4KHP Q;  2DY7 A;  2E2H H;  1EU4 A;  4ABN A;  3UE1 A;  1JOR A;  2F0T A;  2N8N A;  1HA6 A;  5K36 G;  2K52 A;  1Y8O B;  4HJ8 A;  2NWG A;  3HOW G;  3FPU B;  4DNI A;  1EYA A;  2PMZ B;  4Q0F A;  5BN5 A;  1Y14 B;  2WB1 B;  4PZ7 A;  5JJK A;  2B2W C;  3RD4 A;  5BR8 Q;  3IFD A;  1DYQ A;  4HN7 A;  2F03 A;  1SMX A;  1UEB A;  5M3F G;  5E3F A;  1XYI A;  1K3B C;  2I5M X;  4DV2 L;  2GN5 A;  4OWW B;  1TY2 A;  3MXN B;  4OHJ A;  2X69 A;  3OIP A;  2IHF A;  1AZQ A;  3BDL A;  4A93 B;  3MXP A;  1HR0 Q;  4A3D B;  2E76 C;  4XQN A;  5GAD C;  2YTY A;  1D5Z C;  1DOL A;  1NMF A;  1J9O A;  1II3 A;  2F0Q A;  2R7Z G;  1YEZ A;  3WWV A;  3HKZ E;  5IP7 G;  5C4X G;  2UXD L;  2GVA A;  4O42 A;  3A8K E;  2DNE A;  2FIN B;  3FKI H;  1XMQ L;  4FF2 A;  2MQH A;  4A3J B;  2BE5 C;  5IGE A;  3T1Y L;  2B63 B;  4ULL A;  1KNA A;  4TVA B;  4KKU A;  3W1G A;  4XT1 B;  2CW0 D;  1C4Q A;  1I3Q H;  2DN8 A;  5C0X I;  2CH4 A;  1B4O A;  3T1H Q;  4EGV A;  5KRU A;  4KHV A;  5CV9 A;  3Q23 A;  1RF2 D;  3MHB A;  3DMU A;  5IIF A;  4DV1 Q;  4IUR A;  4PZ6 A;  4C2M H;  2RQX A;  4OON A;  1JE5 A;  4GOP B;  4DNT B;  4OO1 I;  1YNX A;  1PRT C;  1BXT A;  2Z6K A;  1K73 C;  3HOV B;  2PQE A;  4RWS C;  4KTA A;  4BA2 I;  1L0W A;  4E6I A;  3RLN A;  2NVT H;  1GD7 A;  3J7A F;  2Y0S B;  1QZH A;  4UP9 A;  1QVF A;  3P75 A;  5F2D A;  2MHV A;  1NAP A;  2B8F A;  1NR2 A;  4FO2 A;  3ZYY X;  3S14 B;  1AFP A;  2JEB I;  2KBN A;  3A7L A;  1OXT A;  3GQB A;  1PFM A;  4DAV A;  4KKS A;  5EBD A;  1GOZ A;  4R4C A;  3PO3 B;  3EA6 A;  3M4P A;  3RMH A;  2K05 A;  4RH6 A;  4L5R C;  3OWF A;  2TSS A;  1K83 H;  1VF7 A;  1EL0 A;  2BA0 A;  4NB3 A;  2R92 H;  2AUK A;  2N88 A;  1F77 A;  1SN8 A;  1O80 A;  3BG3 A;  1CTM A;  5IGF A;  4G7Z C;  1R9T H;  1AE3 A;  4QMG A;  3S1R H;  4LJZ C;  3AQQ A;  3A8J E;  4LF5 L;  1BCP B;  1YBY A;  3LNN A;  4IUN A;  4EQP A;  3K0Y A;  4DR3 Q;  2D2C C;  1ET6 A;  1AW7 A;  1XPO A;  5K5P A;  1I4H A;  1SE2 A;  4PZ8 A;  3NTK A;  2F0W A;  1E7Z A;  2NVX H;  1CI3 M;  1SE8 A;  2B2T A;  1ASZ A;  1PTO D;  1BF4 A;  3LWE A;  3P20 A;  4DUY L;  2K04 A;  4V0B A;  1LV9 A;  3I8Z A;  4C1N I; 
#chains in the Genus database with same CATH homology
 1EY9 A;  2ZXP A;  4HSV A;  1S5E D;  1JIC A;  3M85 A;  2EJM A;  2KHS A;  5DAU A;  3V05 A;  3TN2 A;  5C5L A;  3JAM L;  3DWQ A;  3X3N A;  1LTR D;  1Y1V B;  3FPP A;  2YYZ A;  3J81 E;  4KY7 A;  4KY6 A;  4BWG B;  1TWA B;  2PW7 A;  3DM1 A;  2NVQ B;  5C0X H;  2JA7 B;  4ZAI A;  1QG7 A;  1EEI D;  2F0V A;  2IX1 A;  1SNC A;  4U67 3;  3TZU A;  3S1N B;  1A6X A;  4A3K B;  1CK1 A;  2VB2 X;  3Q22 A;  5JVH 3;  3TP5 A;  2HDL A;  1WTX A;  4WJW A;  2IX0 A;  2EDG A;  2VNU D;  2L9H A;  4A3E B;  4AYB B;  1Z7T A;  2MUY A;  2OT2 A;  1G6Z A;  3G7L A;  4ILW A;  2JA5 B;  2BCO A;  3KF8 A;  2F0F A;  2HCC A;  2EY2 A;  3IL8 A;  5CV6 A;  2OEO A;  4G7O C;  2RKS A;  3ERQ A;  1PTO H;  4K14 A;  2EY6 A;  2F0S A;  5IT9 L;  3IAY A;  2ICE C;  4ZRZ A;  4K8J A;  2AQ3 B;  1ZYR C;  3H6M A;  2E74 C;  4A3G B;  1ESF A;  3MZ5 A;  4IFD I;  2WIN B;  3PUV A;  3PUZ A;  2KCC A;  1SDF A;  3MXG A;  5I6Y A;  4WFN 3;  3HG9 A;  5EQ0 A;  1EWC A;  2FMM A;  2XN9 C;  2RDH A;  3E6Z X;  2O2L D;  4C3I B;  3D6W A;  1JCK B;  1HRJ A;  4WRD A;  2WKD A;  1SEB D;  1OXS C;  4DXF A;  3A54 A;  2RVL A;  1MSH A;  1KTK A;  4DN4 M;  3FEW X;  1ROD A;  2F3W A;  5I9O A;  3V2T A;  2DY8 A;  1HXY D;  1GUN A;  3R93 A;  1GUG A;  3NQI A;  1CZG A;  5DM7 3;  1BO0 A;  3GTM B;  2B2T C;  4F88 A;  4ZKB B;  3HOU B;  4IUP A;  5I2X A;  2AQ2 B;  4KHZ A;  1JC7 A;  2EYL A;  4OL7 A;  2PPB C;  3I91 A;  3K5L A;  5HUR A;  3PV0 A;  5COR A;  2A5H A;  5C4H A;  4XDX A;  4X3K A;  1LT3 D;  5I2Y A;  1TT2 A;  1EEF D;  1SJH D;  1G29 1;  1PYW D;  2J7Z A;  4A3B B;  2JA6 B;  2EYH A;  1S4Z A;  2J4X A;  1K8M A;  1SBB B;  4TRD A;  4FYD A;  1V8Q A;  2I46 A;  5C0X J;  1X3P A;  3J81 L;  4EQO A;  2B2U C;  2F0D A;  2L11 A;  1E2W A;  2WAC A;  4K6L A;  3A56 A;  3A7A B;  1O7Y A;  2Z1C A;  4CHT B;  1STE A;  2RBM A;  3SEB A;  1OXX K;  1YNJ C;  5KNC A;  1RJT A;  3RLF A;  1JOO A;  3M3Y B;  3BVM A;  3MFG A;  4HR7 B;  1CHQ D;  2A68 D;  3LWU A;  1LT5 D;  1C48 A;  4HCS A;  1PTO C;  4TSS A;  3CHB D;  3CU7 A;  1JWM D;  2L55 A;  2H1E A;  2A6H D;  4IFD H;  4FXG C;  1LTI D;  1HUM A;  3FMC A;  3QOJ A;  5JPN C;  3J7A V;  4BBS B;  1DXM A;  2F0G A;  1TY0 A;  2PNR C;  2QCP X;  2M2L A;  1NCV A;  3HP3 A;  1CZW A;  1TS3 A;  1ILP A;  1VMC A;  4A3M B;  4CKE A;  3Q24 A;  1SMY D;  5EKL A;  3PUX A;  1LTG D;  3VYR A;  2LMC B;  4QF4 A;  3VYS A;  1NR4 A;  4B9X A;  1VDZ A;  1ILQ A;  3I72 A;  1LTT D;  2AUJ D;  3MXU A;  2OF1 A;  1V1P B;  5ELF A;  4H13 C;  1PTO F;  2EYM A;  1IYV A;  5JVG 3;  1D2B A;  2SNM A;  1F2Y A;  3VR2 A;  4DK0 A;  1H9K A;  3BVG A;  1ENC A;  4L63 B;  3CRL C;  4RFB A;  4FF1 A;  4YIJ A;  1UUP A;  3QOL A;  1BDO A;  4DF7 A;  3R3O A;  5JOB A;  1G2S A;  3S16 B;  4F87 A;  4HAE A;  2L1B A;  1U9R A;  3L7Z C;  2EY5 A;  3D4D A;  3T53 B;  1EZ8 A;  2C9O A;  4IUT A;  4FP5 D;  1RTN A;  5C5M A;  1DON A;  1PFN A;  4KKT A;  4K6D A;  2NN6 G;  5FK9 C;  2ZXO A;  3I70 A;  2KED A;  4CJ0 B;  4BBR B;  2LFN A;  1F2L A;  1YNN D;  2EJG C;  4NW2 A;  4CJ1 B;  1BCP D;  1RKN A;  4N9T A;  2K5W A;  2MJ8 A;  2F0M A;  4BY7 B;  1DJR D;  4IFD J;  3GTK B;  2F0J A;  1HFG A;  3TP6 A;  4DU9 A;  4KJO A;  1QB5 D;  3D6C A;  3HOX B;  1RHP A;  1WTR A;  2PZT A;  3JAM E;  2NVY B;  4I65 A;  4RAU C;  2BDN A;  2MP1 A;  1LTS D;  4LAA A;  2F0P A;  1PZJ D;  3NXW A;  1QWY A;  4KN4 C;  2K7V A;  1JWU D;  1PRT B;  4LK1 C;  2O5J C;  1D6E C;  1HQM C;  5KIX A;  3Q6S A;  1D5X C;  1MGS A;  3NHH A;  1FD7 D;  2XNA C;  1JQY D;  1EFI D;  4U68 A;  4FXK C;  1QE6 A;  4HMI A;  4GZY C;  1LAC A;  2RSO A;  5IGD A;  1STN A;  2HDM A;  1BQQ T;  1ICW A;  1I4G A;  2A68 C;  2EE1 A;  4G57 A;  1XTC D;  3D4W A;  2ICI A;  4BS9 A;  5IGC A;  1ET9 A;  3AB9 A;  1LTB D;  3QJY A;  1WD1 A;  1M4V A;  2L0C A;  3URY A;  5IT9 E;  2XVS A;  2E2H B;  4O1N A;  2FJ2 A;  3QO2 A;  1ESR A;  4BA1 I;  1Q1E A;  4K5W A;  1W6K A;  4PMB A;  1H9J A;  1KDC A;  1UEA B;  3SR1 A;  1LO5 D;  3M7G A;  4CKC A;  3MEH A;  2Z4H A;  3MC0 B;  2A74 C;  2NZ1 D;  5KYL A;  2PZW A;  5EPK A;  2I07 B;  1A3U A;  5DM6 3;  1CA5 A;  5CC4 A;  4S3S A;  5A2Q E;  3BYY B;  1HHV A;  4QIW B;  3K5N A;  1EYD A;  5HGT A;  2KUM A;  1PDQ A;  5JAV A;  3I3C A;  3FKI B;  3J7Y W;  3J80 E;  5EPJ A;  4DAP A;  2L5T A;  2A69 D;  4KV6 A;  2K1B A;  2KEE A;  1IW7 C;  1I3Q B;  5J39 A;  2ENB A;  1IL8 A;  5I6W A;  4FVM A;  3KBG A;  2NTS A;  2RDG A;  3F2U A;  2M00 A;  1WTV A;  4H7B A;  4C2M B;  2SDF A;  2XIW A;  4F7X A;  1BR9 A;  3WOE A;  1T5E A;  4UDU C;  2LS0 1;  5E1F A;  3HRZ C;  2B2V A;  3N52 A;  4XQJ A;  2M9V A;  3NUC A;  2K5Q A;  2EOT A;  4CKB A;  1TKW B;  1AN8 A;  2NTT A;  5CV8 A;  1CM9 A;  4M8A A;  1K83 B;  3H91 A;  3D3R A;  1UAP A;  2R92 B;  1DOK A;  1Q8I A;  1M8A A;  1LAB A;  4TKO B;  1EIG A;  3OHX C;  2B2U A;  5IOC A;  1TQO A;  1R9T B;  3S1R B;  5CV7 A;  3V96 A;  2A6E D;  3L9A X;  3UI2 A;  2O5I C;  4ME5 A;  2RDF A;  2EYO A;  2JYO A;  3DWP A;  4XXE A;  5G3L D;  4XQQ A;  2Z8L A;  3OWE B;  1FNV A;  4QUF A;  3MAQ A;  2NVX B;  1JOK A;  1X3Q A;  3L3O C;  3AU7 A;  3DXJ C;  5KNB A;  1CQV A;  4XT3 B;  1B3A A;  3R2T A;  5C3X A;  2GA4 B;  1I4Q A;  2E2I B;  3M7N A;  2F0O A;  4FF4 A;  2E2J B;  2CVR A;  4XYQ A;  3CQZ B;  5M5X B;  3I4N B;  1A2T A;  1L0X B;  2FHT A;  4ZQ3 A;  1VMP A;  1PMR A;  2F0E A;  3T56 B;  3G6J B;  5J22 A;  3OIQ A;  3C46 A;  3M4O B;  1OXU A;  2ID0 A;  3C3L A;  4KK7 A;  5A2Q L;  4C56 C;  3NPP A;  3HGB A;  3SK6 A;  3EJI A;  3SK5 A;  4RGN A;  1HCZ A;  5ELC A;  4K5V A;  1F9P A;  2IX3 A;  2K5D A;  1Q90 A;  2CW0 C;  1SNQ A;  3KUP A;  2K28 A;  4B9W A;  2F4I A;  1E2Z A;  1EYC A;  1BCP F;  4C3J B;  4R8N A;  4QB4 A;  1PLF A;  2QEJ C;  4RKL A;  1GHJ A;  3J80 L;  2MGS A;  2JSO A;  3H09 A;  1Y8P B;  5CBA E;  2G9H D;  2WP8 J;  2K03 A;  4RGM A;  3BYT B;  3I73 A;  5K36 H;  3QIA A;  2NB0 A;  2IL8 A;  2RSN A;  2ZT9 C;  1PTO B;  2PW5 A;  3RZO B;  2B2V C;  5AFW A;  5EJW A;  1XX8 A;  2WAQ B;  4PMW A;  3R2I A;  1IKM A;  2SEB D;  1SJE D;  4WOR A;  2K01 A;  3KLR A;  1SND A;  1GJX A;  5CR3 A;  2X6G A;  2KVM A;  3BZD B;  2IT1 A;  3EQL C;  2VUM B;  5FO9 B;  3PUW A;  4DK1 A;  2BOS A;  1GUT A;  3I90 A;  3RZD B;  4UAI A;  2OXP A;  1E2V A;  4HMJ A;  1CA6 A;  1RD9 D;  3H0G B;  4HCE A;  1OO9 B;  5D3D A;  3HEJ A;  1D1I A;  3PIP 3;  4RCO A;  3NK9 A;  1TR5 A;  1SNM A;  1WTP A;  3MFY A;  1XXG A;  2PYK A;  3P1H A;  1Q1B A;  2QDB A;  4RKB A;  1F2Z A;  1H9S A;  3NTI A;  4EQN A;  1X32 A;  4JK1 C;  3VYU A;  1E0B A;  3NWS A;  1DZ1 A;  5D65 A;  3S15 B;  5D3I B;  1WVL A;  3OOC A;  1MBY A;  1H9R A;  1GHK A;  5M3F B;  1G2T A;  3CKI B;  4XYO A;  1BOS A;  4JBW A;  5EKK A;  1PRT D;  2F1M A;  2XRS D;  3KK7 A;  3OMC A;  5DNF A;  1Y8N B;  2EYJ A;  3S9W A;  2E75 C;  4K2L A;  1CHP D;  1R4P B;  1JE4 A;  1HTL D;  2A6E C;  5J1Z A;  4ZKC B;  2R7Z B;  3DWA A;  2RA4 A;  2FFK B;  2KEC A;  5C4X B;  4Z9C B;  4HED A;  1LT4 D;  5I4D A;  4NP5 A;  4C3I G;  1A2U A;  5C0X G;  2KQ3 A;  3KLS X;  3GO5 A;  2R3Z A;  5A35 A;  2L4N A;  4C1N K;  4ZK9 B;  4PQX A;  4OO1 G;  4RGO S;  1OXV A;  3GV6 A;  1R4Q B;  4C3J G;  4DFA A;  2HCI A;  4XTC S;  4KY5 A;  1O7Z A;  4H44 C;  1SYG A;  3A55 A;  1SYF A;  3K6O A;  2JEA I;  2QIL A;  1B9M A;  2LKV A;  1ZEQ X;  2BA1 A;  2F3V A;  1A3V A;  4FXD A;  3TP7 A;  2KCN A;  2AWO A;  2F0U A;  4M1U B;  3BDC A;  4L6T B;  3K5O A;  3GTL B;  2XWB B;  3MXN A;  5EGT A;  1LT6 D;  2EJF C;  3X3M A;  1Q12 A;  1RTO A;  4X3T A;  3S1Q B;  5JEA G;  1TS2 A;  1WTW A;  4KD3 A;  1B50 A;  3U9O A;  2JXM B;  5D14 A;  5G3L F;  1FNU A;  4A3I B;  5IGG A;  5CYU A;  2QF7 A;  3RUZ A;  2L12 A;  4FNF A;  3BVZ A;  3NBI A;  2D5D A;  5EKI A;  1WD0 A;  4G7H C;  1HPC A;  2EZV A;  3PO2 B;  5IOD A;  1KLU D;  1D1K A;  3H3V C;  3K5M A;  3R8B A;  1JB3 A;  1I6H B;  1BBX C;  1F9R A;  2JA8 B;  3QG1 A;  3NTH A;  1U4M A;  2C5C A;  1DM0 B;  3WOF A;  1DOM A;  1GUW A;  4KJN A;  1LLR D;  4K5X A;  4K8I A;  4MN3 A;  4C3H B;  1I4R A;  3SXH A;  3PIO 3;  3P7J A;  5FO7 B;  1EOT A;  2R61 A;  1EY8 A;  2WV6 D;  1RCV D;  3EVQ A;  5DEH A;  2K6A A;  1Y1W B;  4IN3 A;  3VR4 A;  3K7A B;  1G8Z D;  1ZYR D;  1JOQ A;  3ERO A;  2XSC A;  2SNS A;  3D4R A;  5ELE A;  1DD2 A;  4QCL A;  1U4P A;  1TS4 A;  2K33 A;  1STY A;  1Q3L A;  3T16 A;  1Y69 U;  5CV4 A;  4F8M A;  3VA5 A;  2A73 B;  1WCM B;  2A6H C;  3ONA B;  4X3S A;  3C1F A;  2F0I A;  5BN4 A;  3DUZ A;  2N55 A;  4ID6 A;  1FGB D;  5CGK A;  2K32 A;  3Q0A A;  1PZI D;  4DGZ A;  3OPO A;  2JE6 I;  3PUY A;  3W3A A;  3KLS A;  1F2M A;  1F9Q A;  2EYP A;  4IFD G;  2VB3 X;  2KOL A;  4PV1 C;  1SMY C;  1FR3 A;  3OMG A;  1HUN A;  5KYI A;  4ODG A;  4KI0 A;  1EZ6 A;  1WTQ A;  1STG A;  4J8Q A;  4CGY B;  1I4P A;  2V4D A;  5EBC A;  1AP0 A;  1EY4 A;  5C3W A;  3T51 B;  4XIG S;  3SK4 A;  4CBV A;  1H9M A;  2EY1 A;  3ITP A;  2G9D A;  3D31 A;  1QOH A;  3SDZ A;  1KNE A;  1ZXT A;  3I4L A;  4BY1 B;  2DNC A;  2NN6 I;  2Q8I B;  5M3M B;  1JR0 D;  1KAB A;  3DHQ A;  3MA2 B;  5LHY 1;  1MSG A;  1Z6H A;  1YNJ D;  1B9N A;  5JJZ A;  2Q8R E;  4J1M A;  3E5S A;  3GTP B;  3O13 A;  2NVT B;  4PMC A;  1SXT A;  4MHE A;  4DAY A;  2B2Y A;  1I50 B;  2F0H A;  1I4X A;  1D5M C;  3GTJ B;  3GTG B;  4X3U A;  2CQA A;  1TVX A;  1PRT F;  5CV5 A;  2D9U A;  3A8I E;  1TS5 A;  1EWH A;  2NUC A;  2PZU A;  4RHR A;  3HOY B;  1PXU A;  2H4O A;  1HFN A;  3GV3 A;  1A3T A;  4KD4 A;  5ELD A;  1QJO A;  2B8G A;  1EQT A;  3FDT A;  3NE5 B;  5IGB A;  4OGQ C;  4C3H G;  3SVM A;  3TBI B;  1U4L A;  1YNN C;  3C1E A;  5LL6 X;  1EQV A;  1BCP C;  1PFB A;  2AQ1 B;  1TWH B;  3GTQ B;  1U4R A;  1CT1 D;  1VCI A;  4DXG A;  2B39 A;  4FF3 A;  1S5D D;  3EFX D;  4A3F B;  3IFT A;  3HOZ B;  5C4J B;  4OO1 H;  3NWT A;  3LX0 A;  1S5B D;  3KBX A;  1IYU A;  4K2K A;  4V19 0;  1SYE A;  2ZXR A;  3QWN A;  3HKZ B;  3U9S A;  5C6A A;  2KA7 A;  3NP8 A;  1BUV T;  3T4A C;  2IJ0 A;  1WTO A;  2PCF B;  1EY7 A;  5LL6 S;  2F0K A;  5FO8 B;  5C3E B;  1QNK A;  2JP1 A;  1F9S A;  1B53 A;  3C2P A;  3E0J A;  4ZYS A;  2J0T D;  5COY A;  2X6L A;  4MIU A;  5M5W B;  5KND A;  3I4M B;  3MTS A;  1SNO A;  3SK8 A;  2EPB A;  3DEP A;  1AEX A;  1AZP A;  1HTP A;  5JEA H;  2HUG A;  2NN6 H;  4IQZ A;  1L0Y B;  3NQT A;  3NSW A;  3S2D B;  3N6R A;  4B08 A;  1LTA D;  1KDB A;  1UNS A;  5FKA C;  1SFO B;  4TQU S;  1CFM A;  3VYT A;  5E4W C;  1GUS A;  1KAA A;  2VXW A;  1FNW A;  1CQF A;  4R9W A;  3SHL A;  3M4Y A;  5FLX E;  4DA2 A;  1HA5 A;  1TWF B;  2WKC A;  2CHB D;  1EU3 A;  5E4X A;  3IKJ A;  4G4K A;  1GXD C;  3W2D A;  3K59 A;  2B2Y C;  3PMF A;  3BS1 A;  1IHZ A;  4KMU C;  2AWN A;  1SE4 A;  2HQE A;  3VR3 A;  1EIH A;  5CMD A;  1NUC A;  1XWE A;  2LY7 A;  4RA8 A;  4HSP A;  3TME A;  5M5Y B;  3TDQ A;  3NBH A;  1C8C A;  5C4Z A;  3QB3 A;  3S1M B;  1ML0 D;  1KLG D;  1VF5 C;  1K8O A;  2IW3 A;  1GUO A;  2XWJ B;  5FOB B;  1V1O A;  1S5F D;  1KDA A;  3CRK C;  2A69 C;  3BDO A;  3T13 A;  4N9P A;  5TSS A;  3WDN A;  5C44 B;  1T5X D;  4NMZ A;  4OIK A;  4J6H A;  3OSO A;  1QIL A;  4LMQ D;  3FRP B;  4Q5V A;  1NSN S;  1V1P A;  3ND9 A;  2IWH A;  1ONL A;  3AMU A;  5T1G A;  3VA7 A;  2E2D C;  2R6G A;  2EXZ A;  3GP7 A;  3TSS A;  5M9O A;  2QKI C;  3K58 A;  3TZD A;  1BNZ A;  2BE5 D;  3HOW B;  5JPM C;  3MWY W;  4NDX A;  4RCN A;  1B44 D;  1SSO A;  4KN7 C;  3HZX A;  3OW7 A;  3TP8 A;  1PZK D;  1EY0 A;  4IZ8 A;  1G91 A;  1TWC B;  1ZKO A;  2NBF A;  5BN3 A;  2SOB A;  2FMC A;  1HQR D;  1O78 A;  4EVO A;  2WII B;  2Q8T A;  1O7L A;  1MI2 A;  2Z4I A;  1Z47 A;  2B2W A;  3DEO A;  4ZUJ A;  3D8G A;  4IUU A;  2NYZ D;  5T1I A;  1S5C D;  4I7Z C;  1SYC A;  3H94 A;  5JEA J;  2BDO A;  1SNP A;  2D62 A;  4IAL A;  1STB A;  4Y7N B;  4QUC A;  2EYF A;  5CBE E;  1A15 A;  1SE3 A;  5ISR A;  4IUV A;  4RHS A;  3S17 B;  4L8J A;  1I6V C;  4ZLT F;  2EVB A;  4RGT A;  1W6J A;  2O4X A;  2MPM A;  4H0L C;  2TMP A;  3VR5 A;  5EPL A;  1STH A;  1TWG B;  1EY5 A;  1SYD A;  4ZUI A;  1IW7 D;  5FLX L;  3GTO B;  1ENF A;  1DCZ A;  1H9S B;  2KJX A;  1B1Z A;  2IPK D;  4CJ2 C;  4HTH A;  1JWS D;  3FVQ A;  2YU9 B;  1V43 A;  1MD2 D;  1B2T A;  2F0N A;  1TU2 B;  1STA A;  3MVV A;  4OIJ A;  4P2C B;  1ENA A;  2F0L A;  2XRQ D;  1J8I A;  1TII D;  3HS0 C;  3ND8 A;  3SE0 A;  3K57 A;  1SAP A;  1QCB D;  1EY6 A;  1IKL A;  3GD7 A;  5NUC A;  5KGU A;  1FYC A;  4NKL A;  4IUQ A;  1SYB A;  4R8I A;  3VR6 A;  2PO4 A;  4DNR B;  2R93 B;  4PNY A;  5I9P A;  1QNU A;  5ELB A;  1RDP D;  3S2H B;  5KEE A;  2DY7 A;  1EU4 A;  4ABN A;  1JOR A;  2F0T A;  1HA6 A;  5K36 G;  1Y8O B;  2NWG A;  3FPU B;  1EYA A;  2PMZ B;  4Q0F A;  5BN5 A;  2WB1 B;  2B2W C;  3RD4 A;  3IFD A;  1DYQ A;  4HN7 A;  2F03 A;  5E3F A;  1XYI A;  1TY2 A;  4OHJ A;  2X69 A;  3OIP A;  1AZQ A;  3BDL A;  4A93 B;  3MXP A;  4A3D B;  2E76 C;  4XQN A;  1D5Z C;  1DOL A;  1J9O A;  1II3 A;  2F0Q A;  4O42 A;  3A8K E;  2DNE A;  2FIN B;  4FF2 A;  4A3J B;  2BE5 C;  5IGE A;  2B63 B;  4ULL A;  1KNA A;  4KKU A;  4XT1 B;  2CW0 D;  1C4Q A;  2DN8 A;  5C0X I;  1B4O A;  4EGV A;  5KRU A;  4KHV A;  5CV9 A;  3Q23 A;  1RF2 D;  3MHB A;  3DMU A;  5IIF A;  4IUR A;  2RQX A;  4DNT B;  4OO1 I;  1PRT C;  1BXT A;  3HOV B;  2PQE A;  4RWS C;  4KTA A;  4BA2 I;  4E6I A;  3J7A F;  2Y0S B;  3P75 A;  5F2D A;  2MHV A;  1NAP A;  2B8F A;  1NR2 A;  4FO2 A;  3ZYY X;  3S14 B;  1AFP A;  2JEB I;  3A7L A;  1OXT A;  3GQB A;  1PFM A;  4DAV A;  4KKS A;  5EBD A;  1GOZ A;  3PO3 B;  3EA6 A;  3RMH A;  2K05 A;  4RH6 A;  3OWF A;  2TSS A;  1VF7 A;  1EL0 A;  2BA0 A;  2AUK A;  2N88 A;  1F77 A;  1O80 A;  3BG3 A;  1CTM A;  5IGF A;  4G7Z C;  4QMG A;  4LJZ C;  3A8J E;  1BCP B;  3LNN A;  4IUN A;  4EQP A;  3K0Y A;  2D2C C;  1ET6 A;  1AW7 A;  5K5P A;  1I4H A;  1SE2 A;  3NTK A;  2F0W A;  1CI3 M;  2B2T A;  1PTO D;  1BF4 A;  3LWE A;  3P20 A;  2K04 A;  4V0B A;  1LV9 A;  3I8Z A;  4C1N I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...