1KABA

Stress and strain in staphylococcal nuclease
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYGPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Stress and strain in staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
total genus 41
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1992-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1kabA00
4QF4A 1A2UA 3OSOA 3TMEA 4F8MA 1TT2A 3C1EA 3OWFA 4KD4A 2RDFA 3LX0A 4K2LA 3VA5A 5KRUA 5EKLA 2F0KA 5C3WA 2F0HA 3OMGA 5JAVA 2EXZA 2OXPA 3SXHA 5CV9A 5IGBA 1U9RA 2PW7A 4S3SA 1A3VA 5IGEA 5KIXA 2EY6A 2F0UA 5CR3A 4DFAA 2F0WA 3D8GA 4KHVA 4KTAA 2EY2A 2OEOA 3MVVA 3MXPA 4NP5A 4J1MA 1TR5A 2PYKA 4RKLA 4K2KA 4N9TA 4R8NA 4RKBA 3TP6A 1EY5A 1SNMA 4E6IA 3TP8A 5I6YA 4WORA 5J22A 4KY7A 5IGGA 1EY8A 3R3OA 4K5WA 2SOBA 3SR1A 1SNCA 3BDCA 1STHA 5CV7A 4K5VA 5J1ZA 3U9OA 1STAA 3SHLA 4EQPA 4G57A 3EVQA 5CV8A 2F3WA 3QOJA 4TRDA 1STYA 5HGTA 3SK6A 5CC4A 2F0FA 2F0MA 1EYAA 1SNPA 4KJOA 2F0PA 4K5XA 4H7BA 1STBA 4PMBA 4ZUIA 4B9XA 4EQNA 3D6CA 2SNMA 3RUZA 1EY4A 1SYEA 1JOKA 3MZ5A 4J6HA 5IGFA 3QOLA 4QB4A 2SNSA 4IZ8A 5EKKA 5HURA 5I9PA 2EYHA 2F0OA 2F0QA 3D4DA 2PZWA 4KD3A 4YIJA 2EY5A 3BDLA 1F2MA 5NUCA 1STNA 4F7XA 5IOCA 2EYLA 3ERQA 4IUNA 3TP5A 5IGDA 1NSNS 1NUCA 1A3TA 3DMUA 3P75A 5C3XA 1KDCA 4ID6A 5CGKA 5I9OA 5KEEA 1SYDA 5ISRA 1IHZA 1EY9A 4PMCA 1SYGA 1A3UA 5CV6A 5DEHA 2EYPA 4HTHA 4HMJA 1SNOA 4NKLA 3NK9A 3HZXA 5KYIA 1SYBA 2RBMA 3NUCA 5F2DA 3PMFA 2OF1A 2PQEA 4KV6A 3OMCA 4DF7A 2EYMA 4DGZA 5J39A 4ZQ3A 1II3A 2M00A 1KDBA 3E5SA 1KDAA 1SNQA 2EYFA 4KY5A 1JOOA 4NDXA 3T16A 2RKSA 4HMIA 5C4ZA 2F0DA 1EYCA 2F3VA 2NUCA 1SYFA 4K14A 3P1HA 3QB3A 4LAAA 4ODGA 1F2YA 1SNDA 2F0LA 4KJNA 5DAUA 5M9OA 2PW5A 3SK5A 5KYLA 1EY6A 5E3FA 4K8JA 2F0SA 3DHQA 3MEHA 5C5MA 1ENCA 3ITPA 1A2TA 4ME5A 3SK4A 1KABA 5KGUA 2EY1A 4I65A 5IODA 3MHBA 3EJIA 5CV5A 3NXWA 4EVOA 4WRDA 2O4XA 1KAAA 5C4HA 2F0IA 5K5PA 5I6WA 4PNYA 1SYCA 1F2ZA 4NMZA 4DU9A 1RKNA 1EQVA 1EY0A 2ENBA 3H6MA 3NHHA 3NQTA 5C6AA 5IIFA 1JORA 3V2TA 2KQ3A 1EZ8A 4N9PA 4KY6A 5C5LA 4OL7A 2LKVA 4K8IA 2KHSA 4IALA 2EYJA 2QDBA 3SK8A 3TP7A 5JOBA 1ENAA 2F0JA 3C1FA 1STGA 3NP8A 3T13A 1TQOA 1AEXA 2F0EA 1EZ6A 4EQOA 4QMGA 5CV4A 4B9WA 5E1FA 2F0GA 2F0VA 2F0NA 5IGCA 2PZUA 2WACA 4K6DA 2EYOA 1JOQA 2HQEA 3EROA 2F0TA 3HEJA 1EY7A 1EYDA 4MIUA 3S9WA 5EGTA 4ZUJA 2PZTA 3D4WA
chains in the Genus database with same CATH superfamily
2G5DA 4QJFA 1C4QA 4MTNA 2F0HA 3SXHA 1KIXA 3J7A5 1SMYC 4DAMA 1K73C 3LNNA 1X3FA 2R7ZG 2A19A 4KHVA 1B7YB 2OEOA 5FO7B 3OHXC 4XQNA 4C2MH 3VYTA 5FLXL 2NVYH 1N32Q 5IGGA 3R2TA 2CWAA 3M85A 2UXBL 3AB9A 3SHLA 4POGA 3PIO3 1RD9D 4YCUA 3CCJA 5ELNA 2VQFQ 1JE5A 3OYYA 4H7BA 4PMBA 1LTGD 3IRBA 1CZGA 4JI5L 1VQLA 1BUVT 1NE3A 4LUOA 5C44G 2KHIA 5IP7H 5M3MH 3U4ZA 1GJXA 1I94L 4M1UB 1AZQA 4YHHQ 1BXTA 2AWNA 4IUNA 4LK1C 1LO5D 2OQKA 1F9RA 1CSPA 1OXTA 5HY6A 3GTLH 1MSHA 4A93B 1TS2A 2OF1A 2PQEA 4OEMB 4KV6A 1T9HA 4A3IH 3T1HQ 1I4RA 4HJ9A 3VYUA 2B8GA 2NUCA 4EGVA 3J81c 3W1BA 3C3LA 3QB3A 4ZAIA 1RL2A 5JJKA 1EUJA 3OOCA 1SDFA 2XNAC 1AE3A 4CJ2C 3KJOA 3HOYG 1PFMA 4KKTA 1XWEA 3RMHA 3M3YB 1JC7A 5K5PA 3S24A 2PMZB 2AKWB 4LMQD 5JJIA 1EL0A 2Y0SB 3HG9A 3J7ZC 4DR7Q 3CCSA 4JBMA 4ZK9B 2I46A 4DR3L 5ELOA 1J9OA 4A3DH 2VS1A 4A3KB 3TEHB 2KQ3A 3KFUA 4B3TL 1I4HA 5IP7G 4DV3L 2E2HB 2C5CA 2K4KA 3MFYA 3M4YA 1GHKA 1EZ6A 4QMGA 1RODA 3I4LA 1EYGA 1HNWL 4FF2A 2EYOA 1DD2A 1TWAH 1G291 3I91A 4TSSA 3WOFA 2FJ2A 2NVQB 1G2SA 1N9WA 4A3IG 1FD7D 2EXDA 3PV0A 1WOCA 5FLMH 4DV0L 1U9RA 4EX5A 3C46A 1A3VA 4C3JG 2XWJB 1CM9A 1J8IA 2FMMA 4DUZQ 1TWGH 3BYYB 3CQZH 2LY7A 4X3KA 3CCMA 1UEBA 2PYKA 2WB1B 3DWAA 3KLRA 3KF8B 1JWMD 3G6JB 4LF5Q 1STHA 5KNBA 1L1OA 3RZDB 1I6HB 4KK7A 2F3WA 1STYA 4A3DG 1EIFA 4JYAQ 3PIPA 3CP0A 3U4VA 4HEDA 2G9HD 3EBEA 3A0JA 1JB7A 4BBSG 2A74C 3D3RA 2SNSA 4JI6L 3HS0C 2VQEQ 3J81E 1Y1VH 2ZXOA 3QG1A 1LYLA 4HJ7A 1XMOQ 1J5EQ 2G9DA 1K8GA 2K32A 2PNRC 3MA2B 2F4VQ 2J4XA 2DNEA 4IPGA 3AYHB 5C44B 3NK9A 3HZXA 1XPRA 4YWMA 4BY7G 5FLMG 1VQ8A 3A8IE 2Z0SA 1PXUA 3UI2A 1Y8PB 5C0XI 4GN5A 1F9SA 3R8BA 2B2VC 1S5BD 1VQ9A 2D0OA 5DM63 4FO2A 1U0LA 5ELBA 3S1NB 1CFMA 1OXVA 3I70A 5AJ3L 1W2BA 1BCPF 3UDGA 2RSOA 1XJVA 2L55A 2ENBA 1S5DD 3PUZA 1JJGA 1N33L 4IALA 3HOYB 4OO1H 4NXNL 1N32L 1X3EA 4NB3A 2SEBD 3BZKA 1O7YA 1T5XD 3C1FA 4X62L 1IYVA 1Y1VG 2J7ZA 1Q46A 5IWAL 2F0GA 2UUAQ 2OT2A 1A6XA 3K81C 1SE3A 2R7DA 2IL8A 4BBRB 4RFBA 3S9WA 1LV9A 4A3FB 4FF4A 3H3VC 4A3EH 3RLNA 1V1QA 1QZGA 3I56A 1JB3A 4YY3L 2O2LD 3I55A 1XXGA 1N34L 1F77A 4JI0Q 3D31A 3GTQH 1X3PA 1F2LA 3RD4A 2X6LA 1EQTA 1RIPA 1IXRA 2WAQG 3OW7A 1LTSD 3PUVA 2Z9HA 2X6GA 4G7OC 4C3IH 3EFXD 2FINB 1SNPA 2CWPA 4U673 1FL0A 3S15H 1SYEA 1JOKA 4GKJQ 3LWEA 5IGFA 4YCWA 1Z9FA 2EZVA 4YIJA 3D4DA 2RDGA 4GZYC 3BDLA 1WTXA 1F2MA 1B8AA 2HDLA 4DR4L 3GTGB 1B70B 4PZ7A 2B63H 4YWKA 1GUSA 4FP5D 5C3EG 3H94A 2BE5D 3QO2A 2ASBA 4GN4B 4A3EG 1TKWB 2Q2TA 2R93H 3PMFA 4KHPQ 3AQQA 4HJ8A 2CQAA 5J39A 1CQVA 3S2DB 2F4IA 2WKDA 5E4XA 4A3GH 1LTRD 4YWLA 4RKBA 1TS5A 4DKAC 1Z7TA 5BN3A 2GN5A 2H1EA 4DK3C 5C5MA 4OWXB 1HFNA 4RGNA 4O0AA 4CJ1B 3NXWA 2F0IA 2XN9C 1QOHA 1PYBA 1I5FA 4JW0A 5IY0A 2MQHA 5FKAC 1E22A 5FK9C 1UUPA 3GO5A 1R9TH 3WDNA 4FXGC 5CORA 3H3VH 2L5TA 3T13A 4MNOA 4JI8L 3J81j 2N88A 1CKOA 4JI2L 3FPUB 1B50A 1U5KA 1LTTD 3R93A 2DNCA 1I4PA 2B63G 1BVSA 1GD7A 2AQ1B 3UDIA 3CMAA 2E5LL 1A2UA 3GDEA 4F8MA 1TT2A 2NN6G 4KD4A 3LX0A 3KDFB 2K28A 2NVXH 3QWNA 4LF6L 3ICEA 3K7AH 2VQEL 5IGBA 4RG1A 4A3GG 4O42A 1B2TA 2EJMA 4ME3A 3FPPA 4L8JA 2PI2E 2VXWA 1QWYA 4RKLA 2GA4B 3HOWH 1K0RA 1L1OC 4KY7A 4WORA 5J22A 2R3ZA 3GTJH 2EJFC 1WCMG 1ZEQX 3BJUA 1V1PB 2K6AA 1VCIA 4IURA 1YI2A 3SGIA 5CC4A 3OIQA 3GTKB 1EYAA 3K7UC 1BCPB 5ELDA 2UXDQ 3FP9A 4L63B 4JI7Q 3M7NA 4DV1Q 1HH2P 1Q1BA 3MZ5A 3PO3B 1LT3D 4GLVB 4X3TA 1YJNA 2LXJA 4A3JH 1STNA 2JA9A 1B3AA 1GO3E 1MJCA 4GOPB 4OX9Q 1HA5A 2DY8A 1K83B 1KL9A 1EY9A 1I4QA 5EPLA 3DLLA 2CVRA 4JI3Q 1SNOA 4DR6L 2UXCQ 4HJ5A 3RLFA 3GTPH 4UP9A 3TZUA 4HCEA 5M3FH 3MXNA 1UE7A 2D0PA 4ALPA 4NDXA 2RQXA 4K14A 1F2YA 2KCCA 3HOWG 4UDUC 1M90C 4B3SL 4BA2I 4NPSA 1ENCA 4A3MH 2R92H 5IT9c 2LMCB 1G2TA 2IX3A 1GUGA 3CC2A 4JC0A 1SFOH 1KAAA 2KEDA 1KC8C 5I6WA 1PRTF 3PUXA 3HKSA 2NTSA 2X69A 4LFCL 1EQVA 1JORA 2FFKB 4FNFA 2QCPX 2UXBQ 1GHJA 1NBWA 1K3BC 2KHSA 3SK8A 4OIKA 2MPMA 4QIWB 1X32A 2YU9B 3BDOA 2K03A 2KECA 4HJAA 1O7IA 4RGTA 3Q23A 1I50B 1JICA 2K14A 3FHWA 2HQEA 1AFPA 4LF9L 4H13C 2DGYA 3H15A 1ET9A 2A69C 1FGBD 2PPBC 1I94Q 2C9OA 2CW0D 5M3FG 4OWTB 3A7AB 4IPCA 1SJED 1O7ZA 3KDFA 4KI0A 4S3SA 2P5ZX 4AYBE 3GTOH 1XPOA 1Q81C 1OXSC 2R92G 4HIOA 1TR5A 1EFWA 4K2KA 3BVZA 1BKBA 3BYTB 5H1SE 3S1RB 3J81i 3S1QB 5LHY1 4E6IA 4GKKL 3CCUA 1VQFA 1S5FD 4K5WA 1D5ZC 2PCFB 3U9OA 5IP9H 4G57A 3TRZA 5CV8A 3I4NB 1AE2A 2N55A 1QG7A 2ZJQA 4PMWA 4K5XA 4GLXA 1V1PA 5C0XJ 1MI2A 3S1MH 3N6RA 4CDEC 5KNDA 5M5YB 1TS3A 4A93H 4DR3Q 1GUOA 2E74C 3W2DA 2K5WA 1Y1WG 2EYHA 2FHTA 4DK0A 2PZWA 4Y7NB 4DV4L 4B3TQ 4DV3Q 3TZDA 1WJJA 3PF5A 5IT9E 4PMCA 4X65L 1IL8A 4HTHA 5LMNL 4GOPA 1HNWQ 2A68D 4IFDG 3J80c 5EJWA 1SSOA 1PTOD 3FKIB 1II3A 4RHSA 4YCVA 1SNQA 3DWQA 4RCNA 3PO2G 4IJHA 2QILA 1TS4A 4A3KH 4DV0Q 3DEPA 3SK4A 5KGUA 1JMCA 3T53B 2E2HH 2NN6I 5T1IA 3FMCA 1X9NA 1CKNB 1C9OA 5LMNW 3K5OA 5JEAJ 1N8RC 2XIWA 3LGJA 2IHFA 4R1JA 2AQ3B 3JC66 1HPCA 4R9WA 2HIVA 1B44D 1FJGL 1WTHA 2CQOA 1IL2A 1SAPA 1JT8A 5C4JB 2NVQH 2QDBA 3G71A 3S14B 1TQOA 2EIFA 4CDDC 4IPDA 2KCNA 5CV4A 4HN7A 3H0GH 5JVH3 1CQFA 1JOQA 3NBHB 1K28A 4JI6Q 2QKIC 4XT1B 2PZTA 3AFQA 2ZXRA 1X3GA 5M5WH 4P75A 3S2HB 2JA6G 4RAUC 2ID0A 2Q2HA 2OXPA 2JA7G 4RCOA 3A56A 2CH4A 1TU2B 2HQLA 5IGEA 3RZDH 2RDHA 3G6EA 2XRSD 1I6HH 1CUKA 2YTXA 3CC7A 3ZYYX 4AH6A 3HOVB 5TSSA 1B9NA 1EY5A 2PO4A 1D1IA 3TP8A 1QUQB 4UP8A 3KF6B 4U68A 2E75C 5G3LD 3SR1A 2L9HA 4K5VA 3CAMA 1TY0A 1PH5A 4I7AA 5HGTA 4DAYA 4IUQA 4B9XA 1PRTB 1ESFA 3SDZA 5AJ3Q 3D6CA 1BBWA 1PH3A 4JOIA 3J80E 2YTVA 1BBUA 3Q6SA 1XNQL 4DNRB 4WJ3M 1WTOA 2VUMH 3KLSX 4APVA 3A54A 4AIMA 3H0GG 3TP6A 1K0SA 1N33Q 2QEXA 4OELB 3N52A 2CCZA 4NXNQ 4A75A 3R2IA 1P8LA 2JA8G 5KEEA 4X62Q 1PFNA 4GLAC 1SBBB 3F2CA 3CC4A 1TWFH 1F9QA 5IWAQ 5GAGC 1SXTA 1Y1WB 2MNAA 2OTJA 4KN7C 5CMDA 3S1NH 4P74A 3UE0A 1BQQT 1PTOB 4RWSC 2D2CC 1C8CA 1YJ9A 1MGSA 5M9OA 1NR4A 1IBLL 2AWOA 4YY3Q 1VQ4A 5JEAG 4IOCA 2HD3A 1KXLA 1U4MA 2RVLA 1PYSB 1ENFA 1N34Q 1B4OA 3NWSA 3J81L 4NMZA 1RKNA 1IW7D 1VF5C 3NHHA 4F87A 1CKNA 3EA6A 1N36L 1DOKA 4BBRH 2Q8IB 4K8IA 2E2IB 4O2DA 3PIP3 5JOBA 2O5JC 1VQ6A 3NP8A 3FEWX 1JWUD 4CHTB 4X3SA 3ONAB 4DR1L 1VQMA 1PZJD 1CSQA 3HP3A 2AUKA 4XYOA 4A4IA 4AQYL 4C3HH 4QF4A 3WWVA 4XDXA 4DR4Q 2MUYA 1LTID 4B3ML 4IJLA 1HA6A 1HNXL 3F2DA 4BS9A 1XMQL 2PW7A 5M3MG 2VZAA 1QCBD 4QY7A 2Z8LA 5LL6X 1WI5A 2F0WA 2DUDA 2WIIB 4L5TA 1YNNC 4P71A 2BOSA 2B2WA 1SNMA 2TSSA 3MFGA 2JA6B 4MTKA 3JAMc 4GNXB 4IFDI 2WKCA 3BDCA 1B1ZA 2N3SA 3DXJC 2FMCA 4TRDA 4DV6L 1FYCA 5ELFA 2F0FA 4BA1I 1YIJA 3GTGH 3QR8A 2AHOB 3IL8A 1BCPC 2MHVA 1CA5A 3U58A 4NXML 3ZJYC 3L2PA 5EKKA 4X6AH 2PMZE 2A6HC 2K05A 2EY5A 1WTRA 5A35A 5JPNC 2N8NA 3S2DH 4G7HC 1A3TA 3DMUA 3VR3A 4GOPC 4C3HG 1UEAB 1E2VA 3K5LA 5CV6A 1LT6D 4JI8Q 2ALYB 3G4SA 2K5DA 4CKBA 2O5IC 4JI2Q 3ER0A 3I4MH 1WD0A 2IW3A 4IQZA 2E2JB 5F2DA 1CTMA 4G4KA 2L4NA 2R7ZB 1PA6A 1FVIA 2N49A 2BE5C 2EYMA 2OQ0A 3OW2A 1OXXK 2E5LQ 3K59A 2F3VA 2JA8B 3DEOA 1EOTA 2KEEA 3P1HA 2H4OA 3RZOB 4LF6Q 2Z6KA 5KYLA 3Q22A 3DHQA 3A7LA 2R61A 5CV5A 1A0IA 4EVOA 1HUMA 2BA1A 4CKEA 1SMYD 2PQAB 3K5NA 2JK8A 2WB1E 3CD6A 2AUJD 1H9KA 2A5HA 4KKSA 2NWGA 1I4XA 1SN8A 2JA5H 1STGA 1SE8A 3OTOL 1VQJA 1IKLA 4P72A 3K6OA 3RN2A 5IYBH 2F0VA 1ZYRC 1YNXA 3L3OC 1D8LA 3CU7A 3SE0A 4PV1C 3I4MG 3JAME 3D4WA 3F8TA 1VQIA 3TMEA 4P73A 1W6JA 5KRUA 1Q12A 1C7YA 5CV9A 4C2MB 2NVYB 4DR6Q 1SJHD 2F0UA 1LT4D 1WD1A 3D8GA 3NELA 4J1MA 2XTIA 3H09A 3NTHA 5BN5A 1EY8A 2YTYA 1BNZA 3PO3H 2VB2X 4Q0FA 2EPBA 1EWHA 1LUZA 5C4XH 4B3SQ 1H9RA 1Q8KA 1IYUA 5M3MB 4GNXA 1TIID 2F1MA 4JOIC 4CDFC 5T1GA 1K83H 2JA5G 4LFCQ 4J6HA 2AMCB 1FNWA 3QOLA 1S40A 4GS3A 3GTLB 5CBEE 1L0YB 2K5NA 1S72A 4N8FA 1QZHA 1KRSA 4A3IB 2A73B 4XQQA 4R8IA 1SYDA 3H91A 4B08A 1VQBA 3KF8A 4C3JB 2BDOA 1Q3LA 4FDBA 4LF9Q 3KLWA 4DF7A 1UE1A 5BR8L 2EYFA 4OO1G 1HZ9A 2RKSA 4KKUA 2F03A 3GTMH 1E1OA 2B29A 2R6GA 3SK5A 5E3FA 1A15A 1O78A 3ITPA 1A2TA 4A3DB 1XYIA 2NVTH 1HZAA 1WTPA 5IODA 2IY5B 3URYA 2D5DA 2ZTCA 4XXEA 4F88A 2HCCA 4DXGA 4DPGA 3BVGA 4GKKQ 3HOXH 4BBSB 1XNRL 3V2TA 3S17H 4ILWA 2Z4HA 1RHPA 4A3CH 1TWAB 2PQAA 1D5MC 1HXYD 3HGBA 5LL6S 4TKOB 4A3BH 3M9BA 3U50C 2NTTA 1V8QA 2TMPA 4K6DA 4BY7B 1S3OA 2IWHA 3A74A 1F9PA 3MXUA 3T1YL 2LXKA 4DV4Q 1S4ZA 1TWGB 1RF2D 4C3IG 2JQOA 3CPFA 1KAWA 2RDFA 1PH4A 1KLGD 3TS0A 1D6EC 1CHPD 4X65Q 1TWHB 1E1TA 1G6ZA 4Z9CB 1Q82C 5LMNQ 5E7NA 2UUCL 3J80i 1WFQA 2JXMB 1PH7A 5GAEC 2L15A 4V190 2B2WC 3MXPA 1Q7YC 3E9IA 5HGQA 2ES2A 3ND9A 4N9TA 4JI4L 1V9PA 1K8MA 1DJRD 4JK1C 1ICWA 2RA4A 2SOBA 3NBIA 4BWGB 3A8JE 4C1NI 4R4QA 3M4OB 2KVMA 2NZHA 3IFTA 3HOXG 2R93G 4H44C 1Y69U 1QILA 2F0MA 4IPHA 1Y1VB 1EOVA 1PRTC 2QF7A 2WFWA 4DV7L 1HTPA 4JI1L 4A3BG 2RHQB 2BH2A 1E2WA 4KD3A 5AFWA 1FJGQ 3CPWA 3ERQA 5FJ8H 4UAIA 1PH8A 1EWIA 3I90A 4ID6A 5CGKA 1XTCD 5KNCA 1ONLA 4OIJA 1YJWA 4HIDA 2FXQA 1VQNA 4BXXH 1CHQD 4DGZA 1T5EA 3VR5A 3K80C 2Z6KC 2M2LA 1PTOC 1AW7A 1DZ1A 2WAQB 3GQBA 3RN5A 3HOZH 3FVQA 4HCSA 2EY1A 4CGYB 1G6PA 5C4JH 3EJIA 2YYZA 2O4XA 2QW7A 1PH2A 4RH6A 2ICIA 1TWCH 4K0KL 1FNVA 3Q0AA 1HZCA 5IT9L 2K33A 3VDYA 4ABNA 1J6QA 3HOUH 3A55A 3LWUA 1I3QH 5C3EB 1VQGA 4IFDJ 5FJ8G 4B9WA 4A3EB 1XNQQ 4ZLTF 1EIGA 1A8VA 4DV2L 5JJLA 2K5VA 4BY1H 1OTCA 3I73A 4L5RC 4BXXG 5EKLA 2F0KA 1ASZA 3OMGA 4DAVA 1PDQA 1Y14B 1HQRD 3HOZG 1XTDA 3TDQA 4A3JG 3MVVA 4C3IB 4IOAA 3Q24A 3VA7A 3CCLA 1X54A 2E8GA 2JE6I 3ULJA 5CV7A 1S5ED 4GNXC 1IBLQ 4MN3A 4OO1I 1PHJA 3D0FA 1HNZL 1Y8OB 3CRLC 3TBIB 1W3SA 5FO8B 1PTOF 1QVCA 1EU4A 4OHJA 2KUMA 3RLOA 2B2UA 4HIMA 5CYUA 2B63B 1Y8NB 1X65A 1N36Q 2R93B 4A3MG 1GOZA 5IOCA 1HQMC 1H9SB 3A8KE 1PH9A 1VQ5A 4BY1G 1ASYA 4XYQA 4A3GB 3PF4A 4Q5VA 2KBNA 4UP7A 2RBMA 4ZYSA 4DR1Q 4QIWE 2I5LX 3PQIA 5D3DA 3OMCA 2K52A 1LACA 2KCMA 4AQYQ 3E5SA 1JWSD 2ZTEA 2IJ0A 4HMIA 1EYCA 1SYFA 4B3MQ 1PFSA 1WCMB 1SNDA 2EDGA 5EPKA 1HNXQ 4XQJA 1XMQQ 3J7AV 3J80L 4XTCS 4LF4L 3VYRA 4JVZA 4K6LA 1IKMA 3K0YA 4RHRA 5D14A 4FVMA 3MTSA 1R9TB 3M4PA 3T56B 2BH8A 1V43A 4HAEA 3CCQA 3JAMi 1NAPA 2HCIA 3ULLA 4ULLA 4LWCA 5D3IB 1KHIA 3QJYA 3KLSA 2HDMA 1EQRA 3SVMA 3M3YH 3RNUA 4DV6Q 2DJGC 2EOTA 1BDOA 1Q90A 1M8AA 4NXMQ 1M1KC 5JVG3 3K7AB 1GXDC 1EY7A 1NTGA 5G3LF 4N8X1 5IP9G 3GV3A 2D9UA 3T51B 2Z4IA 2A8VA 2HIXA 3L0OA 3AFPA 5GROA 2OCEA 4CKCA 2UU9L 3HOWB 1RJTA 3L7ZC 2Z1CA 4DK6C 2L0CA 4A93G 3F2UA 4FF3A 4LJZC 3K8AA 4KTAA 3HKZE 4OONA 3DWPA 2RF4A 1MJEA 1HTLD 3KK7A 3PUWA 5I6YA 2E76C 3R3OA 4QUFA 1I6VC 2WINB 3W1GA 1STEA 3QOJA 3CCRA 4DR2L 4LNQA 4A3JB 3H3VI 1ILPA 4LF8L 1STBA 3X3MA 1SLJA 3P20A 4A3LH 1EY4A 3HFZB 4DR5L 2LS01 2ATWA 1KRTA 1MBYA 2I07B 4IUPA 5EBCA 4A3KG 2Z6BA 1WVLA 1X6OA 3EN2A 5NUCA 3GTPB 1KTKA 1PMRA 5M3FB 1NMFA 1KDCA 1D7QA 1LM0A 1H9SA 3OTOQ 1MKHA 1G8ZD 1CT1D 1SYBA 3NUCA 1NNXA 2UUBL 2LSSA 4RGMA 2NZOA 2QEJC 2R92B 3OIPA 4LF7L 4TQUS 1EIYB 1SFOB 5FO9B 2JYOA 1CZWA 5C44H 2A69D 3B6YA 2K5QA 3PCOB 3NE5B 1KABA 1EIHA 1KQSA 4I65A 1JQYD 4KLKA 3M7GA 1HR0L 3GV6A 1F2ZA 2WB1G 2ICEC 4R4IA 1R4PB 3I2ZA 3TREA 4A3LG 3S16B 1GUTA 2GVAA 4KY6A 5EAYA 2EJGC 2LKVA 2IX0A 2EYJA 2IT1A 2K1BA 3PSIA 1GKHA 4A76A 2F0EA 4ZRZA 1DXMA 1L1OB 5E1FA 2B2TA 5M5XB 4MZ9A 2WACA 3HEJA 1HR0W 4ZKBB 3HOYH 1WTWA 4MIUA 1HRJA 3GTOB 1PYWD 4ZUJA 1CK1A 4JBKA 1UE6A 3PO2B 4K2LA 3O13A 4FYDA 2B2YA 3NTKA 5C3WA 2K01A 4LFAL 5IE8A 1L0XB 2HUGA 5FLXc 2VB3X 5A2QE 2VUMG 2L1BA 3HRZC 4LFBL 2KJXA 1XX8A 3F1ZA 2EY2A 4A3FH 4B3RL 4X66L 2IHEA 3U9SA 1SEBD 5BR8Q 1BBXC 5K36H 3S1MB 1TY2A 2EVBA 2L12A 5J1ZA 4J15A 3SEBA 1E2ZA 3PGZA 2ZM6L 1GVPA 3NBHA 1KNEA 3DM3A 4G7ZC 1PH1A 1VQKA 2JN4A 3AU7A 4NW2A 2B2UC 1VQ7A 2SNMA 4HIKA 2KCTA 3JAML 2B3GA 3CXCA 1JJ2A 1PZID 3NENA 4C3JH 2Q8TA 1XNRQ 1YZ6A 4DV5L 2A6ED 5I9PA 4XIGS 3TQYA 4J8QA 1DOLA 1NSNS 3P75A 4C56C 1YNJD 5ISRA 2JA7B 1AH9A 1IHZA 2C35B 4QL5A 1QUQA 2I5HA 1NMGA 3KF6A 1SMXA 1PV4A 4BBRG 3IFDA 4ZQ3A 4DK1A 3T1YQ 1YBYA 2R7FA 1WTQA 1JOOA 3OPOA 1A63A 3A5UA 3PUYA 4A3FG 2I0QA 1LTBD 4KJNA 4BBSH 5K36G 1VMCA 3BZDB 2Y0SE 3PIOA 4HSVA 4R4OA 2UUCQ 1K8AC 1CI3M 3X3NA 1E3PA 2KHJA 3MHBA 4KMUC 1NY4A 1VQPA 3G48A 5GADC 2DY7A 1JJCB 1XPUA 4JI4Q 4M8AA 1VQHA 3STBD 1EY0A 1AN8A 4H02A 2XRQD 4PZ6A 3CHBD 1EU3A 4BY7H 1LLRD 3H0GB 3NQIA 5FLXE 5E4WC 4HSPA 2K04A 5M5WB 1IBKL 4EQOA 4EQ5A 2RCNA 1HJPA 4DV7Q 1TWHH 4JI1Q 4DXFA 3V96A 1X3QA 2MGSA 2EE1A 2JSOA 3J7AF 3M4QA 2XWBB 5LMUL 3KBXA 3OWFA 4X64L 2L11A 3I8ZA 1CA6A 2EXZA 1D1KA 1BF4A 1U4LA 3M4OH 1LABA 5KIXA 1KD1C 2E2DC 2DN8A 2HT1A 4DUYL 1ESRA 4NP5A 1LT5D 2MP1A 2V4DA 4POFA 2IPKD 1PVOA 1IBML 3CMEA 3AEVA 1GUWA 1E7ZA 2VUMB 3EVQA 1LTAD 4IN3A 2NZ1D 3I4OA 4HR7B 4KJOA 2F0PA 4QGUA 1FNUA 1VQOA 3C2PA 3DUZA 3EIVA 5EQ0A 1HHVA 3K58A 4K0KQ 2CHBD 5JPMC 1UNSA 1TWFB 3GTKH 4JV5L 2F0QA 3K57A 2NB0A 1ZXTA 2CKZB 2B8FA 1SROA 4UHVA 5I9OA 3KUPA 3FDTA 5DNFA 5DEHA 2EYPA 1PH6A 5ELEA 4UPAA 3A5ZB 4DV2Q 1KDBA 2B39A 2F0LA 3K0XA 2PW5A 1EY6A 1IYJB 1GM5A 5IYBG 3K5MA 1ET6A 2VQFL 4LW1A 1AZPA 2IX1A 2QGQA 3CW2C 4DNTB 2OWOA 5C3EH 5EKIA 5C6AA 1H9JA 1R4QB 1Z6HA 1EZ8A 4IO9A 1YITA 5C5LA 4OL7A 1YNND 3VR2A 4YHHL 2K5HA 3I72A 2VNUD 4ZKCB 3TP7A 5COYA 4C3HB 4JBJA 2B2TC 1HNZQ 4JG2A 2F52A 1VDZA 3PO3G 1U4PA 4C1NK 1SRUA 3MAQA 2DJFC 5C4XG 1VQEA 3T1HL 1BCPD 1HZBA 4KHZA 4LUVA 2YU9H 1L2FA 2B2YC 1MSGA 3WOEA 1YVCA 3BZCA 1I50H 3ND8A 1SR3A 2A6HD 2YV5A 2EY6A 1QNKA 3NWTA 1YEZA 4IUUA 5CR3A 1NR2A 4DA2A 1NCVA 4FF1A 4I7ZC 4O1NA 4DR7L 2VW9A 2HHHQ 1CKMA 5DLQE 1B9MA 1ZKOA 1OO9B 5GAHC 3J7YW 1G51A 2XSCA 2KOLA 3MXNB 4LF4Q 4H0LC 4WFN3 3W3AA 4AYBG 1K3RA 2NN6H 3CQZB 4ZUIA 2NBFA 3S1RH 3KJPA 3S1QH 1IZ6A 4L5QA 3RUZA 4L6TB 4FXKC 2CW0C 1H95A 1WYDA 1QE6A 3I4NH 4QB4A 4IZ8A 4JPBW 1Q8IA 3G7LA 2VL6A 5HURA 3BVMA 3I4MB 1K8OA 1DONA 4PQXA 3DM1A 1ICFB 3MC0B 1NUCA 3T4AC 4MHEA 4TVAB 5M5YH 2Q2UA 1WCMH 5IYCH 1SYGA 3VYSA 4HMJA 1QVFA 5KYIA 4Y7NH 3TSSA 4DUZL 1VF7A 2SDFA 4A3CG 1B53A 2M00A 3ERSX 1KDAA 3BG3A 4KY5A 1E24A 1QNUA 5IYDH 1ZYRD 1X56A 4ODGA 2UU9Q 4LF5L 2GVBA 3W5OA 1BO0A 3IKJA 4QQBX 3I7FA 3MEFA 1FR3A 3AMUA 3FKIH 1RTOA 4PZ8A 4JYAL 4ZCKA 5J3BA 1EEFD 3V05A 4WRDA 1RDPD 2MO0A 3ULPA 5C4HA 2I5MX 3UDXA 4QUCA 5I2XA 2JA5B 1S5CD 3NQTA 1RTNA 5IIFA 2JJQA 3I4NG 1XMOL 1J5EL 4IUVA 2A68C 4DR2Q 2RSNA 1HCZA 2F4VL 4LF8Q 5GQOA 4DR5Q 5IGCA 2PZUA 4LUZA 5I4DA 2F0TA 4R4TA 5IYCG 2ZJRA 5EGTA 5DM73 3UE1A 3S14H 3OSOA 2MO1A 3VA5A 1YHQA 1QB5D 4KN4C 3NSWA 5IYDG 3D4RA 2WP8J 3HKZG 4R4CA 2UUBQ 2MFIA 5C4XB 1DOMA 4DFAA 3S2HH 1BOSA 3FRPB 4LF7Q 3FKIG 5CBAE 5L37A 1X55A 3CCVA 1PZKD 1SE4A 4CJ0B 1SNCA 5BN4A 4OWWB 1Q86C 1EQQA 1STAA 1U4RA 4EQPA 2CH4W 4DN4M 1H9MA 2H5XA 2ZT9C 2K50A 3HOVH 3KBGA 4RA8A 4EQNA 2Q2IA 2WAQE 3GTQB 1JCKB 4QCLA 1HR0Q 3NEMA 1DCZA 3EQLC 3VR6A 2UUAL 1HFGA 1M4VA 3F2BA 2F0OA 2EYLA 2MJ8A 3TP5A 4AYBB 5IGDA 3VR4A 1VQDA 3E0JA 2K7VA 2JEBI 1HUNA 1Q1EA 1VQAA 3I3CA 3S15B 2PNHA 4GN3B 3GTMB 1V1OA 4NKLA 4JBWA 4WJ4A 1W6KA 2PI2A 2QA4A 4JI0L 1TVXA 5EBDA 2NVTB 1ML0D 2JEAI 4OXPA 3BU2A 2Q8RE 5C4ZA 2F0DA 4LAAA 3HOUG 2BCOA 3E3XA 4LFAQ 2AQ2B 3S16H 2F0SA 1Y1WH 3HOXB 4JI5Q 2KENA 4ME5A 3S17B 1B3QA 1BR9A 1JE4A 4LFBQ 4B3RQ 1PTOH 4UY8C 1DGSA 4X66Q 2K75A 3HOVG 4X3UA 4DU9A 4GKJL 1OXUA 4A3BB 1LTLA 3H6MA 5M5XH 3E9HA 2RHSB 1DYQA 4IFDH 1VQCA 4N9PA 3Q8DA 3NTIA 3UDFA 1EFID 2ZM6Q 1MD2D 1D2BA 2HHHL 1ENAA 2ZTDA 3PO2H 1SE2A 1KNAA 2F0JA 2M9VA 5ELCA 3P7JA 1VS0A 4CBVA 2F0NA 3OWEB 4KHPL 2E2IH 4Y52H 1EYDA 4DAYB 4WJWA 2NYZD 4DV5Q 1PRTD 2LFNA 1MIUA 2N78A 3NPPA 3C1EA 2BA0A 1G91A 5JAVA 3GD7A 1EWCA 3MXGA 1Z47A 1TXYA 4P2CB 4XT3B 1IW7C 4DAPA 1P16A 1GUNA 3QIAA 4R8NA 1QJOA 2NVXB 4L5SA 4RMFA 1A62A 3HKZB 3E6ZX 5JJZA 1FGUA 1O80A 3SK6A 1C48A 3L9AX 1AP0A 3TN2A 1DM0B 2JA6H 4PG3A 3CCEA 1I4GA 5D65A 3CRKC 3BS1A 2JA7H 1UE5A 2VY3A 1NJIC 3GTJB 5I2YA 2BDNA 3KOJA 1EEID 1JR0D 1O7LA 1C0AA 4F7XA 5A2QL 2D62A 5C3XA 2A6EC 5EPJA 2QDLA 4IUTA 5C0XH 1D5XC 4JCVE 1A3UA 1YHBA 2KA7A 4RGOS 1IBKQ 1VMPA 1QVGA 2ZXPA 1YNJC 3HOZB 2EQSA 3D6WA 3T16A 1RCVD 3GP7A 2Y0SG 5LMUQ 4X64Q 2E2JH 5DAUA 2OTLA 2R7ZH 1TWCB 4K8JA 4V0BA 3MEHA 1UAPA 1PFBA 2A1AA 2F3IA 2J0TD 4FXDA 3CF5A 2B2VA 2UXDL 2XGTA 3E0EA 4DUYQ 2JA8H 4JI7L 4PNYA 4DV1L 1L0WA 3RZOH 1SYCA 1ILQA 1WTVA 3CKIB 3HOUB 1I3QB 3IAYA 2JP1A 5FOBB 1KLUD 2RCFA 1K9MC 1IBMQ 4A3MB 3MWYW 3STBC 4OGQC 3TS2A 4OX9L 1UWVA 4BY1B 4CDCC 1AEXA 2CFMA 1MHWC 4JI3L 4DNIA 2V1CC 3KYHC 2ZJPA 2UXCL 2WV6D 5JEAH 1E0BA 5C0XG 3EROA 3RR5A 1YHAA 4JV5Q 1PLFA 2XVSA
chains in the Genus database with same CATH topology
1C4QA 2F0HA 3SXHA 1SMYC 3LNNA 4KHVA 2OEOA 5FO7B 3OHXC 4XQNA 5FLXL 3VYTA 5IGGA 3R2TA 3M85A 3AB9A 3SHLA 3PIO3 1RD9D 4PMBA 4H7BA 1LTGD 1CZGA 1BUVT 1GJXA 4M1UB 1AZQA 1BXTA 2AWNA 4IUNA 4LK1C 1LO5D 1F9RA 1OXTA 4A93B 1MSHA 1TS2A 2OF1A 2PQEA 4KV6A 1I4RA 3VYUA 2B8GA 2NUCA 4EGVA 3C3LA 3QB3A 4ZAIA 3OOCA 1SDFA 2XNAC 4CJ2C 1PFMA 4KKTA 1XWEA 3RMHA 3M3YB 1JC7A 5K5PA 1EL0A 2PMZB 4LMQD 2Y0SB 3HG9A 4ZK9B 2I46A 1J9OA 4A3KB 2KQ3A 1I4HA 2E2HB 2C5CA 3MFYA 3M4YA 1GHKA 1EZ6A 4QMGA 1RODA 3I4LA 4FF2A 2EYOA 1DD2A 1G291 3I91A 4TSSA 3WOFA 2FJ2A 2NVQB 1G2SA 1FD7D 3PV0A 1U9RA 3C46A 1A3VA 4C3JG 2XWJB 1CM9A 1J8IA 2FMMA 3BYYB 2LY7A 4X3KA 2PYKA 2WB1B 3DWAA 3KLRA 1JWMD 3G6JB 1STHA 5KNBA 3RZDB 1I6HB 4KK7A 2F3WA 1STYA 4HEDA 2G9HD 2A74C 3D3RA 2SNSA 3HS0C 3J81E 2ZXOA 3QG1A 2G9DA 2K32A 2PNRC 3MA2B 2J4XA 2DNEA 5C44B 3NK9A 3HZXA 3A8IE 1PXUA 3UI2A 1Y8PB 5C0XI 1F9SA 3R8BA 2B2VC 1S5BD 5DM63 4FO2A 5ELBA 3S1NB 1CFMA 1OXVA 3I70A 1BCPF 2RSOA 2L55A 2ENBA 1S5DD 3PUZA 4IALA 3HOYB 4OO1H 2SEBD 1O7YA 1T5XD 3C1FA 1IYVA 2J7ZA 2F0GA 2OT2A 1A6XA 1SE3A 4BBRB 2IL8A 4RFBA 3S9WA 1LV9A 4A3FB 4FF4A 3H3VC 1JB3A 2O2LD 1XXGA 1F77A 3D31A 1X3PA 1F2LA 3RD4A 2X6LA 1EQTA 3OW7A 1LTSD 3PUVA 2X6GA 4G7OC 3EFXD 2FINB 1SNPA 4U673 1SYEA 1JOKA 3LWEA 5IGFA 2EZVA 4YIJA 3D4DA 2RDGA 4GZYC 3BDLA 1WTXA 1F2MA 2HDLA 3GTGB 1GUSA 4FP5D 3H94A 2BE5D 3QO2A 1TKWB 3PMFA 2CQAA 5J39A 1CQVA 3S2DB 2F4IA 2WKDA 5E4XA 1LTRD 4RKBA 1TS5A 1Z7TA 5BN3A 2H1EA 5C5MA 1HFNA 4RGNA 4CJ1B 3NXWA 2F0IA 2XN9C 1QOHA 5FKAC 5FK9C 1UUPA 3GO5A 3WDNA 4FXGC 5CORA 2L5TA 3T13A 2N88A 3FPUB 1B50A 1LTTD 3R93A 2DNCA 1I4PA 2AQ1B 1A2UA 4F8MA 1TT2A 2NN6G 4KD4A 3LX0A 2K28A 3QWNA 5IGBA 4O42A 1B2TA 2EJMA 3FPPA 4L8JA 2VXWA 1QWYA 4RKLA 2GA4B 4WORA 5J22A 4KY7A 2R3ZA 2EJFC 1ZEQX 1V1PB 2K6AA 1VCIA 4IURA 5CC4A 3OIQA 3GTKB 1EYAA 1BCPB 5ELDA 4L63B 3M7NA 1Q1BA 3MZ5A 3PO3B 1LT3D 4X3TA 1STNA 1B3AA 1HA5A 2DY8A 1K83B 1EY9A 1I4QA 5EPLA 2CVRA 1SNOA 3RLFA 3TZUA 4HCEA 3MXNA 4NDXA 2RQXA 4K14A 1F2YA 2KCCA 4UDUC 4BA2I 1ENCA 2LMCB 1G2TA 2IX3A 1GUGA 1KAAA 2KEDA 5I6WA 1PRTF 3PUXA 2NTSA 2X69A 1EQVA 1JORA 2FFKB 4FNFA 2QCPX 1GHJA 2KHSA 3SK8A 4OIKA 2MPMA 4QIWB 1X32A 2YU9B 3BDOA 2K03A 2KECA 4RGTA 3Q23A 1I50B 1JICA 2HQEA 1AFPA 4H13C 1ET9A 2A69C 1FGBD 2PPBC 2C9OA 2CW0D 3A7AB 1SJED 1O7ZA 4S3SA 4KI0A 1OXSC 1TR5A 4K2KA 3BVZA 3BYTB 3S1RB 3S1QB 5LHY1 4E6IA 1S5FD 4K5WA 1D5ZC 2PCFB 3U9OA 4G57A 5CV8A 3I4NB 2N55A 1QG7A 4PMWA 4K5XA 1V1PA 5C0XJ 1MI2A 3N6RA 5KNDA 5M5YB 1TS3A 1GUOA 2E74C 3W2DA 2K5WA 2EYHA 2FHTA 4DK0A 2PZWA 4Y7NB 3TZDA 5IT9E 4PMCA 1IL8A 4HTHA 2A68D 4IFDG 5EJWA 1SSOA 1PTOD 3FKIB 1II3A 4RHSA 1SNQA 3DWQA 4RCNA 2QILA 1TS4A 3DEPA 3SK4A 5KGUA 3T53B 2NN6I 5T1IA 3FMCA 3K5OA 5JEAJ 2XIWA 4R9WA 2AQ3B 1HPCA 1B44D 1SAPA 5C4JB 2QDBA 3S14B 1TQOA 2KCNA 5CV4A 4HN7A 5JVH3 1CQFA 1JOQA 2QKIC 4XT1B 2PZTA 2ZXRA 3S2HB 4RAUC 2ID0A 2OXPA 4RCOA 3A56A 1TU2B 5IGEA 2RDHA 2XRSD 3ZYYX 3HOVB 5TSSA 1B9NA 1EY5A 2PO4A 1D1IA 3TP8A 4U68A 5G3LD 2E75C 3SR1A 2L9HA 4K5VA 1TY0A 5HGTA 4DAYA 4IUQA 4B9XA 1PRTB 1ESFA 3SDZA 3D6CA 3J80E 3Q6SA 4DNRB 1WTOA 3KLSX 3A54A 3TP6A 3N52A 3R2IA 5KEEA 1PFNA 1SBBB 1F9QA 1SXTA 1Y1WB 4KN7C 5CMDA 1BQQT 1PTOB 4RWSC 2D2CC 1C8CA 1MGSA 5M9OA 1NR4A 2AWOA 5JEAG 1U4MA 2RVLA 1ENFA 1B4OA 3NWSA 3J81L 4NMZA 1RKNA 1IW7D 1VF5C 3NHHA 4F87A 3EA6A 1DOKA 2Q8IB 4K8IA 2E2IB 3PIP3 5JOBA 2O5JC 3NP8A 3FEWX 1JWUD 4CHTB 4X3SA 3ONAB 1PZJD 3HP3A 2AUKA 4XYOA 4QF4A 4XDXA 2MUYA 1LTID 1HA6A 4BS9A 2PW7A 1QCBD 5LL6X 2Z8LA 2F0WA 2WIIB 1YNNC 2BOSA 2B2WA 1SNMA 2TSSA 3MFGA 2JA6B 4IFDI 2WKCA 3BDCA 1B1ZA 3DXJC 2FMCA 4TRDA 1FYCA 5ELFA 2F0FA 4BA1I 3IL8A 1BCPC 2MHVA 1CA5A 5EKKA 2A6HC 2K05A 2EY5A 1WTRA 5A35A 5JPNC 4G7HC 1A3TA 3DMUA 3VR3A 4C3HG 1UEAB 1E2VA 3K5LA 5CV6A 1LT6D 2O5IC 2K5DA 4CKBA 2E2JB 1WD0A 2IW3A 4IQZA 5F2DA 1CTMA 4G4KA 2L4NA 2R7ZB 2BE5C 2EYMA 1OXXK 3K59A 2F3VA 2JA8B 3DEOA 1EOTA 2KEEA 3P1HA 2H4OA 3RZOB 5KYLA 3Q22A 3DHQA 3A7LA 2R61A 5CV5A 4EVOA 1HUMA 2BA1A 4CKEA 1SMYD 3K5NA 2AUJD 1H9KA 2A5HA 4KKSA 2NWGA 1I4XA 1STGA 1IKLA 3K6OA 2F0VA 1ZYRC 3L3OC 3SE0A 3CU7A 4PV1C 3JAME 3D4WA 3TMEA 1W6JA 5KRUA 1Q12A 5CV9A 4C2MB 2NVYB 1SJHD 2F0UA 1LT4D 1WD1A 3D8GA 4J1MA 3H09A 3NTHA 5BN5A 1EY8A 1BNZA 2VB2X 4Q0FA 2EPBA 1EWHA 1H9RA 5M3MB 1IYUA 1TIID 2F1MA 5T1GA 4J6HA 1FNWA 3QOLA 3GTLB 5CBEE 1L0YB 4A3IB 2A73B 4XQQA 4R8IA 1SYDA 3H91A 4B08A 3KF8A 4C3JB 2BDOA 1Q3LA 4DF7A 2EYFA 4OO1G 2RKSA 4KKUA 2F03A 3SK5A 2R6GA 5E3FA 1A15A 1O78A 3ITPA 1A2TA 4A3DB 1XYIA 1WTPA 5IODA 3URYA 2D5DA 4XXEA 4F88A 2HCCA 4DXGA 3BVGA 4BBSB 3V2TA 4ILWA 2Z4HA 1RHPA 1TWAB 1D5MC 1HXYD 3HGBA 5LL6S 4TKOB 2NTTA 1V8QA 2TMPA 4K6DA 4BY7B 2IWHA 1F9PA 3MXUA 1S4ZA 1TWGB 1RF2D 4C3IG 2RDFA 1KLGD 1D6EC 1CHPD 1TWHB 1G6ZA 4Z9CB 2JXMB 4V190 2B2WC 3MXPA 3ND9A 4N9TA 1K8MA 1DJRD 4JK1C 1ICWA 2RA4A 2SOBA 3NBIA 4BWGB 3A8JE 4C1NI 3M4OB 2KVMA 3IFTA 4H44C 1Y69U 1QILA 2F0MA 1Y1VB 1PRTC 2QF7A 1HTPA 1E2WA 4KD3A 5AFWA 3ERQA 4UAIA 3I90A 4ID6A 5CGKA 1XTCD 5KNCA 1ONLA 4OIJA 1CHQD 4DGZA 1T5EA 3VR5A 2M2LA 1PTOC 1AW7A 1DZ1A 2WAQB 3GQBA 3FVQA 4HCSA 2EY1A 4CGYB 3EJIA 2YYZA 2O4XA 4RH6A 2ICIA 1FNVA 3Q0AA 5IT9L 2K33A 4ABNA 3A55A 3LWUA 5C3EB 4IFDJ 4B9WA 4A3EB 4ZLTF 1EIGA 3I73A 5EKLA 2F0KA 3OMGA 4DAVA 1PDQA 1HQRD 3TDQA 3MVVA 4C3IB 3Q24A 3VA7A 2JE6I 5CV7A 1S5ED 4MN3A 4OO1I 1Y8OB 3CRLC 3TBIB 5FO8B 1PTOF 1EU4A 4OHJA 2KUMA 2B2UA 2B63B 5CYUA 1Y8NB 2R93B 1GOZA 5IOCA 1HQMC 1H9SB 3A8KE 4XYQA 4A3GB 4Q5VA 2RBMA 4ZYSA 5D3DA 3OMCA 1LACA 3E5SA 1JWSD 4HMIA 2IJ0A 1EYCA 1SYFA 2EDGA 1WCMB 1SNDA 5EPKA 4XQJA 3J7AV 3J80L 4XTCS 3VYRA 4K6LA 1IKMA 3K0YA 4RHRA 5D14A 4FVMA 3MTSA 1R9TB 3T56B 1V43A 4HAEA 1NAPA 2HCIA 4ULLA 5D3IB 3QJYA 3KLSA 2HDMA 3SVMA 2EOTA 1BDOA 1Q90A 1M8AA 5JVG3 3K7AB 1GXDC 1EY7A 5G3LF 3GV3A 2D9UA 3T51B 2Z4IA 4CKCA 3HOWB 1RJTA 3L7ZC 2Z1CA 2L0CA 3F2UA 4FF3A 4LJZC 4KTAA 3DWPA 1HTLD 3KK7A 3PUWA 5I6YA 2E76C 3R3OA 4QUFA 1I6VC 2WINB 1STEA 3QOJA 4A3JB 1ILPA 1STBA 3X3MA 3P20A 1EY4A 2LS01 1MBYA 2I07B 4IUPA 5EBCA 1WVLA 5NUCA 3GTPB 1KTKA 1PMRA 5M3FB 1KDCA 1H9SA 1G8ZD 1CT1D 1SYBA 3NUCA 4RGMA 2QEJC 2R92B 3OIPA 4TQUS 1SFOB 5FO9B 2JYOA 1CZWA 2A69D 2K5QA 3NE5B 1KABA 1EIHA 4I65A 1JQYD 3M7GA 3GV6A 1F2ZA 2ICEC 1R4PB 3S16B 1GUTA 4KY6A 2EJGC 2LKVA 2IX0A 2EYJA 2IT1A 2K1BA 2F0EA 4ZRZA 1DXMA 5E1FA 2B2TA 5M5XB 2WACA 3HEJA 4ZKBB 1WTWA 4MIUA 1HRJA 3GTOB 1PYWD 4ZUJA 1CK1A 3PO2B 4K2LA 3O13A 4FYDA 2B2YA 3NTKA 5C3WA 2K01A 1L0XB 2HUGA 2VB3X 5A2QE 2L1BA 3HRZC 2KJXA 1XX8A 2EY2A 3U9SA 1SEBD 1BBXC 5K36H 3S1MB 1TY2A 2EVBA 2L12A 5J1ZA 3SEBA 1E2ZA 3NBHA 1KNEA 4G7ZC 3AU7A 4NW2A 2B2UC 2SNMA 3JAML 1PZID 2Q8TA 2A6ED 5I9PA 4XIGS 4J8QA 1DOLA 1NSNS 3P75A 4C56C 1YNJD 5ISRA 2JA7B 1IHZA 3IFDA 4ZQ3A 4DK1A 1WTQA 1JOOA 3OPOA 3PUYA 1LTBD 4KJNA 5K36G 1VMCA 3BZDB 4HSVA 1CI3M 3X3NA 3MHBA 4KMUC 2DY7A 4M8AA 1EY0A 1AN8A 2XRQD 3CHBD 1EU3A 1LLRD 3H0GB 3NQIA 5FLXE 5E4WC 4HSPA 2K04A 5M5WB 4EQOA 4DXFA 3V96A 1X3QA 2MGSA 2EE1A 2JSOA 3J7AF 2XWBB 3KBXA 3OWFA 2L11A 3I8ZA 1CA6A 2EXZA 1D1KA 1BF4A 1U4LA 1LABA 5KIXA 2E2DC 2DN8A 1ESRA 4NP5A 1LT5D 2MP1A 2V4DA 2IPKD 1GUWA 2VUMB 3EVQA 1LTAD 4IN3A 2NZ1D 4HR7B 4KJOA 2F0PA 1FNUA 3C2PA 3DUZA 5EQ0A 1HHVA 3K58A 2CHBD 5JPMC 1UNSA 1TWFB 2F0QA 3K57A 2NB0A 1ZXTA 2B8FA 5I9OA 3KUPA 3FDTA 5DNFA 5DEHA 2EYPA 5ELEA 1KDBA 2B39A 2F0LA 2PW5A 1EY6A 3K5MA 1ET6A 1AZPA 2IX1A 4DNTB 5EKIA 5C6AA 1H9JA 1R4QB 1Z6HA 1EZ8A 5C5LA 4OL7A 1YNND 3VR2A 3I72A 2VNUD 4ZKCB 3TP7A 5COYA 4C3HB 2B2TC 1VDZA 1U4PA 4C1NK 3MAQA 1BCPD 4KHZA 2B2YC 1MSGA 3WOEA 3ND8A 2A6HD 2EY6A 1QNKA 3NWTA 4IUUA 5CR3A 1NR2A 4DA2A 1NCVA 4FF1A 4I7ZC 4O1NA 1B9MA 1ZKOA 1OO9B 3J7YW 2XSCA 2KOLA 4H0LC 4WFN3 3W3AA 2NN6H 3CQZB 4ZUIA 2NBFA 3RUZA 4L6TB 4FXKC 2CW0C 1QE6A 4QB4A 4IZ8A 5HURA 1Q8IA 3G7LA 3I4MB 3BVMA 1K8OA 1DONA 4PQXA 3DM1A 3MC0B 1NUCA 3T4AC 4MHEA 1SYGA 3VYSA 4HMJA 5KYIA 3TSSA 1VF7A 2SDFA 1B53A 2M00A 1KDAA 3BG3A 4KY5A 1QNUA 1ZYRD 4ODGA 1BO0A 3IKJA 1FR3A 3AMUA 1RTOA 1EEFD 3V05A 4WRDA 1RDPD 5C4HA 4QUCA 5I2XA 2JA5B 1S5CD 3NQTA 1RTNA 5IIFA 4IUVA 2A68C 2RSNA 1HCZA 5IGCA 2PZUA 5I4DA 2F0TA 5EGTA 5DM73 3OSOA 3VA5A 1QB5D 4KN4C 3NSWA 3D4RA 2WP8J 5C4XB 1DOMA 4DFAA 1BOSA 3FRPB 5CBAE 1PZKD 1SE4A 4CJ0B 1SNCA 5BN4A 1STAA 1U4RA 4EQPA 4DN4M 1H9MA 2ZT9C 3KBGA 4RA8A 4EQNA 3GTQB 4QCLA 1JCKB 1DCZA 3EQLC 3VR6A 1HFGA 1M4VA 2F0OA 2EYLA 2MJ8A 3TP5A 4AYBB 5IGDA 3VR4A 3E0JA 2K7VA 2JEBI 1HUNA 1Q1EA 3I3CA 3S15B 3GTMB 1V1OA 4NKLA 4JBWA 1W6KA 1TVXA 5EBDA 2NVTB 1ML0D 2JEAI 2Q8RE 5C4ZA 2F0DA 4LAAA 2BCOA 2AQ2B 2F0SA 3HOXB 4ME5A 3S17B 1BR9A 1JE4A 1PTOH 4X3UA 4DU9A 1OXUA 4A3BB 3H6MA 1DYQA 4IFDH 4N9PA 3NTIA 1EFID 1MD2D 1D2BA 1ENAA 1SE2A 1KNAA 2F0JA 2M9VA 5ELCA 3P7JA 4CBVA 2F0NA 3OWEB 1EYDA 4WJWA 2NYZD 1PRTD 2LFNA 3NPPA 3C1EA 2BA0A 1G91A 5JAVA 3GD7A 1EWCA 3MXGA 1Z47A 4XT3B 4P2CB 1IW7C 4DAPA 1GUNA 3QIAA 4R8NA 1QJOA 2NVXB 3HKZB 3E6ZX 5JJZA 1O80A 3SK6A 1C48A 3L9AX 1AP0A 3TN2A 1DM0B 1I4GA 5D65A 3CRKC 3BS1A 3GTJB 5I2YA 2BDNA 1EEID 1JR0D 1O7LA 4F7XA 5A2QL 2D62A 5C3XA 2A6EC 5EPJA 4IUTA 5C0XH 1D5XC 1A3UA 2KA7A 4RGOS 1VMPA 2ZXPA 1YNJC 3HOZB 3D6WA 3T16A 1RCVD 3GP7A 5DAUA 1TWCB 4K8JA 4V0BA 3MEHA 1UAPA 1PFBA 2J0TD 4FXDA 2B2VA 4PNYA 1SYCA 1ILQA 1WTVA 3CKIB 3HOUB 1I3QB 3IAYA 2JP1A 5FOBB 1KLUD 4A3MB 3MWYW 4OGQC 4BY1B 1AEXA 2WV6D 5JEAH 1E0BA 5C0XG 3EROA 1PLFA 2XVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QF4 A;  1A2U A;  3OSO A;  3TME A;  4F8M A;  1TT2 A;  3C1E A;  3OWF A;  4KD4 A;  2RDF A;  3LX0 A;  4K2L A;  3VA5 A;  5KRU A;  5EKL A;  2F0K A;  5C3W A;  2F0H A;  3OMG A;  5JAV A;  2EXZ A;  2OXP A;  3SXH A;  5CV9 A;  5IGB A;  1U9R A;  2PW7 A;  4S3S A;  1A3V A;  5IGE A;  5KIX A;  2EY6 A;  2F0U A;  5CR3 A;  4DFA A;  2F0W A;  3D8G A;  4KHV A;  4KTA A;  2EY2 A;  2OEO A;  3MVV A;  3MXP A;  4NP5 A;  4J1M A;  1TR5 A;  2PYK A;  4RKL A;  4K2K A;  4N9T A;  4R8N A;  4RKB A;  3TP6 A;  1EY5 A;  1SNM A;  4E6I A;  3TP8 A;  5I6Y A;  4WOR A;  5J22 A;  4KY7 A;  5IGG A;  1EY8 A;  3R3O A;  4K5W A;  2SOB A;  3SR1 A;  1SNC A;  3BDC A;  1STH A;  5CV7 A;  4K5V A;  5J1Z A;  3U9O A;  1STA A;  3SHL A;  4EQP A;  4G57 A;  3EVQ A;  5CV8 A;  2F3W A;  3QOJ A;  4TRD A;  1STY A;  5HGT A;  3SK6 A;  5CC4 A;  2F0F A;  2F0M A;  1EYA A;  1SNP A;  4KJO A;  2F0P A;  4K5X A;  4H7B A;  1STB A;  4PMB A;  4ZUI A;  4B9X A;  4EQN A;  3D6C A;  2SNM A;  3RUZ A;  1EY4 A;  1SYE A;  1JOK A;  3MZ5 A;  4J6H A;  5IGF A;  3QOL A;  4QB4 A;  2SNS A;  4IZ8 A;  5EKK A;  5HUR A;  5I9P A;  2EYH A;  2F0O A;  2F0Q A;  3D4D A;  2PZW A;  4KD3 A;  4YIJ A;  2EY5 A;  3BDL A;  1F2M A;  5NUC A;  1STN A;  4F7X A;  5IOC A;  2EYL A;  3ERQ A;  4IUN A;  3TP5 A;  5IGD A;  1NSN S;  1NUC A;  1A3T A;  3DMU A;  3P75 A;  5C3X A;  1KDC A;  4ID6 A;  5CGK A;  5I9O A;  5KEE A;  1SYD A;  5ISR A;  1IHZ A;  1EY9 A;  4PMC A;  1SYG A;  1A3U A;  5CV6 A;  5DEH A;  2EYP A;  4HTH A;  4HMJ A;  1SNO A;  4NKL A;  3NK9 A;  3HZX A;  5KYI A;  1SYB A;  2RBM A;  3NUC A;  5F2D A;  3PMF A;  2OF1 A;  2PQE A;  4KV6 A;  3OMC A;  4DF7 A;  2EYM A;  4DGZ A;  5J39 A;  4ZQ3 A;  1II3 A;  2M00 A;  1KDB A;  3E5S A;  1KDA A;  1SNQ A;  2EYF A;  4KY5 A;  1JOO A;  4NDX A;  3T16 A;  2RKS A;  4HMI A;  5C4Z A;  2F0D A;  1EYC A;  2F3V A;  2NUC A;  1SYF A;  4K14 A;  3P1H A;  3QB3 A;  4LAA A;  4ODG A;  1F2Y A;  1SND A;  2F0L A;  4KJN A;  5DAU A;  5M9O A;  2PW5 A;  3SK5 A;  5KYL A;  1EY6 A;  5E3F A;  4K8J A;  2F0S A;  3DHQ A;  3MEH A;  5C5M A;  1ENC A;  3ITP A;  1A2T A;  4ME5 A;  3SK4 A;  1KAB A;  5KGU A;  2EY1 A;  4I65 A;  5IOD A;  3MHB A;  3EJI A;  5CV5 A;  3NXW A;  4EVO A;  4WRD A;  2O4X A;  1KAA A;  5C4H A;  2F0I A;  5K5P A;  5I6W A;  4PNY A;  1SYC A;  1F2Z A;  4NMZ A;  4DU9 A;  1RKN A;  1EQV A;  1EY0 A;  2ENB A;  3H6M A;  3NHH A;  3NQT A;  5C6A A;  5IIF A;  1JOR A;  3V2T A;  2KQ3 A;  1EZ8 A;  4N9P A;  4KY6 A;  5C5L A;  4OL7 A;  2LKV A;  4K8I A;  2KHS A;  4IAL A;  2EYJ A;  2QDB A;  3SK8 A;  3TP7 A;  5JOB A;  1ENA A;  2F0J A;  3C1F A;  1STG A;  3NP8 A;  3T13 A;  1TQO A;  1AEX A;  2F0E A;  1EZ6 A;  4EQO A;  4QMG A;  5CV4 A;  4B9W A;  5E1F A;  2F0G A;  2F0V A;  2F0N A;  5IGC A;  2PZU A;  2WAC A;  4K6D A;  2EYO A;  1JOQ A;  2HQE A;  3ERO A;  2F0T A;  3HEJ A;  1EY7 A;  1EYD A;  4MIU A;  3S9W A;  5EGT A;  4ZUJ A;  2PZT A;  3D4W A; 
#chains in the Genus database with same CATH topology
 2G5D A;  4QJF A;  1C4Q A;  4MTN A;  2F0H A;  3SXH A;  1KIX A;  3J7A 5;  1SMY C;  4DAM A;  1K73 C;  3LNN A;  1X3F A;  2R7Z G;  2A19 A;  4KHV A;  1B7Y B;  2OEO A;  5FO7 B;  3OHX C;  4XQN A;  4C2M H;  3VYT A;  5FLX L;  2NVY H;  1N32 Q;  5IGG A;  3R2T A;  2CWA A;  3M85 A;  2UXB L;  3AB9 A;  3SHL A;  4POG A;  3PIO 3;  1RD9 D;  4YCU A;  3CCJ A;  5ELN A;  2VQF Q;  1JE5 A;  3OYY A;  4H7B A;  4PMB A;  1LTG D;  3IRB A;  1CZG A;  4JI5 L;  1VQL A;  1BUV T;  1NE3 A;  4LUO A;  5C44 G;  2KHI A;  5IP7 H;  5M3M H;  3U4Z A;  1GJX A;  1I94 L;  4M1U B;  1AZQ A;  4YHH Q;  1BXT A;  2AWN A;  4IUN A;  4LK1 C;  1LO5 D;  2OQK A;  1F9R A;  1CSP A;  1OXT A;  5HY6 A;  3GTL H;  1MSH A;  4A93 B;  1TS2 A;  2OF1 A;  2PQE A;  4OEM B;  4KV6 A;  1T9H A;  4A3I H;  3T1H Q;  1I4R A;  4HJ9 A;  3VYU A;  2B8G A;  2NUC A;  4EGV A;  3J81 c;  3W1B A;  3C3L A;  3QB3 A;  4ZAI A;  1RL2 A;  5JJK A;  1EUJ A;  3OOC A;  1SDF A;  2XNA C;  1AE3 A;  4CJ2 C;  3KJO A;  3HOY G;  1PFM A;  4KKT A;  1XWE A;  3RMH A;  3M3Y B;  1JC7 A;  5K5P A;  3S24 A;  2PMZ B;  2AKW B;  4LMQ D;  5JJI A;  1EL0 A;  2Y0S B;  3HG9 A;  3J7Z C;  4DR7 Q;  3CCS A;  4JBM A;  4ZK9 B;  2I46 A;  4DR3 L;  5ELO A;  1J9O A;  4A3D H;  2VS1 A;  4A3K B;  3TEH B;  2KQ3 A;  3KFU A;  4B3T L;  1I4H A;  5IP7 G;  4DV3 L;  2E2H B;  2C5C A;  2K4K A;  3MFY A;  3M4Y A;  1GHK A;  1EZ6 A;  4QMG A;  1ROD A;  3I4L A;  1EYG A;  1HNW L;  4FF2 A;  2EYO A;  1DD2 A;  1TWA H;  1G29 1;  3I91 A;  4TSS A;  3WOF A;  2FJ2 A;  2NVQ B;  1G2S A;  1N9W A;  4A3I G;  1FD7 D;  2EXD A;  3PV0 A;  1WOC A;  5FLM H;  4DV0 L;  1U9R A;  4EX5 A;  3C46 A;  1A3V A;  4C3J G;  2XWJ B;  1CM9 A;  1J8I A;  2FMM A;  4DUZ Q;  1TWG H;  3BYY B;  3CQZ H;  2LY7 A;  4X3K A;  3CCM A;  1UEB A;  2PYK A;  2WB1 B;  3DWA A;  3KLR A;  3KF8 B;  1JWM D;  3G6J B;  4LF5 Q;  1STH A;  5KNB A;  1L1O A;  3RZD B;  1I6H B;  4KK7 A;  2F3W A;  1STY A;  4A3D G;  1EIF A;  4JYA Q;  3PIP A;  3CP0 A;  3U4V A;  4HED A;  2G9H D;  3EBE A;  3A0J A;  1JB7 A;  4BBS G;  2A74 C;  3D3R A;  2SNS A;  4JI6 L;  3HS0 C;  2VQE Q;  3J81 E;  1Y1V H;  2ZXO A;  3QG1 A;  1LYL A;  4HJ7 A;  1XMO Q;  1J5E Q;  2G9D A;  1K8G A;  2K32 A;  2PNR C;  3MA2 B;  2F4V Q;  2J4X A;  2DNE A;  4IPG A;  3AYH B;  5C44 B;  3NK9 A;  3HZX A;  1XPR A;  4YWM A;  4BY7 G;  5FLM G;  1VQ8 A;  3A8I E;  2Z0S A;  1PXU A;  3UI2 A;  1Y8P B;  5C0X I;  4GN5 A;  1F9S A;  3R8B A;  2B2V C;  1S5B D;  1VQ9 A;  2D0O A;  5DM6 3;  4FO2 A;  1U0L A;  5ELB A;  3S1N B;  1CFM A;  1OXV A;  3I70 A;  5AJ3 L;  1W2B A;  1BCP F;  3UDG A;  2RSO A;  1XJV A;  2L55 A;  2ENB A;  1S5D D;  3PUZ A;  1JJG A;  1N33 L;  4IAL A;  3HOY B;  4OO1 H;  4NXN L;  1N32 L;  1X3E A;  4NB3 A;  2SEB D;  3BZK A;  1O7Y A;  1T5X D;  3C1F A;  4X62 L;  1IYV A;  1Y1V G;  2J7Z A;  1Q46 A;  5IWA L;  2F0G A;  2UUA Q;  2OT2 A;  1A6X A;  3K81 C;  1SE3 A;  2R7D A;  2IL8 A;  4BBR B;  4RFB A;  3S9W A;  1LV9 A;  4A3F B;  4FF4 A;  3H3V C;  4A3E H;  3RLN A;  1V1Q A;  1QZG A;  3I56 A;  1JB3 A;  4YY3 L;  2O2L D;  3I55 A;  1XXG A;  1N34 L;  1F77 A;  4JI0 Q;  3D31 A;  3GTQ H;  1X3P A;  1F2L A;  3RD4 A;  2X6L A;  1EQT A;  1RIP A;  1IXR A;  2WAQ G;  3OW7 A;  1LTS D;  3PUV A;  2Z9H A;  2X6G A;  4G7O C;  4C3I H;  3EFX D;  2FIN B;  1SNP A;  2CWP A;  4U67 3;  1FL0 A;  3S15 H;  1SYE A;  1JOK A;  4GKJ Q;  3LWE A;  5IGF A;  4YCW A;  1Z9F A;  2EZV A;  4YIJ A;  3D4D A;  2RDG A;  4GZY C;  3BDL A;  1WTX A;  1F2M A;  1B8A A;  2HDL A;  4DR4 L;  3GTG B;  1B70 B;  4PZ7 A;  2B63 H;  4YWK A;  1GUS A;  4FP5 D;  5C3E G;  3H94 A;  2BE5 D;  3QO2 A;  2ASB A;  4GN4 B;  4A3E G;  1TKW B;  2Q2T A;  2R93 H;  3PMF A;  4KHP Q;  3AQQ A;  4HJ8 A;  2CQA A;  5J39 A;  1CQV A;  3S2D B;  2F4I A;  2WKD A;  5E4X A;  4A3G H;  1LTR D;  4YWL A;  4RKB A;  1TS5 A;  4DKA C;  1Z7T A;  5BN3 A;  2GN5 A;  2H1E A;  4DK3 C;  5C5M A;  4OWX B;  1HFN A;  4RGN A;  4O0A A;  4CJ1 B;  3NXW A;  2F0I A;  2XN9 C;  1QOH A;  1PYB A;  1I5F A;  4JW0 A;  5IY0 A;  2MQH A;  5FKA C;  1E22 A;  5FK9 C;  1UUP A;  3GO5 A;  1R9T H;  3WDN A;  4FXG C;  5COR A;  3H3V H;  2L5T A;  3T13 A;  4MNO A;  4JI8 L;  3J81 j;  2N88 A;  1CKO A;  4JI2 L;  3FPU B;  1B50 A;  1U5K A;  1LTT D;  3R93 A;  2DNC A;  1I4P A;  2B63 G;  1BVS A;  1GD7 A;  2AQ1 B;  3UDI A;  3CMA A;  2E5L L;  1A2U A;  3GDE A;  4F8M A;  1TT2 A;  2NN6 G;  4KD4 A;  3LX0 A;  3KDF B;  2K28 A;  2NVX H;  3QWN A;  4LF6 L;  3ICE A;  3K7A H;  2VQE L;  5IGB A;  4RG1 A;  4A3G G;  4O42 A;  1B2T A;  2EJM A;  4ME3 A;  3FPP A;  4L8J A;  2PI2 E;  2VXW A;  1QWY A;  4RKL A;  2GA4 B;  3HOW H;  1K0R A;  1L1O C;  4KY7 A;  4WOR A;  5J22 A;  2R3Z A;  3GTJ H;  2EJF C;  1WCM G;  1ZEQ X;  3BJU A;  1V1P B;  2K6A A;  1VCI A;  4IUR A;  1YI2 A;  3SGI A;  5CC4 A;  3OIQ A;  3GTK B;  1EYA A;  3K7U C;  1BCP B;  5ELD A;  2UXD Q;  3FP9 A;  4L63 B;  4JI7 Q;  3M7N A;  4DV1 Q;  1HH2 P;  1Q1B A;  3MZ5 A;  3PO3 B;  1LT3 D;  4GLV B;  4X3T A;  1YJN A;  2LXJ A;  4A3J H;  1STN A;  2JA9 A;  1B3A A;  1GO3 E;  1MJC A;  4GOP B;  4OX9 Q;  1HA5 A;  2DY8 A;  1K83 B;  1KL9 A;  1EY9 A;  1I4Q A;  5EPL A;  3DLL A;  2CVR A;  4JI3 Q;  1SNO A;  4DR6 L;  2UXC Q;  4HJ5 A;  3RLF A;  3GTP H;  4UP9 A;  3TZU A;  4HCE A;  5M3F H;  3MXN A;  1UE7 A;  2D0P A;  4ALP A;  4NDX A;  2RQX A;  4K14 A;  1F2Y A;  2KCC A;  3HOW G;  4UDU C;  1M90 C;  4B3S L;  4BA2 I;  4NPS A;  1ENC A;  4A3M H;  2R92 H;  5IT9 c;  2LMC B;  1G2T A;  2IX3 A;  1GUG A;  3CC2 A;  4JC0 A;  1SFO H;  1KAA A;  2KED A;  1KC8 C;  5I6W A;  1PRT F;  3PUX A;  3HKS A;  2NTS A;  2X69 A;  4LFC L;  1EQV A;  1JOR A;  2FFK B;  4FNF A;  2QCP X;  2UXB Q;  1GHJ A;  1NBW A;  1K3B C;  2KHS A;  3SK8 A;  4OIK A;  2MPM A;  4QIW B;  1X32 A;  2YU9 B;  3BDO A;  2K03 A;  2KEC A;  4HJA A;  1O7I A;  4RGT A;  3Q23 A;  1I50 B;  1JIC A;  2K14 A;  3FHW A;  2HQE A;  1AFP A;  4LF9 L;  4H13 C;  2DGY A;  3H15 A;  1ET9 A;  2A69 C;  1FGB D;  2PPB C;  1I94 Q;  2C9O A;  2CW0 D;  5M3F G;  4OWT B;  3A7A B;  4IPC A;  1SJE D;  1O7Z A;  3KDF A;  4KI0 A;  4S3S A;  2P5Z X;  4AYB E;  3GTO H;  1XPO A;  1Q81 C;  1OXS C;  2R92 G;  4HIO A;  1TR5 A;  1EFW A;  4K2K A;  3BVZ A;  1BKB A;  3BYT B;  5H1S E;  3S1R B;  3J81 i;  3S1Q B;  5LHY 1;  4E6I A;  4GKK L;  3CCU A;  1VQF A;  1S5F D;  4K5W A;  1D5Z C;  2PCF B;  3U9O A;  5IP9 H;  4G57 A;  3TRZ A;  5CV8 A;  3I4N B;  1AE2 A;  2N55 A;  1QG7 A;  2ZJQ A;  4PMW A;  4K5X A;  4GLX A;  1V1P A;  5C0X J;  1MI2 A;  3S1M H;  3N6R A;  4CDE C;  5KND A;  5M5Y B;  1TS3 A;  4A93 H;  4DR3 Q;  1GUO A;  2E74 C;  3W2D A;  2K5W A;  1Y1W G;  2EYH A;  2FHT A;  4DK0 A;  2PZW A;  4Y7N B;  4DV4 L;  4B3T Q;  4DV3 Q;  3TZD A;  1WJJ A;  3PF5 A;  5IT9 E;  4PMC A;  4X65 L;  1IL8 A;  4HTH A;  5LMN L;  4GOP A;  1HNW Q;  2A68 D;  4IFD G;  3J80 c;  5EJW A;  1SSO A;  1PTO D;  3FKI B;  1II3 A;  4RHS A;  4YCV A;  1SNQ A;  3DWQ A;  4RCN A;  3PO2 G;  4IJH A;  2QIL A;  1TS4 A;  4A3K H;  4DV0 Q;  3DEP A;  3SK4 A;  5KGU A;  1JMC A;  3T53 B;  2E2H H;  2NN6 I;  5T1I A;  3FMC A;  1X9N A;  1CKN B;  1C9O A;  5LMN W;  3K5O A;  5JEA J;  1N8R C;  2XIW A;  3LGJ A;  2IHF A;  4R1J A;  2AQ3 B;  3JC6 6;  1HPC A;  4R9W A;  2HIV A;  1B44 D;  1FJG L;  1WTH A;  2CQO A;  1IL2 A;  1SAP A;  1JT8 A;  5C4J B;  2NVQ H;  2QDB A;  3G71 A;  3S14 B;  1TQO A;  2EIF A;  4CDD C;  4IPD A;  2KCN A;  5CV4 A;  4HN7 A;  3H0G H;  5JVH 3;  1CQF A;  1JOQ A;  3NBH B;  1K28 A;  4JI6 Q;  2QKI C;  4XT1 B;  2PZT A;  3AFQ A;  2ZXR A;  1X3G A;  5M5W H;  4P75 A;  3S2H B;  2JA6 G;  4RAU C;  2ID0 A;  2Q2H A;  2OXP A;  2JA7 G;  4RCO A;  3A56 A;  2CH4 A;  1TU2 B;  2HQL A;  5IGE A;  3RZD H;  2RDH A;  3G6E A;  2XRS D;  1I6H H;  1CUK A;  2YTX A;  3CC7 A;  3ZYY X;  4AH6 A;  3HOV B;  5TSS A;  1B9N A;  1EY5 A;  2PO4 A;  1D1I A;  3TP8 A;  1QUQ B;  4UP8 A;  3KF6 B;  4U68 A;  2E75 C;  5G3L D;  3SR1 A;  2L9H A;  4K5V A;  3CAM A;  1TY0 A;  1PH5 A;  4I7A A;  5HGT A;  4DAY A;  4IUQ A;  4B9X A;  1PRT B;  1ESF A;  3SDZ A;  5AJ3 Q;  3D6C A;  1BBW A;  1PH3 A;  4JOI A;  3J80 E;  2YTV A;  1BBU A;  3Q6S A;  1XNQ L;  4DNR B;  4WJ3 M;  1WTO A;  2VUM H;  3KLS X;  4APV A;  3A54 A;  4AIM A;  3H0G G;  3TP6 A;  1K0S A;  1N33 Q;  2QEX A;  4OEL B;  3N52 A;  2CCZ A;  4NXN Q;  4A75 A;  3R2I A;  1P8L A;  2JA8 G;  5KEE A;  4X62 Q;  1PFN A;  4GLA C;  1SBB B;  3F2C A;  3CC4 A;  1TWF H;  1F9Q A;  5IWA Q;  5GAG C;  1SXT A;  1Y1W B;  2MNA A;  2OTJ A;  4KN7 C;  5CMD A;  3S1N H;  4P74 A;  3UE0 A;  1BQQ T;  1PTO B;  4RWS C;  2D2C C;  1C8C A;  1YJ9 A;  1MGS A;  5M9O A;  1NR4 A;  1IBL L;  2AWO A;  4YY3 Q;  1VQ4 A;  5JEA G;  4IOC A;  2HD3 A;  1KXL A;  1U4M A;  2RVL A;  1PYS B;  1ENF A;  1N34 Q;  1B4O A;  3NWS A;  3J81 L;  4NMZ A;  1RKN A;  1IW7 D;  1VF5 C;  3NHH A;  4F87 A;  1CKN A;  3EA6 A;  1N36 L;  1DOK A;  4BBR H;  2Q8I B;  4K8I A;  2E2I B;  4O2D A;  3PIP 3;  5JOB A;  2O5J C;  1VQ6 A;  3NP8 A;  3FEW X;  1JWU D;  4CHT B;  4X3S A;  3ONA B;  4DR1 L;  1VQM A;  1PZJ D;  1CSQ A;  3HP3 A;  2AUK A;  4XYO A;  4A4I A;  4AQY L;  4C3H H;  4QF4 A;  3WWV A;  4XDX A;  4DR4 Q;  2MUY A;  1LTI D;  4B3M L;  4IJL A;  1HA6 A;  1HNX L;  3F2D A;  4BS9 A;  1XMQ L;  2PW7 A;  5M3M G;  2VZA A;  1QCB D;  4QY7 A;  2Z8L A;  5LL6 X;  1WI5 A;  2F0W A;  2DUD A;  2WII B;  4L5T A;  1YNN C;  4P71 A;  2BOS A;  2B2W A;  1SNM A;  2TSS A;  3MFG A;  2JA6 B;  4MTK A;  3JAM c;  4GNX B;  4IFD I;  2WKC A;  3BDC A;  1B1Z A;  2N3S A;  3DXJ C;  2FMC A;  4TRD A;  4DV6 L;  1FYC A;  5ELF A;  2F0F A;  4BA1 I;  1YIJ A;  3GTG H;  3QR8 A;  2AHO B;  3IL8 A;  1BCP C;  2MHV A;  1CA5 A;  3U58 A;  4NXM L;  3ZJY C;  3L2P A;  5EKK A;  4X6A H;  2PMZ E;  2A6H C;  2K05 A;  2EY5 A;  1WTR A;  5A35 A;  5JPN C;  2N8N A;  3S2D H;  4G7H C;  1A3T A;  3DMU A;  3VR3 A;  4GOP C;  4C3H G;  1UEA B;  1E2V A;  3K5L A;  5CV6 A;  1LT6 D;  4JI8 Q;  2ALY B;  3G4S A;  2K5D A;  4CKB A;  2O5I C;  4JI2 Q;  3ER0 A;  3I4M H;  1WD0 A;  2IW3 A;  4IQZ A;  2E2J B;  5F2D A;  1CTM A;  4G4K A;  2L4N A;  2R7Z B;  1PA6 A;  1FVI A;  2N49 A;  2BE5 C;  2EYM A;  2OQ0 A;  3OW2 A;  1OXX K;  2E5L Q;  3K59 A;  2F3V A;  2JA8 B;  3DEO A;  1EOT A;  2KEE A;  3P1H A;  2H4O A;  3RZO B;  4LF6 Q;  2Z6K A;  5KYL A;  3Q22 A;  3DHQ A;  3A7L A;  2R61 A;  5CV5 A;  1A0I A;  4EVO A;  1HUM A;  2BA1 A;  4CKE A;  1SMY D;  2PQA B;  3K5N A;  2JK8 A;  2WB1 E;  3CD6 A;  2AUJ D;  1H9K A;  2A5H A;  4KKS A;  2NWG A;  1I4X A;  1SN8 A;  2JA5 H;  1STG A;  1SE8 A;  3OTO L;  1VQJ A;  1IKL A;  4P72 A;  3K6O A;  3RN2 A;  5IYB H;  2F0V A;  1ZYR C;  1YNX A;  3L3O C;  1D8L A;  3CU7 A;  3SE0 A;  4PV1 C;  3I4M G;  3JAM E;  3D4W A;  3F8T A;  1VQI A;  3TME A;  4P73 A;  1W6J A;  5KRU A;  1Q12 A;  1C7Y A;  5CV9 A;  4C2M B;  2NVY B;  4DR6 Q;  1SJH D;  2F0U A;  1LT4 D;  1WD1 A;  3D8G A;  3NEL A;  4J1M A;  2XTI A;  3H09 A;  3NTH A;  5BN5 A;  1EY8 A;  2YTY A;  1BNZ A;  3PO3 H;  2VB2 X;  4Q0F A;  2EPB A;  1EWH A;  1LUZ A;  5C4X H;  4B3S Q;  1H9R A;  1Q8K A;  1IYU A;  5M3M B;  4GNX A;  1TII D;  2F1M A;  4JOI C;  4CDF C;  5T1G A;  1K83 H;  2JA5 G;  4LFC Q;  4J6H A;  2AMC B;  1FNW A;  3QOL A;  1S40 A;  4GS3 A;  3GTL B;  5CBE E;  1L0Y B;  2K5N A;  1S72 A;  4N8F A;  1QZH A;  1KRS A;  4A3I B;  2A73 B;  4XQQ A;  4R8I A;  1SYD A;  3H91 A;  4B08 A;  1VQB A;  3KF8 A;  4C3J B;  2BDO A;  1Q3L A;  4FDB A;  4LF9 Q;  3KLW A;  4DF7 A;  1UE1 A;  5BR8 L;  2EYF A;  4OO1 G;  1HZ9 A;  2RKS A;  4KKU A;  2F03 A;  3GTM H;  1E1O A;  2B29 A;  2R6G A;  3SK5 A;  5E3F A;  1A15 A;  1O78 A;  3ITP A;  1A2T A;  4A3D B;  1XYI A;  2NVT H;  1HZA A;  1WTP A;  5IOD A;  2IY5 B;  3URY A;  2D5D A;  2ZTC A;  4XXE A;  4F88 A;  2HCC A;  4DXG A;  4DPG A;  3BVG A;  4GKK Q;  3HOX H;  4BBS B;  1XNR L;  3V2T A;  3S17 H;  4ILW A;  2Z4H A;  1RHP A;  4A3C H;  1TWA B;  2PQA A;  1D5M C;  1HXY D;  3HGB A;  5LL6 S;  4TKO B;  4A3B H;  3M9B A;  3U50 C;  2NTT A;  1V8Q A;  2TMP A;  4K6D A;  4BY7 B;  1S3O A;  2IWH A;  3A74 A;  1F9P A;  3MXU A;  3T1Y L;  2LXK A;  4DV4 Q;  1S4Z A;  1TWG B;  1RF2 D;  4C3I G;  2JQO A;  3CPF A;  1KAW A;  2RDF A;  1PH4 A;  1KLG D;  3TS0 A;  1D6E C;  1CHP D;  4X65 Q;  1TWH B;  1E1T A;  1G6Z A;  4Z9C B;  1Q82 C;  5LMN Q;  5E7N A;  2UUC L;  3J80 i;  1WFQ A;  2JXM B;  1PH7 A;  5GAE C;  2L15 A;  4V19 0;  2B2W C;  3MXP A;  1Q7Y C;  3E9I A;  5HGQ A;  2ES2 A;  3ND9 A;  4N9T A;  4JI4 L;  1V9P A;  1K8M A;  1DJR D;  4JK1 C;  1ICW A;  2RA4 A;  2SOB A;  3NBI A;  4BWG B;  3A8J E;  4C1N I;  4R4Q A;  3M4O B;  2KVM A;  2NZH A;  3IFT A;  3HOX G;  2R93 G;  4H44 C;  1Y69 U;  1QIL A;  2F0M A;  4IPH A;  1Y1V B;  1EOV A;  1PRT C;  2QF7 A;  2WFW A;  4DV7 L;  1HTP A;  4JI1 L;  4A3B G;  2RHQ B;  2BH2 A;  1E2W A;  4KD3 A;  5AFW A;  1FJG Q;  3CPW A;  3ERQ A;  5FJ8 H;  4UAI A;  1PH8 A;  1EWI A;  3I90 A;  4ID6 A;  5CGK A;  1XTC D;  5KNC A;  1ONL A;  4OIJ A;  1YJW A;  4HID A;  2FXQ A;  1VQN A;  4BXX H;  1CHQ D;  4DGZ A;  1T5E A;  3VR5 A;  3K80 C;  2Z6K C;  2M2L A;  1PTO C;  1AW7 A;  1DZ1 A;  2WAQ B;  3GQB A;  3RN5 A;  3HOZ H;  3FVQ A;  4HCS A;  2EY1 A;  4CGY B;  1G6P A;  5C4J H;  3EJI A;  2YYZ A;  2O4X A;  2QW7 A;  1PH2 A;  4RH6 A;  2ICI A;  1TWC H;  4K0K L;  1FNV A;  3Q0A A;  1HZC A;  5IT9 L;  2K33 A;  3VDY A;  4ABN A;  1J6Q A;  3HOU H;  3A55 A;  3LWU A;  1I3Q H;  5C3E B;  1VQG A;  4IFD J;  5FJ8 G;  4B9W A;  4A3E B;  1XNQ Q;  4ZLT F;  1EIG A;  1A8V A;  4DV2 L;  5JJL A;  2K5V A;  4BY1 H;  1OTC A;  3I73 A;  4L5R C;  4BXX G;  5EKL A;  2F0K A;  1ASZ A;  3OMG A;  4DAV A;  1PDQ A;  1Y14 B;  1HQR D;  3HOZ G;  1XTD A;  3TDQ A;  4A3J G;  3MVV A;  4C3I B;  4IOA A;  3Q24 A;  3VA7 A;  3CCL A;  1X54 A;  2E8G A;  2JE6 I;  3ULJ A;  5CV7 A;  1S5E D;  4GNX C;  1IBL Q;  4MN3 A;  4OO1 I;  1PHJ A;  3D0F A;  1HNZ L;  1Y8O B;  3CRL C;  3TBI B;  1W3S A;  5FO8 B;  1PTO F;  1QVC A;  1EU4 A;  4OHJ A;  2KUM A;  3RLO A;  2B2U A;  4HIM A;  5CYU A;  2B63 B;  1Y8N B;  1X65 A;  1N36 Q;  2R93 B;  4A3M G;  1GOZ A;  5IOC A;  1HQM C;  1H9S B;  3A8K E;  1PH9 A;  1VQ5 A;  4BY1 G;  1ASY A;  4XYQ A;  4A3G B;  3PF4 A;  4Q5V A;  2KBN A;  4UP7 A;  2RBM A;  4ZYS A;  4DR1 Q;  4QIW E;  2I5L X;  3PQI A;  5D3D A;  3OMC A;  2K52 A;  1LAC A;  2KCM A;  4AQY Q;  3E5S A;  1JWS D;  2ZTE A;  2IJ0 A;  4HMI A;  1EYC A;  1SYF A;  4B3M Q;  1PFS A;  1WCM B;  1SND A;  2EDG A;  5EPK A;  1HNX Q;  4XQJ A;  1XMQ Q;  3J7A V;  3J80 L;  4XTC S;  4LF4 L;  3VYR A;  4JVZ A;  4K6L A;  1IKM A;  3K0Y A;  4RHR A;  5D14 A;  4FVM A;  3MTS A;  1R9T B;  3M4P A;  3T56 B;  2BH8 A;  1V43 A;  4HAE A;  3CCQ A;  3JAM i;  1NAP A;  2HCI A;  3ULL A;  4ULL A;  4LWC A;  5D3I B;  1KHI A;  3QJY A;  3KLS A;  2HDM A;  1EQR A;  3SVM A;  3M3Y H;  3RNU A;  4DV6 Q;  2DJG C;  2EOT A;  1BDO A;  1Q90 A;  1M8A A;  4NXM Q;  1M1K C;  5JVG 3;  3K7A B;  1GXD C;  1EY7 A;  1NTG A;  5G3L F;  4N8X 1;  5IP9 G;  3GV3 A;  2D9U A;  3T51 B;  2Z4I A;  2A8V A;  2HIX A;  3L0O A;  3AFP A;  5GRO A;  2OCE A;  4CKC A;  2UU9 L;  3HOW B;  1RJT A;  3L7Z C;  2Z1C A;  4DK6 C;  2L0C A;  4A93 G;  3F2U A;  4FF3 A;  4LJZ C;  3K8A A;  4KTA A;  3HKZ E;  4OON A;  3DWP A;  2RF4 A;  1MJE A;  1HTL D;  3KK7 A;  3PUW A;  5I6Y A;  2E76 C;  3R3O A;  4QUF A;  1I6V C;  2WIN B;  3W1G A;  1STE A;  3QOJ A;  3CCR A;  4DR2 L;  4LNQ A;  4A3J B;  3H3V I;  1ILP A;  4LF8 L;  1STB A;  3X3M A;  1SLJ A;  3P20 A;  4A3L H;  1EY4 A;  3HFZ B;  4DR5 L;  2LS0 1;  2ATW A;  1KRT A;  1MBY A;  2I07 B;  4IUP A;  5EBC A;  4A3K G;  2Z6B A;  1WVL A;  1X6O A;  3EN2 A;  5NUC A;  3GTP B;  1KTK A;  1PMR A;  5M3F B;  1NMF A;  1KDC A;  1D7Q A;  1LM0 A;  1H9S A;  3OTO Q;  1MKH A;  1G8Z D;  1CT1 D;  1SYB A;  3NUC A;  1NNX A;  2UUB L;  2LSS A;  4RGM A;  2NZO A;  2QEJ C;  2R92 B;  3OIP A;  4LF7 L;  4TQU S;  1EIY B;  1SFO B;  5FO9 B;  2JYO A;  1CZW A;  5C44 H;  2A69 D;  3B6Y A;  2K5Q A;  3PCO B;  3NE5 B;  1KAB A;  1EIH A;  1KQS A;  4I65 A;  1JQY D;  4KLK A;  3M7G A;  1HR0 L;  3GV6 A;  1F2Z A;  2WB1 G;  2ICE C;  4R4I A;  1R4P B;  3I2Z A;  3TRE A;  4A3L G;  3S16 B;  1GUT A;  2GVA A;  4KY6 A;  5EAY A;  2EJG C;  2LKV A;  2IX0 A;  2EYJ A;  2IT1 A;  2K1B A;  3PSI A;  1GKH A;  4A76 A;  2F0E A;  4ZRZ A;  1DXM A;  1L1O B;  5E1F A;  2B2T A;  5M5X B;  4MZ9 A;  2WAC A;  3HEJ A;  1HR0 W;  4ZKB B;  3HOY H;  1WTW A;  4MIU A;  1HRJ A;  3GTO B;  1PYW D;  4ZUJ A;  1CK1 A;  4JBK A;  1UE6 A;  3PO2 B;  4K2L A;  3O13 A;  4FYD A;  2B2Y A;  3NTK A;  5C3W A;  2K01 A;  4LFA L;  5IE8 A;  1L0X B;  2HUG A;  5FLX c;  2VB3 X;  5A2Q E;  2VUM G;  2L1B A;  3HRZ C;  4LFB L;  2KJX A;  1XX8 A;  3F1Z A;  2EY2 A;  4A3F H;  4B3R L;  4X66 L;  2IHE A;  3U9S A;  1SEB D;  5BR8 Q;  1BBX C;  5K36 H;  3S1M B;  1TY2 A;  2EVB A;  2L12 A;  5J1Z A;  4J15 A;  3SEB A;  1E2Z A;  3PGZ A;  2ZM6 L;  1GVP A;  3NBH A;  1KNE A;  3DM3 A;  4G7Z C;  1PH1 A;  1VQK A;  2JN4 A;  3AU7 A;  4NW2 A;  2B2U C;  1VQ7 A;  2SNM A;  4HIK A;  2KCT A;  3JAM L;  2B3G A;  3CXC A;  1JJ2 A;  1PZI D;  3NEN A;  4C3J H;  2Q8T A;  1XNR Q;  1YZ6 A;  4DV5 L;  2A6E D;  5I9P A;  4XIG S;  3TQY A;  4J8Q A;  1DOL A;  1NSN S;  3P75 A;  4C56 C;  1YNJ D;  5ISR A;  2JA7 B;  1AH9 A;  1IHZ A;  2C35 B;  4QL5 A;  1QUQ A;  2I5H A;  1NMG A;  3KF6 A;  1SMX A;  1PV4 A;  4BBR G;  3IFD A;  4ZQ3 A;  4DK1 A;  3T1Y Q;  1YBY A;  2R7F A;  1WTQ A;  1JOO A;  3OPO A;  1A63 A;  3A5U A;  3PUY A;  4A3F G;  2I0Q A;  1LTB D;  4KJN A;  4BBS H;  5K36 G;  1VMC A;  3BZD B;  2Y0S E;  3PIO A;  4HSV A;  4R4O A;  2UUC Q;  1K8A C;  1CI3 M;  3X3N A;  1E3P A;  2KHJ A;  3MHB A;  4KMU C;  1NY4 A;  1VQP A;  3G48 A;  5GAD C;  2DY7 A;  1JJC B;  1XPU A;  4JI4 Q;  4M8A A;  1VQH A;  3STB D;  1EY0 A;  1AN8 A;  4H02 A;  2XRQ D;  4PZ6 A;  3CHB D;  1EU3 A;  4BY7 H;  1LLR D;  3H0G B;  3NQI A;  5FLX E;  5E4W C;  4HSP A;  2K04 A;  5M5W B;  1IBK L;  4EQO A;  4EQ5 A;  2RCN A;  1HJP A;  4DV7 Q;  1TWH H;  4JI1 Q;  4DXF A;  3V96 A;  1X3Q A;  2MGS A;  2EE1 A;  2JSO A;  3J7A F;  3M4Q A;  2XWB B;  5LMU L;  3KBX A;  3OWF A;  4X64 L;  2L11 A;  3I8Z A;  1CA6 A;  2EXZ A;  1D1K A;  1BF4 A;  1U4L A;  3M4O H;  1LAB A;  5KIX A;  1KD1 C;  2E2D C;  2DN8 A;  2HT1 A;  4DUY L;  1ESR A;  4NP5 A;  1LT5 D;  2MP1 A;  2V4D A;  4POF A;  2IPK D;  1PVO A;  1IBM L;  3CME A;  3AEV A;  1GUW A;  1E7Z A;  2VUM B;  3EVQ A;  1LTA D;  4IN3 A;  2NZ1 D;  3I4O A;  4HR7 B;  4KJO A;  2F0P A;  4QGU A;  1FNU A;  1VQO A;  3C2P A;  3DUZ A;  3EIV A;  5EQ0 A;  1HHV A;  3K58 A;  4K0K Q;  2CHB D;  5JPM C;  1UNS A;  1TWF B;  3GTK H;  4JV5 L;  2F0Q A;  3K57 A;  2NB0 A;  1ZXT A;  2CKZ B;  2B8F A;  1SRO A;  4UHV A;  5I9O A;  3KUP A;  3FDT A;  5DNF A;  5DEH A;  2EYP A;  1PH6 A;  5ELE A;  4UPA A;  3A5Z B;  4DV2 Q;  1KDB A;  2B39 A;  2F0L A;  3K0X A;  2PW5 A;  1EY6 A;  1IYJ B;  1GM5 A;  5IYB G;  3K5M A;  1ET6 A;  2VQF L;  4LW1 A;  1AZP A;  2IX1 A;  2QGQ A;  3CW2 C;  4DNT B;  2OWO A;  5C3E H;  5EKI A;  5C6A A;  1H9J A;  1R4Q B;  1Z6H A;  1EZ8 A;  4IO9 A;  1YIT A;  5C5L A;  4OL7 A;  1YNN D;  3VR2 A;  4YHH L;  2K5H A;  3I72 A;  2VNU D;  4ZKC B;  3TP7 A;  5COY A;  4C3H B;  4JBJ A;  2B2T C;  1HNZ Q;  4JG2 A;  2F52 A;  1VDZ A;  3PO3 G;  1U4P A;  4C1N K;  1SRU A;  3MAQ A;  2DJF C;  5C4X G;  1VQE A;  3T1H L;  1BCP D;  1HZB A;  4KHZ A;  4LUV A;  2YU9 H;  1L2F A;  2B2Y C;  1MSG A;  3WOE A;  1YVC A;  3BZC A;  1I50 H;  3ND8 A;  1SR3 A;  2A6H D;  2YV5 A;  2EY6 A;  1QNK A;  3NWT A;  1YEZ A;  4IUU A;  5CR3 A;  1NR2 A;  4DA2 A;  1NCV A;  4FF1 A;  4I7Z C;  4O1N A;  4DR7 L;  2VW9 A;  2HHH Q;  1CKM A;  5DLQ E;  1B9M A;  1ZKO A;  1OO9 B;  5GAH C;  3J7Y W;  1G51 A;  2XSC A;  2KOL A;  3MXN B;  4LF4 Q;  4H0L C;  4WFN 3;  3W3A A;  4AYB G;  1K3R A;  2NN6 H;  3CQZ B;  4ZUI A;  2NBF A;  3S1R H;  3KJP A;  3S1Q H;  1IZ6 A;  4L5Q A;  3RUZ A;  4L6T B;  4FXK C;  2CW0 C;  1H95 A;  1WYD A;  1QE6 A;  3I4N H;  4QB4 A;  4IZ8 A;  4JPB W;  1Q8I A;  3G7L A;  2VL6 A;  5HUR A;  3BVM A;  3I4M B;  1K8O A;  1DON A;  4PQX A;  3DM1 A;  1ICF B;  3MC0 B;  1NUC A;  3T4A C;  4MHE A;  4TVA B;  5M5Y H;  2Q2U A;  1WCM H;  5IYC H;  1SYG A;  3VYS A;  4HMJ A;  1QVF A;  5KYI A;  4Y7N H;  3TSS A;  4DUZ L;  1VF7 A;  2SDF A;  4A3C G;  1B53 A;  2M00 A;  3ERS X;  1KDA A;  3BG3 A;  4KY5 A;  1E24 A;  1QNU A;  5IYD H;  1ZYR D;  1X56 A;  4ODG A;  2UU9 Q;  4LF5 L;  2GVB A;  3W5O A;  1BO0 A;  3IKJ A;  4QQB X;  3I7F A;  3MEF A;  1FR3 A;  3AMU A;  3FKI H;  1RTO A;  4PZ8 A;  4JYA L;  4ZCK A;  5J3B A;  1EEF D;  3V05 A;  4WRD A;  1RDP D;  2MO0 A;  3ULP A;  5C4H A;  2I5M X;  3UDX A;  4QUC A;  5I2X A;  2JA5 B;  1S5C D;  3NQT A;  1RTN A;  5IIF A;  2JJQ A;  3I4N G;  1XMO L;  1J5E L;  4IUV A;  2A68 C;  4DR2 Q;  2RSN A;  1HCZ A;  2F4V L;  4LF8 Q;  5GQO A;  4DR5 Q;  5IGC A;  2PZU A;  4LUZ A;  5I4D A;  2F0T A;  4R4T A;  5IYC G;  2ZJR A;  5EGT A;  5DM7 3;  3UE1 A;  3S14 H;  3OSO A;  2MO1 A;  3VA5 A;  1YHQ A;  1QB5 D;  4KN4 C;  3NSW A;  5IYD G;  3D4R A;  2WP8 J;  3HKZ G;  4R4C A;  2UUB Q;  2MFI A;  5C4X B;  1DOM A;  4DFA A;  3S2H H;  1BOS A;  3FRP B;  4LF7 Q;  3FKI G;  5CBA E;  5L37 A;  1X55 A;  3CCV A;  1PZK D;  1SE4 A;  4CJ0 B;  1SNC A;  5BN4 A;  4OWW B;  1Q86 C;  1EQQ A;  1STA A;  1U4R A;  4EQP A;  2CH4 W;  4DN4 M;  1H9M A;  2H5X A;  2ZT9 C;  2K50 A;  3HOV H;  3KBG A;  4RA8 A;  4EQN A;  2Q2I A;  2WAQ E;  3GTQ B;  1JCK B;  4QCL A;  1HR0 Q;  3NEM A;  1DCZ A;  3EQL C;  3VR6 A;  2UUA L;  1HFG A;  1M4V A;  3F2B A;  2F0O A;  2EYL A;  2MJ8 A;  3TP5 A;  4AYB B;  5IGD A;  3VR4 A;  1VQD A;  3E0J A;  2K7V A;  2JEB I;  1HUN A;  1Q1E A;  1VQA A;  3I3C A;  3S15 B;  2PNH A;  4GN3 B;  3GTM B;  1V1O A;  4NKL A;  4JBW A;  4WJ4 A;  1W6K A;  2PI2 A;  2QA4 A;  4JI0 L;  1TVX A;  5EBD A;  2NVT B;  1ML0 D;  2JEA I;  4OXP A;  3BU2 A;  2Q8R E;  5C4Z A;  2F0D A;  4LAA A;  3HOU G;  2BCO A;  3E3X A;  4LFA Q;  2AQ2 B;  3S16 H;  2F0S A;  1Y1W H;  3HOX B;  4JI5 Q;  2KEN A;  4ME5 A;  3S17 B;  1B3Q A;  1BR9 A;  1JE4 A;  4LFB Q;  4B3R Q;  1PTO H;  4UY8 C;  1DGS A;  4X66 Q;  2K75 A;  3HOV G;  4X3U A;  4DU9 A;  4GKJ L;  1OXU A;  4A3B B;  1LTL A;  3H6M A;  5M5X H;  3E9H A;  2RHS B;  1DYQ A;  4IFD H;  1VQC A;  4N9P A;  3Q8D A;  3NTI A;  3UDF A;  1EFI D;  2ZM6 Q;  1MD2 D;  1D2B A;  2HHH L;  1ENA A;  2ZTD A;  3PO2 H;  1SE2 A;  1KNA A;  2F0J A;  2M9V A;  5ELC A;  3P7J A;  1VS0 A;  4CBV A;  2F0N A;  3OWE B;  4KHP L;  2E2I H;  4Y52 H;  1EYD A;  4DAY B;  4WJW A;  2NYZ D;  4DV5 Q;  1PRT D;  2LFN A;  1MIU A;  2N78 A;  3NPP A;  3C1E A;  2BA0 A;  1G91 A;  5JAV A;  3GD7 A;  1EWC A;  3MXG A;  1Z47 A;  1TXY A;  4P2C B;  4XT3 B;  1IW7 C;  4DAP A;  1P16 A;  1GUN A;  3QIA A;  4R8N A;  1QJO A;  2NVX B;  4L5S A;  4RMF A;  1A62 A;  3HKZ B;  3E6Z X;  5JJZ A;  1FGU A;  1O80 A;  3SK6 A;  1C48 A;  3L9A X;  1AP0 A;  3TN2 A;  1DM0 B;  2JA6 H;  4PG3 A;  3CCE A;  1I4G A;  5D65 A;  3CRK C;  3BS1 A;  2JA7 H;  1UE5 A;  2VY3 A;  1NJI C;  3GTJ B;  5I2Y A;  2BDN A;  3KOJ A;  1EEI D;  1JR0 D;  1O7L A;  1C0A A;  4F7X A;  5A2Q L;  2D62 A;  5C3X A;  2A6E C;  5EPJ A;  2QDL A;  4IUT A;  5C0X H;  1D5X C;  4JCV E;  1A3U A;  1YHB A;  2KA7 A;  4RGO S;  1IBK Q;  1VMP A;  1QVG A;  2ZXP A;  1YNJ C;  3HOZ B;  2EQS A;  3D6W A;  3T16 A;  1RCV D;  3GP7 A;  2Y0S G;  5LMU Q;  4X64 Q;  2E2J H;  5DAU A;  2OTL A;  2R7Z H;  1TWC B;  4K8J A;  4V0B A;  3MEH A;  1UAP A;  1PFB A;  2A1A A;  2F3I A;  2J0T D;  4FXD A;  3CF5 A;  2B2V A;  2UXD L;  2XGT A;  3E0E A;  4DUY Q;  2JA8 H;  4JI7 L;  4PNY A;  4DV1 L;  1L0W A;  3RZO H;  1SYC A;  1ILQ A;  1WTV A;  3CKI B;  3HOU B;  1I3Q B;  3IAY A;  2JP1 A;  5FOB B;  1KLU D;  2RCF A;  1K9M C;  1IBM Q;  4A3M B;  3MWY W;  3STB C;  4OGQ C;  3TS2 A;  4OX9 L;  1UWV A;  4BY1 B;  4CDC C;  1AEX A;  2CFM A;  1MHW C;  4JI3 L;  4DNI A;  2V1C C;  3KYH C;  2ZJP A;  2UXC L;  2WV6 D;  5JEA H;  1E0B A;  5C0X G;  3ERO A;  3RR5 A;  1YHA A;  4JV5 Q;  1PLF A;  2XVS A; 
#chains in the Genus database with same CATH homology
 1C4Q A;  2F0H A;  3SXH A;  1SMY C;  3LNN A;  4KHV A;  2OEO A;  5FO7 B;  3OHX C;  4XQN A;  5FLX L;  3VYT A;  5IGG A;  3R2T A;  3M85 A;  3AB9 A;  3SHL A;  3PIO 3;  1RD9 D;  4PMB A;  4H7B A;  1LTG D;  1CZG A;  1BUV T;  1GJX A;  4M1U B;  1AZQ A;  1BXT A;  2AWN A;  4IUN A;  4LK1 C;  1LO5 D;  1F9R A;  1OXT A;  4A93 B;  1MSH A;  1TS2 A;  2OF1 A;  2PQE A;  4KV6 A;  1I4R A;  3VYU A;  2B8G A;  2NUC A;  4EGV A;  3C3L A;  3QB3 A;  4ZAI A;  3OOC A;  1SDF A;  2XNA C;  4CJ2 C;  1PFM A;  4KKT A;  1XWE A;  3RMH A;  3M3Y B;  1JC7 A;  5K5P A;  1EL0 A;  2PMZ B;  4LMQ D;  2Y0S B;  3HG9 A;  4ZK9 B;  2I46 A;  1J9O A;  4A3K B;  2KQ3 A;  1I4H A;  2E2H B;  2C5C A;  3MFY A;  3M4Y A;  1GHK A;  1EZ6 A;  4QMG A;  1ROD A;  3I4L A;  4FF2 A;  2EYO A;  1DD2 A;  1G29 1;  3I91 A;  4TSS A;  3WOF A;  2FJ2 A;  2NVQ B;  1G2S A;  1FD7 D;  3PV0 A;  1U9R A;  3C46 A;  1A3V A;  4C3J G;  2XWJ B;  1CM9 A;  1J8I A;  2FMM A;  3BYY B;  2LY7 A;  4X3K A;  2PYK A;  2WB1 B;  3DWA A;  3KLR A;  1JWM D;  3G6J B;  1STH A;  5KNB A;  3RZD B;  1I6H B;  4KK7 A;  2F3W A;  1STY A;  4HED A;  2G9H D;  2A74 C;  3D3R A;  2SNS A;  3HS0 C;  3J81 E;  2ZXO A;  3QG1 A;  2G9D A;  2K32 A;  2PNR C;  3MA2 B;  2J4X A;  2DNE A;  5C44 B;  3NK9 A;  3HZX A;  3A8I E;  1PXU A;  3UI2 A;  1Y8P B;  5C0X I;  1F9S A;  3R8B A;  2B2V C;  1S5B D;  5DM6 3;  4FO2 A;  5ELB A;  3S1N B;  1CFM A;  1OXV A;  3I70 A;  1BCP F;  2RSO A;  2L55 A;  2ENB A;  1S5D D;  3PUZ A;  4IAL A;  3HOY B;  4OO1 H;  2SEB D;  1O7Y A;  1T5X D;  3C1F A;  1IYV A;  2J7Z A;  2F0G A;  2OT2 A;  1A6X A;  1SE3 A;  4BBR B;  2IL8 A;  4RFB A;  3S9W A;  1LV9 A;  4A3F B;  4FF4 A;  3H3V C;  1JB3 A;  2O2L D;  1XXG A;  1F77 A;  3D31 A;  1X3P A;  1F2L A;  3RD4 A;  2X6L A;  1EQT A;  3OW7 A;  1LTS D;  3PUV A;  2X6G A;  4G7O C;  3EFX D;  2FIN B;  1SNP A;  4U67 3;  1SYE A;  1JOK A;  3LWE A;  5IGF A;  2EZV A;  4YIJ A;  3D4D A;  2RDG A;  4GZY C;  3BDL A;  1WTX A;  1F2M A;  2HDL A;  3GTG B;  1GUS A;  4FP5 D;  3H94 A;  2BE5 D;  3QO2 A;  1TKW B;  3PMF A;  2CQA A;  5J39 A;  1CQV A;  3S2D B;  2F4I A;  2WKD A;  5E4X A;  1LTR D;  4RKB A;  1TS5 A;  1Z7T A;  5BN3 A;  2H1E A;  5C5M A;  1HFN A;  4RGN A;  4CJ1 B;  3NXW A;  2F0I A;  2XN9 C;  1QOH A;  5FKA C;  5FK9 C;  1UUP A;  3GO5 A;  3WDN A;  4FXG C;  5COR A;  2L5T A;  3T13 A;  2N88 A;  3FPU B;  1B50 A;  1LTT D;  3R93 A;  2DNC A;  1I4P A;  2AQ1 B;  1A2U A;  4F8M A;  1TT2 A;  2NN6 G;  4KD4 A;  3LX0 A;  2K28 A;  3QWN A;  5IGB A;  4O42 A;  1B2T A;  2EJM A;  3FPP A;  4L8J A;  2VXW A;  1QWY A;  4RKL A;  2GA4 B;  4WOR A;  5J22 A;  4KY7 A;  2R3Z A;  2EJF C;  1ZEQ X;  1V1P B;  2K6A A;  1VCI A;  4IUR A;  5CC4 A;  3OIQ A;  3GTK B;  1EYA A;  1BCP B;  5ELD A;  4L63 B;  3M7N A;  1Q1B A;  3MZ5 A;  3PO3 B;  1LT3 D;  4X3T A;  1STN A;  1B3A A;  1HA5 A;  2DY8 A;  1K83 B;  1EY9 A;  1I4Q A;  5EPL A;  2CVR A;  1SNO A;  3RLF A;  3TZU A;  4HCE A;  3MXN A;  4NDX A;  2RQX A;  4K14 A;  1F2Y A;  2KCC A;  4UDU C;  4BA2 I;  1ENC A;  2LMC B;  1G2T A;  2IX3 A;  1GUG A;  1KAA A;  2KED A;  5I6W A;  1PRT F;  3PUX A;  2NTS A;  2X69 A;  1EQV A;  1JOR A;  2FFK B;  4FNF A;  2QCP X;  1GHJ A;  2KHS A;  3SK8 A;  4OIK A;  2MPM A;  4QIW B;  1X32 A;  2YU9 B;  3BDO A;  2K03 A;  2KEC A;  4RGT A;  3Q23 A;  1I50 B;  1JIC A;  2HQE A;  1AFP A;  4H13 C;  1ET9 A;  2A69 C;  1FGB D;  2PPB C;  2C9O A;  2CW0 D;  3A7A B;  1SJE D;  1O7Z A;  4S3S A;  4KI0 A;  1OXS C;  1TR5 A;  4K2K A;  3BVZ A;  3BYT B;  3S1R B;  3S1Q B;  5LHY 1;  4E6I A;  1S5F D;  4K5W A;  1D5Z C;  2PCF B;  3U9O A;  4G57 A;  5CV8 A;  3I4N B;  2N55 A;  1QG7 A;  4PMW A;  4K5X A;  1V1P A;  5C0X J;  1MI2 A;  3N6R A;  5KND A;  5M5Y B;  1TS3 A;  1GUO A;  2E74 C;  3W2D A;  2K5W A;  2EYH A;  2FHT A;  4DK0 A;  2PZW A;  4Y7N B;  3TZD A;  5IT9 E;  4PMC A;  1IL8 A;  4HTH A;  2A68 D;  4IFD G;  5EJW A;  1SSO A;  1PTO D;  3FKI B;  1II3 A;  4RHS A;  1SNQ A;  3DWQ A;  4RCN A;  2QIL A;  1TS4 A;  3DEP A;  3SK4 A;  5KGU A;  3T53 B;  2NN6 I;  5T1I A;  3FMC A;  3K5O A;  5JEA J;  2XIW A;  4R9W A;  2AQ3 B;  1HPC A;  1B44 D;  1SAP A;  5C4J B;  2QDB A;  3S14 B;  1TQO A;  2KCN A;  5CV4 A;  4HN7 A;  5JVH 3;  1CQF A;  1JOQ A;  2QKI C;  4XT1 B;  2PZT A;  2ZXR A;  3S2H B;  4RAU C;  2ID0 A;  2OXP A;  4RCO A;  3A56 A;  1TU2 B;  5IGE A;  2RDH A;  2XRS D;  3ZYY X;  3HOV B;  5TSS A;  1B9N A;  1EY5 A;  2PO4 A;  1D1I A;  3TP8 A;  4U68 A;  5G3L D;  2E75 C;  3SR1 A;  2L9H A;  4K5V A;  1TY0 A;  5HGT A;  4DAY A;  4IUQ A;  4B9X A;  1PRT B;  1ESF A;  3SDZ A;  3D6C A;  3J80 E;  3Q6S A;  4DNR B;  1WTO A;  3KLS X;  3A54 A;  3TP6 A;  3N52 A;  3R2I A;  5KEE A;  1PFN A;  1SBB B;  1F9Q A;  1SXT A;  1Y1W B;  4KN7 C;  5CMD A;  1BQQ T;  1PTO B;  4RWS C;  2D2C C;  1C8C A;  1MGS A;  5M9O A;  1NR4 A;  2AWO A;  5JEA G;  1U4M A;  2RVL A;  1ENF A;  1B4O A;  3NWS A;  3J81 L;  4NMZ A;  1RKN A;  1IW7 D;  1VF5 C;  3NHH A;  4F87 A;  3EA6 A;  1DOK A;  2Q8I B;  4K8I A;  2E2I B;  3PIP 3;  5JOB A;  2O5J C;  3NP8 A;  3FEW X;  1JWU D;  4CHT B;  4X3S A;  3ONA B;  1PZJ D;  3HP3 A;  2AUK A;  4XYO A;  4QF4 A;  4XDX A;  2MUY A;  1LTI D;  1HA6 A;  4BS9 A;  2PW7 A;  1QCB D;  5LL6 X;  2Z8L A;  2F0W A;  2WII B;  1YNN C;  2BOS A;  2B2W A;  1SNM A;  2TSS A;  3MFG A;  2JA6 B;  4IFD I;  2WKC A;  3BDC A;  1B1Z A;  3DXJ C;  2FMC A;  4TRD A;  1FYC A;  5ELF A;  2F0F A;  4BA1 I;  3IL8 A;  1BCP C;  2MHV A;  1CA5 A;  5EKK A;  2A6H C;  2K05 A;  2EY5 A;  1WTR A;  5A35 A;  5JPN C;  4G7H C;  1A3T A;  3DMU A;  3VR3 A;  4C3H G;  1UEA B;  1E2V A;  3K5L A;  5CV6 A;  1LT6 D;  2O5I C;  2K5D A;  4CKB A;  2E2J B;  1WD0 A;  2IW3 A;  4IQZ A;  5F2D A;  1CTM A;  4G4K A;  2L4N A;  2R7Z B;  2BE5 C;  2EYM A;  1OXX K;  3K59 A;  2F3V A;  2JA8 B;  3DEO A;  1EOT A;  2KEE A;  3P1H A;  2H4O A;  3RZO B;  5KYL A;  3Q22 A;  3DHQ A;  3A7L A;  2R61 A;  5CV5 A;  4EVO A;  1HUM A;  2BA1 A;  4CKE A;  1SMY D;  3K5N A;  2AUJ D;  1H9K A;  2A5H A;  4KKS A;  2NWG A;  1I4X A;  1STG A;  1IKL A;  3K6O A;  2F0V A;  1ZYR C;  3L3O C;  3SE0 A;  3CU7 A;  4PV1 C;  3JAM E;  3D4W A;  3TME A;  1W6J A;  5KRU A;  1Q12 A;  5CV9 A;  4C2M B;  2NVY B;  1SJH D;  2F0U A;  1LT4 D;  1WD1 A;  3D8G A;  4J1M A;  3H09 A;  3NTH A;  5BN5 A;  1EY8 A;  1BNZ A;  2VB2 X;  4Q0F A;  2EPB A;  1EWH A;  1H9R A;  5M3M B;  1IYU A;  1TII D;  2F1M A;  5T1G A;  4J6H A;  1FNW A;  3QOL A;  3GTL B;  5CBE E;  1L0Y B;  4A3I B;  2A73 B;  4XQQ A;  4R8I A;  1SYD A;  3H91 A;  4B08 A;  3KF8 A;  4C3J B;  2BDO A;  1Q3L A;  4DF7 A;  2EYF A;  4OO1 G;  2RKS A;  4KKU A;  2F03 A;  3SK5 A;  2R6G A;  5E3F A;  1A15 A;  1O78 A;  3ITP A;  1A2T A;  4A3D B;  1XYI A;  1WTP A;  5IOD A;  3URY A;  2D5D A;  4XXE A;  4F88 A;  2HCC A;  4DXG A;  3BVG A;  4BBS B;  3V2T A;  4ILW A;  2Z4H A;  1RHP A;  1TWA B;  1D5M C;  1HXY D;  3HGB A;  5LL6 S;  4TKO B;  2NTT A;  1V8Q A;  2TMP A;  4K6D A;  4BY7 B;  2IWH A;  1F9P A;  3MXU A;  1S4Z A;  1TWG B;  1RF2 D;  4C3I G;  2RDF A;  1KLG D;  1D6E C;  1CHP D;  1TWH B;  1G6Z A;  4Z9C B;  2JXM B;  4V19 0;  2B2W C;  3MXP A;  3ND9 A;  4N9T A;  1K8M A;  1DJR D;  4JK1 C;  1ICW A;  2RA4 A;  2SOB A;  3NBI A;  4BWG B;  3A8J E;  4C1N I;  3M4O B;  2KVM A;  3IFT A;  4H44 C;  1Y69 U;  1QIL A;  2F0M A;  1Y1V B;  1PRT C;  2QF7 A;  1HTP A;  1E2W A;  4KD3 A;  5AFW A;  3ERQ A;  4UAI A;  3I90 A;  4ID6 A;  5CGK A;  1XTC D;  5KNC A;  1ONL A;  4OIJ A;  1CHQ D;  4DGZ A;  1T5E A;  3VR5 A;  2M2L A;  1PTO C;  1AW7 A;  1DZ1 A;  2WAQ B;  3GQB A;  3FVQ A;  4HCS A;  2EY1 A;  4CGY B;  3EJI A;  2YYZ A;  2O4X A;  4RH6 A;  2ICI A;  1FNV A;  3Q0A A;  5IT9 L;  2K33 A;  4ABN A;  3A55 A;  3LWU A;  5C3E B;  4IFD J;  4B9W A;  4A3E B;  4ZLT F;  1EIG A;  3I73 A;  5EKL A;  2F0K A;  3OMG A;  4DAV A;  1PDQ A;  1HQR D;  3TDQ A;  3MVV A;  4C3I B;  3Q24 A;  3VA7 A;  2JE6 I;  5CV7 A;  1S5E D;  4MN3 A;  4OO1 I;  1Y8O B;  3CRL C;  3TBI B;  5FO8 B;  1PTO F;  1EU4 A;  4OHJ A;  2KUM A;  2B2U A;  2B63 B;  5CYU A;  1Y8N B;  2R93 B;  1GOZ A;  5IOC A;  1HQM C;  1H9S B;  3A8K E;  4XYQ A;  4A3G B;  4Q5V A;  2RBM A;  4ZYS A;  5D3D A;  3OMC A;  1LAC A;  3E5S A;  1JWS D;  4HMI A;  2IJ0 A;  1EYC A;  1SYF A;  2EDG A;  1WCM B;  1SND A;  5EPK A;  4XQJ A;  3J7A V;  3J80 L;  4XTC S;  3VYR A;  4K6L A;  1IKM A;  3K0Y A;  4RHR A;  5D14 A;  4FVM A;  3MTS A;  1R9T B;  3T56 B;  1V43 A;  4HAE A;  1NAP A;  2HCI A;  4ULL A;  5D3I B;  3QJY A;  3KLS A;  2HDM A;  3SVM A;  2EOT A;  1BDO A;  1Q90 A;  1M8A A;  5JVG 3;  3K7A B;  1GXD C;  1EY7 A;  5G3L F;  3GV3 A;  2D9U A;  3T51 B;  2Z4I A;  4CKC A;  3HOW B;  1RJT A;  3L7Z C;  2Z1C A;  2L0C A;  3F2U A;  4FF3 A;  4LJZ C;  4KTA A;  3DWP A;  1HTL D;  3KK7 A;  3PUW A;  5I6Y A;  2E76 C;  3R3O A;  4QUF A;  1I6V C;  2WIN B;  1STE A;  3QOJ A;  4A3J B;  1ILP A;  1STB A;  3X3M A;  3P20 A;  1EY4 A;  2LS0 1;  1MBY A;  2I07 B;  4IUP A;  5EBC A;  1WVL A;  5NUC A;  3GTP B;  1KTK A;  1PMR A;  5M3F B;  1KDC A;  1H9S A;  1G8Z D;  1CT1 D;  1SYB A;  3NUC A;  4RGM A;  2QEJ C;  2R92 B;  3OIP A;  4TQU S;  1SFO B;  5FO9 B;  2JYO A;  1CZW A;  2A69 D;  2K5Q A;  3NE5 B;  1KAB A;  1EIH A;  4I65 A;  1JQY D;  3M7G A;  3GV6 A;  1F2Z A;  2ICE C;  1R4P B;  3S16 B;  1GUT A;  4KY6 A;  2EJG C;  2LKV A;  2IX0 A;  2EYJ A;  2IT1 A;  2K1B A;  2F0E A;  4ZRZ A;  1DXM A;  5E1F A;  2B2T A;  5M5X B;  2WAC A;  3HEJ A;  4ZKB B;  1WTW A;  4MIU A;  1HRJ A;  3GTO B;  1PYW D;  4ZUJ A;  1CK1 A;  3PO2 B;  4K2L A;  3O13 A;  4FYD A;  2B2Y A;  3NTK A;  5C3W A;  2K01 A;  1L0X B;  2HUG A;  2VB3 X;  5A2Q E;  2L1B A;  3HRZ C;  2KJX A;  1XX8 A;  2EY2 A;  3U9S A;  1SEB D;  1BBX C;  5K36 H;  3S1M B;  1TY2 A;  2EVB A;  2L12 A;  5J1Z A;  3SEB A;  1E2Z A;  3NBH A;  1KNE A;  4G7Z C;  3AU7 A;  4NW2 A;  2B2U C;  2SNM A;  3JAM L;  1PZI D;  2Q8T A;  2A6E D;  5I9P A;  4XIG S;  4J8Q A;  1DOL A;  1NSN S;  3P75 A;  4C56 C;  1YNJ D;  5ISR A;  2JA7 B;  1IHZ A;  3IFD A;  4ZQ3 A;  4DK1 A;  1WTQ A;  1JOO A;  3OPO A;  3PUY A;  1LTB D;  4KJN A;  5K36 G;  1VMC A;  3BZD B;  4HSV A;  1CI3 M;  3X3N A;  3MHB A;  4KMU C;  2DY7 A;  4M8A A;  1EY0 A;  1AN8 A;  2XRQ D;  3CHB D;  1EU3 A;  1LLR D;  3H0G B;  3NQI A;  5FLX E;  5E4W C;  4HSP A;  2K04 A;  5M5W B;  4EQO A;  4DXF A;  3V96 A;  1X3Q A;  2MGS A;  2EE1 A;  2JSO A;  3J7A F;  2XWB B;  3KBX A;  3OWF A;  2L11 A;  3I8Z A;  1CA6 A;  2EXZ A;  1D1K A;  1BF4 A;  1U4L A;  1LAB A;  5KIX A;  2E2D C;  2DN8 A;  1ESR A;  4NP5 A;  1LT5 D;  2MP1 A;  2V4D A;  2IPK D;  1GUW A;  2VUM B;  3EVQ A;  1LTA D;  4IN3 A;  2NZ1 D;  4HR7 B;  4KJO A;  2F0P A;  1FNU A;  3C2P A;  3DUZ A;  5EQ0 A;  1HHV A;  3K58 A;  2CHB D;  5JPM C;  1UNS A;  1TWF B;  2F0Q A;  3K57 A;  2NB0 A;  1ZXT A;  2B8F A;  5I9O A;  3KUP A;  3FDT A;  5DNF A;  5DEH A;  2EYP A;  5ELE A;  1KDB A;  2B39 A;  2F0L A;  2PW5 A;  1EY6 A;  3K5M A;  1ET6 A;  1AZP A;  2IX1 A;  4DNT B;  5EKI A;  5C6A A;  1H9J A;  1R4Q B;  1Z6H A;  1EZ8 A;  5C5L A;  4OL7 A;  1YNN D;  3VR2 A;  3I72 A;  2VNU D;  4ZKC B;  3TP7 A;  5COY A;  4C3H B;  2B2T C;  1VDZ A;  1U4P A;  4C1N K;  3MAQ A;  1BCP D;  4KHZ A;  2B2Y C;  1MSG A;  3WOE A;  3ND8 A;  2A6H D;  2EY6 A;  1QNK A;  3NWT A;  4IUU A;  5CR3 A;  1NR2 A;  4DA2 A;  1NCV A;  4FF1 A;  4I7Z C;  4O1N A;  1B9M A;  1ZKO A;  1OO9 B;  3J7Y W;  2XSC A;  2KOL A;  4H0L C;  4WFN 3;  3W3A A;  2NN6 H;  3CQZ B;  4ZUI A;  2NBF A;  3RUZ A;  4L6T B;  4FXK C;  2CW0 C;  1QE6 A;  4QB4 A;  4IZ8 A;  5HUR A;  1Q8I A;  3G7L A;  3I4M B;  3BVM A;  1K8O A;  1DON A;  4PQX A;  3DM1 A;  3MC0 B;  1NUC A;  3T4A C;  4MHE A;  1SYG A;  3VYS A;  4HMJ A;  5KYI A;  3TSS A;  1VF7 A;  2SDF A;  1B53 A;  2M00 A;  1KDA A;  3BG3 A;  4KY5 A;  1QNU A;  1ZYR D;  4ODG A;  1BO0 A;  3IKJ A;  1FR3 A;  3AMU A;  1RTO A;  1EEF D;  3V05 A;  4WRD A;  1RDP D;  5C4H A;  4QUC A;  5I2X A;  2JA5 B;  1S5C D;  3NQT A;  1RTN A;  5IIF A;  4IUV A;  2A68 C;  2RSN A;  1HCZ A;  5IGC A;  2PZU A;  5I4D A;  2F0T A;  5EGT A;  5DM7 3;  3OSO A;  3VA5 A;  1QB5 D;  4KN4 C;  3NSW A;  3D4R A;  2WP8 J;  5C4X B;  1DOM A;  4DFA A;  1BOS A;  3FRP B;  5CBA E;  1PZK D;  1SE4 A;  4CJ0 B;  1SNC A;  5BN4 A;  1STA A;  1U4R A;  4EQP A;  4DN4 M;  1H9M A;  2ZT9 C;  3KBG A;  4RA8 A;  4EQN A;  3GTQ B;  4QCL A;  1JCK B;  1DCZ A;  3EQL C;  3VR6 A;  1HFG A;  1M4V A;  2F0O A;  2EYL A;  2MJ8 A;  3TP5 A;  4AYB B;  5IGD A;  3VR4 A;  3E0J A;  2K7V A;  2JEB I;  1HUN A;  1Q1E A;  3I3C A;  3S15 B;  3GTM B;  1V1O A;  4NKL A;  4JBW A;  1W6K A;  1TVX A;  5EBD A;  2NVT B;  1ML0 D;  2JEA I;  2Q8R E;  5C4Z A;  2F0D A;  4LAA A;  2BCO A;  2AQ2 B;  2F0S A;  3HOX B;  4ME5 A;  3S17 B;  1BR9 A;  1JE4 A;  1PTO H;  4X3U A;  4DU9 A;  1OXU A;  4A3B B;  3H6M A;  1DYQ A;  4IFD H;  4N9P A;  3NTI A;  1EFI D;  1MD2 D;  1D2B A;  1ENA A;  1SE2 A;  1KNA A;  2F0J A;  2M9V A;  5ELC A;  3P7J A;  4CBV A;  2F0N A;  3OWE B;  1EYD A;  4WJW A;  2NYZ D;  1PRT D;  2LFN A;  3NPP A;  3C1E A;  2BA0 A;  1G91 A;  5JAV A;  3GD7 A;  1EWC A;  3MXG A;  1Z47 A;  4XT3 B;  4P2C B;  1IW7 C;  4DAP A;  1GUN A;  3QIA A;  4R8N A;  1QJO A;  2NVX B;  3HKZ B;  3E6Z X;  5JJZ A;  1O80 A;  3SK6 A;  1C48 A;  3L9A X;  1AP0 A;  3TN2 A;  1DM0 B;  1I4G A;  5D65 A;  3CRK C;  3BS1 A;  3GTJ B;  5I2Y A;  2BDN A;  1EEI D;  1JR0 D;  1O7L A;  4F7X A;  5A2Q L;  2D62 A;  5C3X A;  2A6E C;  5EPJ A;  4IUT A;  5C0X H;  1D5X C;  1A3U A;  2KA7 A;  4RGO S;  1VMP A;  2ZXP A;  1YNJ C;  3HOZ B;  3D6W A;  3T16 A;  1RCV D;  3GP7 A;  5DAU A;  1TWC B;  4K8J A;  4V0B A;  3MEH A;  1UAP A;  1PFB A;  2J0T D;  4FXD A;  2B2V A;  4PNY A;  1SYC A;  1ILQ A;  1WTV A;  3CKI B;  3HOU B;  1I3Q B;  3IAY A;  2JP1 A;  5FOB B;  1KLU D;  4A3M B;  3MWY W;  4OGQ C;  4BY1 B;  1AEX A;  2WV6 D;  5JEA H;  1E0B A;  5C0X G;  3ERO A;  1PLF A;  2XVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...