1KAFA

Dna binding domain of the phage t4 transcription factor mota (aa105-211)
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
108
structure length
108
Chain Sequence
MEITSDMEEDKDLMLKLLDKNGFVLKKVEIYRSNYLAILEKRTNGIRNFEINNNGNMRIFGYKMMEHHIQKFTDIGMSCKIAKNGNVYLDIKRSAENIEAVITVASEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription regulatory protein MOTA
publication title The MotA transcription factor from bacteriophage T4 contains a novel DNA-binding domain: the 'double wing' motif.
pubmed doi rcsb
source organism Enterobacteria phage t4
molecule tags Transcription
total genus 33
structure length 108
sequence length 108
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2001-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09158 MotCF Bacteriophage T4 MotA, C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1150.20 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Transcription regulator MotA, C-terminal domain 1kafA00
1KAFA
chains in the Genus database with same CATH superfamily
3FDBA 2HP1A 4JEWA 1KL1A 1KL2A 2QB2A 3L44A 1S09A 3PIUA 1LC5A 3RUYA 3T32A 5EIGB 1QJ5A 5I92A 3LVMA 2ZY5A 4F5JA 1WYTA 2E7UA 2HOXA 3GZDA 3ZZKA 1EQBA 1GC2A 1I43A 2QB3A 4ZWMA 4BQ0A 1AY5A 4GDYA 5KTBA 3EZSA 3OKSA 1B9IA 2GMSA 2X5DA 3MAUA 2HUFA 2TPLA 3B1CA 2VGTA 2D61A 3DRDA 3GZCA 3PDBA 2R0TA 4EB5A 3QPGA 2VMUA 3WCOA 1W23A 3WGBA 4IXSA 2PO3A 3MC6A 4WP0A 3K28A 1WYUA 3DXVA 3WGCA 4U1TA 3AENB 3BV0A 3IHJA 2YCTA 5G4JA 5G2PA 4HVKA 4EMYA 2ZC0A 3FD0A 4LNMA 3E9KA 1AAWA 4XK1A 5EIGA 5BJ3A 3AELA 4K2IA 1ASFA 2ZSLA 1N2TA 2F8JA 5EAVA 1YJSA 4R8DA 2C81A 4Y0DA 5EUEA 2BIEA 1B8GA 4A6RA 1WSTA 2E7JA 1IUGA 2AY3A 1IBJA 5JAYA 4A72A 2AY1A 5EAAA 1GEXA 4KAMA 1BT4A 1DJ9A 1YIYA 1VP4A 1IAYA 4HF8A 4Q31A 3WKRA 3AEMA 8AATA 3QI6A 3K40A 4I8AA 1ARIA 4XEWA 1WYVB 3AENA 1SZUA 3LVLB 2EZ1A 4UHMA 3JWBA 2ZY4A 3NNKA 1TPLA 3NUBA 3W1IA 1VJOA 3GJUA 2O0RA 1LKCA 2YRIA 1M0PA 1ASGA 4UHOA 3TFUA 1B5OA 1CZCA 2AY2A 4RKCA 3MAFB 3FFRA 4MY5A 1VEFA 2VMRA 4PFFA 1C4KA 3MADA 5FT8A 1AKAA 3NYTA 1BJOB 2YHKA 3BS8A 4WYCA 4BHDA 4CBSA 1PMOA 1C0NA 1I41A 2BWPA 2DOUA 2YKXA 1AJRA 2VLHA 2WK7A 3L8AA 3PJ0A 1ASDA 4WYEA 1FC4A 4RAEA 1GDEA 2A1VA 5G09A 4Q76A 4LC3A 1O69A 3KGXA 1AHYA 1I29A 2BKWA 1MDZA 2PB2A 2QLRA 4IXZA 4GRXA 1QITA 2WK9A 1T3IA 3MKJA 4B9BA 3D6KA 2OGEA 3NDNA 2FNUA 4L0OA 1WYVA 4OCAA 1P3WA 2YKYA 2CSTA 3E2YA 2Z61A 4P3MA 1ZODA 3B1EA 1YIZA 2VMOA 2VMWA 2Q7WA 4XJLA 4ATPA 3HL2A 1C7GA 2BI1A 1YAAA 1ASCA 3QM2A 1CL2A 2E54A 3FKDA 1TOKA 3MAFA 4WYGA 1J04A 5M4DA 3ZRPA 4PFNA 2OKJA 3ZRQA 1BJOA 1ASMA 3I4JA 1D7VA 3LVJA 1ASEA 3E6GA 2JJEA 1FG7A 3UWCA 5M49A 1FG3A 2BI5A 4GE4A 1SFFA 1ECXA 4Y0IA 1W7MA 1TOJA 2AY4A 3TCMA 3FQAA 3NX3A 1OXPA 1M4NA 1M32A 1IX8A 4JEZA 1AMAA 3BWNC 4RLGA 2EPJA 1W7NA 2FQ6A 3BC8A 2ZY3A 3CAIA 1QGNA 3UE8A 2YOBA 2G7JA 3FZ8A 3JZLA 1AICA 1OATA 1AY8A 3DR4A 1M7YA 3II0A 5G2QA 4H63Q 2BHXA 4E77A 1YJYA 3VK2A 1AKCA 1YJZA 5F9SA 2GSAA 1MDOA 2CJGA 3H7FA 2W7GA 3AATA 3AEMC 1G4VA 2YKUA 5D5SA 3UAKA 2D63A 3ELPA 4WD2A 4OC9A 5G4IA 4BMKA 1GC4A 2ORDA 2ZYJA 5DJ9A 3ACZA 2VI8A 1DGDA 3HT4A 3RBFA 2QSRA 2HUIA 3LV2A 4XJOA 2X3LA 2Z1ZA 1JS6A 3A8UX 2VMZA 1IAXA 4JF0A 3P1TA 1GBNA 1D7UA 3PDXA 4OT8A 4WYFA 1Y4IA 3NYSA 2BYLA 5M46A 1UU2A 1S06A 4E1OA 5HDMA 4A6UA 1OHVA 4JF1A 2HUUA 2FM1A 1E5EA 1CJ0A 5C6UA 2FYFA 3BWOA 2C7TA 3ZRRA 1V2EA 3GWPA 4WBTA 3TQXA 1G7XA 3JW9A 4EU1A 1C7NA 4H51A 4MSOA 3I5TA 1EG5A 4MQQA 1ARTA 3AEJC 3FVXA 4ZDOA 2HZPA 4NOGA 3EI7A 3WKSA 1QZ9A 1RVUA 3HDOA 3M5UA 3WZFA 3N5MA 2AY9A 3CQ4A 3BWNA 3NU7A 1AHEA 4W5KA 2DGLA 1LW4A 3ECDA 4ZM3A 4ZDPA 3A9XA 4JEXA 4MKJA 3TFTA 4MQRA 4O6ZA 1W7LA 2FN6A 2W8TA 5DB5A 2VMNA 3ASAA 1C9CA 1CZEA 2VMPA 4R2NA 1BJ4A 4MKKA 3EZ1A 4ZLVA 4LW2A 5AX8A 4GEBA 3TATA 2EYQA 3DODA 4ADDA 4FFCA 1AX4A 1GD9A 3HBXA 1LC7A 5DJ1A 2KFPA 1IX7A 1QISA 2VIBA 3Q8NA 2W7FA 3EI6A 1U08A 4P7YA 5F8VA 1GEYA 2WKAA 1SF2A 3FZ6A 1RV4A 5E3KA 3LWSA 2BWOA 2DKBA 5EUDA 4DQ6A 9AATA 4ADEA 3EI9A 3VAXA 1EJIA 2JG2A 1ORDA 2CH2A 2VLFA 4IYOB 4EFFA 3H9XA 4E3RA 2BIGA 2W7HA 3FQ8A 2WB6A 1V2DA 1MAPA 2CH1A 1GEWA 1ZC9A 3OP7A 2V1PA 4R5ZA 4EB7A 2AEUA 1SVVA 3G8MA 3EIBA 2GMUA 3AV7A 3VOMA 1KAFA 2AY7A 3DU4A 4WXFA 1CQ8A 4WXGA 4WYDA 4ZSYA 1SZKA 2W7DA 1OXOA 1X28A 2BI2A 2VGVA 2YCPA 1MLYA 1RV3A 4W8IA 1G4XA 4AO9A 4M2KA 2QMAA 1D2FA 3RCHA 3WY7A 4F5GA 1JF9A 1PG8A 2FKIA 3AEJA 4CBRA 2OATA 4ZASA 1AJSB 3BB8A 1XEYA 3DZZA 1Z7DA 2R2NA 3FVSA 3EI8A 4OBUA 4OTLA 1YNUA 3RI6A 4WLHA 4Y0HA 2WK8A 3PGYA 2AATA 1YOOA 5BJ4A 1KKPA 4GSAA 4W1XA 3QN6A 1ASBA 1G7WA 4CXRA 1ELUA 4LW4A 3LG0A 2AY6A 2CJHA 3GETA 3I16A 1MAQA 3AOVA 2BIAA 1DKAA 3COGA 1D7RA 1Z3ZA 1AIAA 2D66A 5FT4A 4IYOA 4KXKA 1V72A 3KE3A 4ITXA 5FT6A 4RKDA 4LNLA 4PVFA 4TMRA 3VK3A 1X2AA 1UKJA 1TASA 2C44A 2VGZA 4OYTA 1LK9A 3VK4A 1DTYA 4A00A 5DX5A 2O7CA 2VGSA 2ZP7A 3AOWA 3DYDA 1S0AA 3AEPA 4WLJA 2O1BA 1ASAA 4A0FA 4ZM4A 4MQPA 4F5HA 2VMTA 3QGUA 1AIBA 1GC0A 3CBFA 1AJSA 3NRAA 2VMVA 3HMUA 2W7IA 4OMAA 4F4EA 1ASNA 1TOIA 1B4XA 2YKVA 3CQ6A 3N4RA 3N75A 2VMXA 3QBOA 4R5FA 1I48A 2XH1A 1N8PA 4M2JA 3PD6B 5D95A 4LNJA 4CXQA 4F5FA 3BCXA 4ZAHA 1UU0A 1DJEA 2AY8A 4QGRA 3R9AA 3N0LA 1M0OA 2W8VA 1AMQA 4RJ0A 4AH3A 4W91A 2JGTA 2D7YA 4AOAA 1PFFA 3A2BA 2W8WA 3F9TA 2GB3A 4XAUA 2Z1YA 4N0WA 1W3UA 2VYCA 4ZDLA 4ATQA 3USFA 3RQ1A 3B46A 3EI5A 4ADBA 3FDDA 3FVUA 1O62A 3PPLA 5EFSA 1PMMA 4UOYA 1MGVA 4JEVA 2DKJA 3MEBA 1ELQA 3FFHA 4K2MA 3ATHA 1BJWA 1BS0A 3DR7A 2EZ2A 2G6WA 1X29A 4JEYA 2QBTA 2Z20A 2D65A 2W8JA 3G0TA 3NUIA 1CL1A 4BA5A 1IVRA 2OQXA 3JTXA 1DGEA 5IWQA 3PA9A 1MDXA 3KKIA 3F6TA 3WX9A 2Z9WA 2D7ZA 3PD6A 5EUNA 2ZJGA 1ARSA 2BWNA 3E2ZB 4ZWVA 2JJGA 5HHYA 2R5CB 1IJIA 5J8QA 4A6TA 2EGYA 1MLZA 2OKKA 2PB0A 1LS3A 2CY8A 3HQTA 1GCKA 4ZSWA 4A0HA 3EUCA 3DC1A 4ISYA 2FNIA 3ISLA 2VMSA 1KMJA 5E4ZA 1AAMA 1CQ7A 1TARA 2W7EA 3ELEA 1H0CA 4Q6RA 3GSBA 5E5IA 3A9ZA 2HORA 3A9YA 3B8XA 2W7LA 4GE7A 5M4BA 1M0NA 2BI3A 1N31A 4DGTA 2W7KA 3N4XA 4WYAA 3BN1A 4ITGA 1LW5A 1AHXA 3F0HA 3R4TA 2X5FA 5K8BA 1QIRA 1KMKA 1AY4A 1DJUA 1OHYA 3ASBA 3FRKA 3KGWA 3NYUA 2YRRA 1BJNA 2CTZA 3HLMA 4ADCA 1UU1A 1M6SA 3EIAA 1OHWA 3N4SA 3LY1A 3DXWA 2VGWA 3E2ZA 3GBXA 2E7IA 1S07A 2JISA 1BQAA 2R5CA 2AEVA 2C0RA 4GE9A 1AKBA 3ZZJA 1BKGA 1KKJA 3FCRA 1SZSA 4DBCA 4J8LA 1M0QA 2XBNA 2CANA 1D7SA 1QJ3A 1C7OA 1AHGA 5EQCA 3VP6A 4A0GA 4WXBA 1AMSA 1BQDA 3WLXA 2Z9UA 4OBVA 1GC3A 1X0MA 1E5FA 3HVYA 4BA4A 4IY7A 3RBLA 4XJPA 1J32A 4XQ2A 1JG8A 3W1HA 2GQNA 2VIAA 3FTBA 4PIWA 4A0RA 4AZJA 4TN4A 2ZUKA 1B9HA 1S08A 2DGMA 1H1CA 1SPAA 2NMPA 1ASLA 2OGAA 3AEOA 3FZ7A 4F5MA 1CS1A 4K05A 4B98A 1LC8A 2DGKA 2ZSMA 4CVQA 1ZOBA 2EO5A 3GR9A 4IW7A 4Q75A 2W7MA 1DFOA 7AATA 1JS3A 3QHXA 4J5UA 1B5PA 4RITA 2JJHA 1TOGA 4F5LA 1V2FA 2JJFA 3GZDC 3E77A 1XI9A 1AMRA 5G0AA 3NU8A 4WB0B 2D5YA 1ARHA 2YCNA 4IXOA 3G7QA 2DR1A 1ARGA 4RJYA 3WCNA 1RVYA 3CQ5A 2CJDA 2X8UA 2VMQA 2W8UA 2ZY2A 2D64A 3RCHB 2RFVA 1AHFA 1CQ6A 3JWAA 3FSLA 2AY5A 3P6KA 3MC6C 3FQ7A 3LVKA 4RIZA 1WYTB 5TF5A 2V0YA 2Z9XA 3BCAA 4UQVA 4W1WA 2HOZA 4XJMA 4U2HA 1TATA 3BCBA 3W1JA 2VMYA 1BW0A 4FL0A 2QA3A 2W7JA 4AO4A 2CB1A 3B1DA 2CFBA 2BI9A 3PDBB 2R5EA 4UHNA 3E2FA 4F5IA 2HP2A 4E3QA 5FT5A 2VGUA 2BYJA 4KYOA 2Z9VA 4WB0A 1IX6A 3K7YA 4K2BA 1WYUB 2EH6A 4AZKA 1O61A 2HOYA 4IX8A 1WKGA 3N7NA 4W1VA 3NTJA 1WKHA 4RM1A 4F5KA 1TOEA 2VI9A 1O4SA 3PAAA 3MBBA 2CINA 4M2MA 5HXXA
chains in the Genus database with same CATH topology
1KAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KAF A; 
#chains in the Genus database with same CATH topology
 3FDB A;  2HP1 A;  4JEW A;  1KL1 A;  1KL2 A;  2QB2 A;  3L44 A;  1S09 A;  3PIU A;  1LC5 A;  3RUY A;  3T32 A;  5EIG B;  1QJ5 A;  5I92 A;  3LVM A;  2ZY5 A;  4F5J A;  1WYT A;  2E7U A;  2HOX A;  3GZD A;  3ZZK A;  1EQB A;  1GC2 A;  1I43 A;  2QB3 A;  4ZWM A;  4BQ0 A;  1AY5 A;  4GDY A;  5KTB A;  3EZS A;  3OKS A;  1B9I A;  2GMS A;  2X5D A;  3MAU A;  2HUF A;  2TPL A;  3B1C A;  2VGT A;  2D61 A;  3DRD A;  3GZC A;  3PDB A;  2R0T A;  4EB5 A;  3QPG A;  2VMU A;  3WCO A;  1W23 A;  3WGB A;  4IXS A;  2PO3 A;  3MC6 A;  4WP0 A;  3K28 A;  1WYU A;  3DXV A;  3WGC A;  4U1T A;  3AEN B;  3BV0 A;  3IHJ A;  2YCT A;  5G4J A;  5G2P A;  4HVK A;  4EMY A;  2ZC0 A;  3FD0 A;  4LNM A;  3E9K A;  1AAW A;  4XK1 A;  5EIG A;  5BJ3 A;  3AEL A;  4K2I A;  1ASF A;  2ZSL A;  1N2T A;  2F8J A;  5EAV A;  1YJS A;  4R8D A;  2C81 A;  4Y0D A;  5EUE A;  2BIE A;  1B8G A;  4A6R A;  1WST A;  2E7J A;  1IUG A;  2AY3 A;  1IBJ A;  5JAY A;  4A72 A;  2AY1 A;  5EAA A;  1GEX A;  4KAM A;  1BT4 A;  1DJ9 A;  1YIY A;  1VP4 A;  1IAY A;  4HF8 A;  4Q31 A;  3WKR A;  3AEM A;  8AAT A;  3QI6 A;  3K40 A;  4I8A A;  1ARI A;  4XEW A;  1WYV B;  3AEN A;  1SZU A;  3LVL B;  2EZ1 A;  4UHM A;  3JWB A;  2ZY4 A;  3NNK A;  1TPL A;  3NUB A;  3W1I A;  1VJO A;  3GJU A;  2O0R A;  1LKC A;  2YRI A;  1M0P A;  1ASG A;  4UHO A;  3TFU A;  1B5O A;  1CZC A;  2AY2 A;  4RKC A;  3MAF B;  3FFR A;  4MY5 A;  1VEF A;  2VMR A;  4PFF A;  1C4K A;  3MAD A;  5FT8 A;  1AKA A;  3NYT A;  1BJO B;  2YHK A;  3BS8 A;  4WYC A;  4BHD A;  4CBS A;  1PMO A;  1C0N A;  1I41 A;  2BWP A;  2DOU A;  2YKX A;  1AJR A;  2VLH A;  2WK7 A;  3L8A A;  3PJ0 A;  1ASD A;  4WYE A;  1FC4 A;  4RAE A;  1GDE A;  2A1V A;  5G09 A;  4Q76 A;  4LC3 A;  1O69 A;  3KGX A;  1AHY A;  1I29 A;  2BKW A;  1MDZ A;  2PB2 A;  2QLR A;  4IXZ A;  4GRX A;  1QIT A;  2WK9 A;  1T3I A;  3MKJ A;  4B9B A;  3D6K A;  2OGE A;  3NDN A;  2FNU A;  4L0O A;  1WYV A;  4OCA A;  1P3W A;  2YKY A;  2CST A;  3E2Y A;  2Z61 A;  4P3M A;  1ZOD A;  3B1E A;  1YIZ A;  2VMO A;  2VMW A;  2Q7W A;  4XJL A;  4ATP A;  3HL2 A;  1C7G A;  2BI1 A;  1YAA A;  1ASC A;  3QM2 A;  1CL2 A;  2E54 A;  3FKD A;  1TOK A;  3MAF A;  4WYG A;  1J04 A;  5M4D A;  3ZRP A;  4PFN A;  2OKJ A;  3ZRQ A;  1BJO A;  1ASM A;  3I4J A;  1D7V A;  3LVJ A;  1ASE A;  3E6G A;  2JJE A;  1FG7 A;  3UWC A;  5M49 A;  1FG3 A;  2BI5 A;  4GE4 A;  1SFF A;  1ECX A;  4Y0I A;  1W7M A;  1TOJ A;  2AY4 A;  3TCM A;  3FQA A;  3NX3 A;  1OXP A;  1M4N A;  1M32 A;  1IX8 A;  4JEZ A;  1AMA A;  3BWN C;  4RLG A;  2EPJ A;  1W7N A;  2FQ6 A;  3BC8 A;  2ZY3 A;  3CAI A;  1QGN A;  3UE8 A;  2YOB A;  2G7J A;  3FZ8 A;  3JZL A;  1AIC A;  1OAT A;  1AY8 A;  3DR4 A;  1M7Y A;  3II0 A;  5G2Q A;  4H63 Q;  2BHX A;  4E77 A;  1YJY A;  3VK2 A;  1AKC A;  1YJZ A;  5F9S A;  2GSA A;  1MDO A;  2CJG A;  3H7F A;  2W7G A;  3AAT A;  3AEM C;  1G4V A;  2YKU A;  5D5S A;  3UAK A;  2D63 A;  3ELP A;  4WD2 A;  4OC9 A;  5G4I A;  4BMK A;  1GC4 A;  2ORD A;  2ZYJ A;  5DJ9 A;  3ACZ A;  2VI8 A;  1DGD A;  3HT4 A;  3RBF A;  2QSR A;  2HUI A;  3LV2 A;  4XJO A;  2X3L A;  2Z1Z A;  1JS6 A;  3A8U X;  2VMZ A;  1IAX A;  4JF0 A;  3P1T A;  1GBN A;  1D7U A;  3PDX A;  4OT8 A;  4WYF A;  1Y4I A;  3NYS A;  2BYL A;  5M46 A;  1UU2 A;  1S06 A;  4E1O A;  5HDM A;  4A6U A;  1OHV A;  4JF1 A;  2HUU A;  2FM1 A;  1E5E A;  1CJ0 A;  5C6U A;  2FYF A;  3BWO A;  2C7T A;  3ZRR A;  1V2E A;  3GWP A;  4WBT A;  3TQX A;  1G7X A;  3JW9 A;  4EU1 A;  1C7N A;  4H51 A;  4MSO A;  3I5T A;  1EG5 A;  4MQQ A;  1ART A;  3AEJ C;  3FVX A;  4ZDO A;  2HZP A;  4NOG A;  3EI7 A;  3WKS A;  1QZ9 A;  1RVU A;  3HDO A;  3M5U A;  3WZF A;  3N5M A;  2AY9 A;  3CQ4 A;  3BWN A;  3NU7 A;  1AHE A;  4W5K A;  2DGL A;  1LW4 A;  3ECD A;  4ZM3 A;  4ZDP A;  3A9X A;  4JEX A;  4MKJ A;  3TFT A;  4MQR A;  4O6Z A;  1W7L A;  2FN6 A;  2W8T A;  5DB5 A;  2VMN A;  3ASA A;  1C9C A;  1CZE A;  2VMP A;  4R2N A;  1BJ4 A;  4MKK A;  3EZ1 A;  4ZLV A;  4LW2 A;  5AX8 A;  4GEB A;  3TAT A;  2EYQ A;  3DOD A;  4ADD A;  4FFC A;  1AX4 A;  1GD9 A;  3HBX A;  1LC7 A;  5DJ1 A;  2KFP A;  1IX7 A;  1QIS A;  2VIB A;  3Q8N A;  2W7F A;  3EI6 A;  1U08 A;  4P7Y A;  5F8V A;  1GEY A;  2WKA A;  1SF2 A;  3FZ6 A;  1RV4 A;  5E3K A;  3LWS A;  2BWO A;  2DKB A;  5EUD A;  4DQ6 A;  9AAT A;  4ADE A;  3EI9 A;  3VAX A;  1EJI A;  2JG2 A;  1ORD A;  2CH2 A;  2VLF A;  4IYO B;  4EFF A;  3H9X A;  4E3R A;  2BIG A;  2W7H A;  3FQ8 A;  2WB6 A;  1V2D A;  1MAP A;  2CH1 A;  1GEW A;  1ZC9 A;  3OP7 A;  2V1P A;  4R5Z A;  4EB7 A;  2AEU A;  1SVV A;  3G8M A;  3EIB A;  2GMU A;  3AV7 A;  3VOM A;  1KAF A;  2AY7 A;  3DU4 A;  4WXF A;  1CQ8 A;  4WXG A;  4WYD A;  4ZSY A;  1SZK A;  2W7D A;  1OXO A;  1X28 A;  2BI2 A;  2VGV A;  2YCP A;  1MLY A;  1RV3 A;  4W8I A;  1G4X A;  4AO9 A;  4M2K A;  2QMA A;  1D2F A;  3RCH A;  3WY7 A;  4F5G A;  1JF9 A;  1PG8 A;  2FKI A;  3AEJ A;  4CBR A;  2OAT A;  4ZAS A;  1AJS B;  3BB8 A;  1XEY A;  3DZZ A;  1Z7D A;  2R2N A;  3FVS A;  3EI8 A;  4OBU A;  4OTL A;  1YNU A;  3RI6 A;  4WLH A;  4Y0H A;  2WK8 A;  3PGY A;  2AAT A;  1YOO A;  5BJ4 A;  1KKP A;  4GSA A;  4W1X A;  3QN6 A;  1ASB A;  1G7W A;  4CXR A;  1ELU A;  4LW4 A;  3LG0 A;  2AY6 A;  2CJH A;  3GET A;  3I16 A;  1MAQ A;  3AOV A;  2BIA A;  1DKA A;  3COG A;  1D7R A;  1Z3Z A;  1AIA A;  2D66 A;  5FT4 A;  4IYO A;  4KXK A;  1V72 A;  3KE3 A;  4ITX A;  5FT6 A;  4RKD A;  4LNL A;  4PVF A;  4TMR A;  3VK3 A;  1X2A A;  1UKJ A;  1TAS A;  2C44 A;  2VGZ A;  4OYT A;  1LK9 A;  3VK4 A;  1DTY A;  4A00 A;  5DX5 A;  2O7C A;  2VGS A;  2ZP7 A;  3AOW A;  3DYD A;  1S0A A;  3AEP A;  4WLJ A;  2O1B A;  1ASA A;  4A0F A;  4ZM4 A;  4MQP A;  4F5H A;  2VMT A;  3QGU A;  1AIB A;  1GC0 A;  3CBF A;  1AJS A;  3NRA A;  2VMV A;  3HMU A;  2W7I A;  4OMA A;  4F4E A;  1ASN A;  1TOI A;  1B4X A;  2YKV A;  3CQ6 A;  3N4R A;  3N75 A;  2VMX A;  3QBO A;  4R5F A;  1I48 A;  2XH1 A;  1N8P A;  4M2J A;  3PD6 B;  5D95 A;  4LNJ A;  4CXQ A;  4F5F A;  3BCX A;  4ZAH A;  1UU0 A;  1DJE A;  2AY8 A;  4QGR A;  3R9A A;  3N0L A;  1M0O A;  2W8V A;  1AMQ A;  4RJ0 A;  4AH3 A;  4W91 A;  2JGT A;  2D7Y A;  4AOA A;  1PFF A;  3A2B A;  2W8W A;  3F9T A;  2GB3 A;  4XAU A;  2Z1Y A;  4N0W A;  1W3U A;  2VYC A;  4ZDL A;  4ATQ A;  3USF A;  3RQ1 A;  3B46 A;  3EI5 A;  4ADB A;  3FDD A;  3FVU A;  1O62 A;  3PPL A;  5EFS A;  1PMM A;  4UOY A;  1MGV A;  4JEV A;  2DKJ A;  3MEB A;  1ELQ A;  3FFH A;  4K2M A;  3ATH A;  1BJW A;  1BS0 A;  3DR7 A;  2EZ2 A;  2G6W A;  1X29 A;  4JEY A;  2QBT A;  2Z20 A;  2D65 A;  2W8J A;  3G0T A;  3NUI A;  1CL1 A;  4BA5 A;  1IVR A;  2OQX A;  3JTX A;  1DGE A;  5IWQ A;  3PA9 A;  1MDX A;  3KKI A;  3F6T A;  3WX9 A;  2Z9W A;  2D7Z A;  3PD6 A;  5EUN A;  2ZJG A;  1ARS A;  2BWN A;  3E2Z B;  4ZWV A;  2JJG A;  5HHY A;  2R5C B;  1IJI A;  5J8Q A;  4A6T A;  2EGY A;  1MLZ A;  2OKK A;  2PB0 A;  1LS3 A;  2CY8 A;  3HQT A;  1GCK A;  4ZSW A;  4A0H A;  3EUC A;  3DC1 A;  4ISY A;  2FNI A;  3ISL A;  2VMS A;  1KMJ A;  5E4Z A;  1AAM A;  1CQ7 A;  1TAR A;  2W7E A;  3ELE A;  1H0C A;  4Q6R A;  3GSB A;  5E5I A;  3A9Z A;  2HOR A;  3A9Y A;  3B8X A;  2W7L A;  4GE7 A;  5M4B A;  1M0N A;  2BI3 A;  1N31 A;  4DGT A;  2W7K A;  3N4X A;  4WYA A;  3BN1 A;  4ITG A;  1LW5 A;  1AHX A;  3F0H A;  3R4T A;  2X5F A;  5K8B A;  1QIR A;  1KMK A;  1AY4 A;  1DJU A;  1OHY A;  3ASB A;  3FRK A;  3KGW A;  3NYU A;  2YRR A;  1BJN A;  2CTZ A;  3HLM A;  4ADC A;  1UU1 A;  1M6S A;  3EIA A;  1OHW A;  3N4S A;  3LY1 A;  3DXW A;  2VGW A;  3E2Z A;  3GBX A;  2E7I A;  1S07 A;  2JIS A;  1BQA A;  2R5C A;  2AEV A;  2C0R A;  4GE9 A;  1AKB A;  3ZZJ A;  1BKG A;  1KKJ A;  3FCR A;  1SZS A;  4DBC A;  4J8L A;  1M0Q A;  2XBN A;  2CAN A;  1D7S A;  1QJ3 A;  1C7O A;  1AHG A;  5EQC A;  3VP6 A;  4A0G A;  4WXB A;  1AMS A;  1BQD A;  3WLX A;  2Z9U A;  4OBV A;  1GC3 A;  1X0M A;  1E5F A;  3HVY A;  4BA4 A;  4IY7 A;  3RBL A;  4XJP A;  1J32 A;  4XQ2 A;  1JG8 A;  3W1H A;  2GQN A;  2VIA A;  3FTB A;  4PIW A;  4A0R A;  4AZJ A;  4TN4 A;  2ZUK A;  1B9H A;  1S08 A;  2DGM A;  1H1C A;  1SPA A;  2NMP A;  1ASL A;  2OGA A;  3AEO A;  3FZ7 A;  4F5M A;  1CS1 A;  4K05 A;  4B98 A;  1LC8 A;  2DGK A;  2ZSM A;  4CVQ A;  1ZOB A;  2EO5 A;  3GR9 A;  4IW7 A;  4Q75 A;  2W7M A;  1DFO A;  7AAT A;  1JS3 A;  3QHX A;  4J5U A;  1B5P A;  4RIT A;  2JJH A;  1TOG A;  4F5L A;  1V2F A;  2JJF A;  3GZD C;  3E77 A;  1XI9 A;  1AMR A;  5G0A A;  3NU8 A;  4WB0 B;  2D5Y A;  1ARH A;  2YCN A;  4IXO A;  3G7Q A;  2DR1 A;  1ARG A;  4RJY A;  3WCN A;  1RVY A;  3CQ5 A;  2CJD A;  2X8U A;  2VMQ A;  2W8U A;  2ZY2 A;  2D64 A;  3RCH B;  2RFV A;  1AHF A;  1CQ6 A;  3JWA A;  3FSL A;  2AY5 A;  3P6K A;  3MC6 C;  3FQ7 A;  3LVK A;  4RIZ A;  1WYT B;  5TF5 A;  2V0Y A;  2Z9X A;  3BCA A;  4UQV A;  4W1W A;  2HOZ A;  4XJM A;  4U2H A;  1TAT A;  3BCB A;  3W1J A;  2VMY A;  1BW0 A;  4FL0 A;  2QA3 A;  2W7J A;  4AO4 A;  2CB1 A;  3B1D A;  2CFB A;  2BI9 A;  3PDB B;  2R5E A;  4UHN A;  3E2F A;  4F5I A;  2HP2 A;  4E3Q A;  5FT5 A;  2VGU A;  2BYJ A;  4KYO A;  2Z9V A;  4WB0 A;  1IX6 A;  3K7Y A;  4K2B A;  1WYU B;  2EH6 A;  4AZK A;  1O61 A;  2HOY A;  4IX8 A;  1WKG A;  3N7N A;  4W1V A;  3NTJ A;  1WKH A;  4RM1 A;  4F5K A;  1TOE A;  2VI9 A;  1O4S A;  3PAA A;  3MBB A;  2CIN A;  4M2M A;  5HXX A; 
#chains in the Genus database with same CATH homology
 1KAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...