1KAWA

Structure of single stranded dna binding protein (ssb)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
110
structure length
96
Chain Sequence
b'RGVNKVILVGNLGQDPEVRYMAVANITLATSESEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SINGLE-STRANDED DNA BINDING PROTEIN
publication title Crystal structure of the homo-tetrameric DNA binding domain of Escherichia coli single-stranded DNA-binding protein determined by multiwavelength x-ray diffraction on the selenomethionyl protein at 2.9-A resolution.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 11
structure length 96
sequence length 110
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1996-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1kawA00
1Q12A 3GD7A 3GTJH 4IJHA 3M7NA 4DR7L 4DV6Q 3FKIH 1HR0L 1PH3A 3E0EA 3I4NH 4KLKA 1YVCA 5HGQA 2LXKA 1VQ7A 2BA1A 3JAMc 3T1YQ 2D0OA 4B3TL 1S40A 4DV2Q 2KBNA 4LF5Q 1EYGA 2ZM6Q 1BVSA 3OTOL 3B6YA 2NN6I 5C44G 1CKMA 4HIOA 5C44H 4IPCA 1EOVA 1HR0W 2C35B 1N8RC 5ELNA 1YITA 1BKBA 4LW1A 2JA8H 4JI3L 1TWCH 2F4VQ 5M5WH 4HIDA 2AWOA 1WJJA 1I5FA 3J81j 4JI6Q 4P73A 1EWIA 4TQUS 3WWVA 2OWOA 4OX9Q 1D7QA 3KJOA 1YJNA 2Y0SE 5LMNQ 2NVQH 2GN5A 4A3IH 3EN2A 3J7ZC 1YNXA 2A8VA 1N32L 4X62Q 1NY4A 1PA6A 1A62A 1EQRA 3CQZH 1B7YB 1VCIA 2QEXA 4BXXH 4QIWE 1VS0A 3MXNB 1S3OA 1HNZL 4LFBQ 4ALPA 4JCVE 3S14H 3KDFB 4P71A 3U4ZA 1PH5A 4JI4Q 4QL5A 4A4IA 4EQ5A 4JBJA 1VQLA 3CC4A 1YBYA 2IT1A 3J81c 1RIPA 1JE5A 2Z0SA 3TEHB 1PV4A 2OTLA 4JC0A 3PO2H 4JYAQ 2JJQA 4DUYL 1N36Q 3CAMA 1L2FA 4BBSG 3M9BA 4BBSH 3K80C 4A3JH 2R7ZG 3A5UA 1GVPA 1OXVA 3CCQA 2JA9A 1XNRQ 3HOWG 3HOZG 3HOWH 1H95A 1C7YA 2K14A 4DR2L 2N49A 1VQFA 2I5HA 4YY3Q 3HOYG 3L0OA 2K50A 2I5MX 2PNHA 2IX1A 4LWCA 4GN5A 1N33L 1UEBA 2YTVA 2VQEL 2KENA 2IY5B 2JA5G 1ASYA 3EIVA 1CKNB 2ES2A 4JOIC 1UE5A 1NTGA 1X54A 1R9TH 2JA5H 1SRUA 3SGIA 5M5XH 1K83H 1XTDA 2NVXH 4DKAC 4IO9A 1CSPA 4DR6Q 1X3EA 2UXBQ 1V9PA 3G6EA 4QQBX 3K81C 1W3SA 2BA0A 3TS2A 3JAMi 3HOUG 2E8GA 3HOUH 2K75A 5IWAL 4X66Q 1HNXL 2UUBQ 2EXDA 4X65L 4IOCA 4LF6Q 3J7A5 2ID0A 3CCUA 3RR5A 2K52A 1TXYA 5IP9H 3I56A 4R4OA 4GKKQ 4JBMA 3L7ZC 4L5SA 5ELOA 5IE8A 4A93H 1KAWA 3MEFA 4PZ7A 3K7AH 5C4XH 5M3FG 3RN2A 2NN6G 3ICEA 5IYDH 3F2CA 1VQCA 3BJUA 4YCVA 3G71A 1Q81C 1IBMQ 1PH8A 3PUZA 4JI5L 4DV4L 1I50H 1JJ2A 4DUZL 3LGJA 3PIOA 3HOXG 3OYYA 2GVAA 3CPWA 5AJ3L 1K9MC 1K8GA 4GKJL 1YHAA 3CF5A 1VQ9A 4A3LG 4A3LH 1P16A 1E24A 2ZJPA 4NXML 1G51A 2N3SA 1I6HH 1Z47A 2DUDA 4Y7NH 3U58A 3FHWA 5IP7G 1PVOA 3NEMA 1E22A 4AYBE 1HZ9A 4R1JA 1V43A 1J5EL 3UE0A 2RCNA 4A3EG 1E1TA 1JJGA 3CCJA 5C3EG 2UU9L 3J81i 5C3EH 3S2DH 1Q8KA 3HFZB 2AMCB 5BR8L 3CW2C 3UDGA 1N34Q 4ME3A 1X3FA 3CPFA 1P8LA 3CCMA 3F2DA 3S15H 2PI2E 3HKSA 1XMQL 4LF8Q 5IYBG 3CD6A 2KHIA 5GAEC 1SMXA 2CCZA 2YTXA 4JI0Q 4A3CG 1BBWA 4DR3L 4JI2L 4A3BG 4A3CH 1YJWA 5FLMH 1X9NA 1QVFA 3GTLH 1OTCA 2JEBI 1FGUA 5GQOA 4DR5Q 1FJGQ 4R4CA 2UUAL 4DV7Q 1XNQL 1OXTA 5GAHC 2JK8A 1XPOA 2NZHA 1GD7A 2MNAA 2GVBA 4IJLA 1U0LA 3T1HL 4DV5Q 1TWHH 2CFMA 4AQYL 1XMOL 1YHQA 4YHHL 3GTMH 2E2JH 4JV5L 3FKIG 3S1RH 3I4NG 4DV0L 2JA6H 3H0GG 4BY1H 3RNUA 1FVIA 3H0GH 4IPHA 1VQOA 5JJLA 4UP7A 3KF6B 1SFOH 3PF4A 2HIXA 3RLNA 4LFAQ 2YV5A 2MQHA 2D62A 2VQFL 1NMGA 4LFCQ 1AH9A 4DR7Q 1WFQA 1OXUA 3GDEA 1PH1A 2JA8G 2YTYA 1HR0Q 2VS1A 4DV2L 4LF5L 1PH9A 2VNUD 1L1OB 3CC2A 4GNXB 2MO0A 3W1BA 3S17H 3KDFA 4B3MQ 3CP0A 1VQHA 2VZAA 3PO3H 3PUVA 3PUWA 4A3IG 4JI1Q 1KL9A 3CMAA 1TWFH 3TREA 2Q2UA 4JI3Q 4IPDA 4DV1Q 2WAQE 1A0IA 1YJ9A 4BXXG 3ZJYC 1OXXK 4GN3B 5M3MH 4PMWA 3IRBA 5C4JH 4X62L 2HHHL 2CWPA 5K36G 2V1CC 3RLFA 1VQPA 3I7FA 4TVAB 1N32Q 1QUQB 1IBKQ 2ZJRA 3RLOA 1BBUA 2UXCQ 4LFBL 4LF4Q 3UE1A 2B29A 3PO2G 1CKNA 2JQOA 3KF8B 4JI4L 1I94Q 2ATWA 2F52A 1HNWL 3H3VH 4LUVA 4A3JG 4GLAC 4UPAA 3D0FA 3HKZE 2B63H 1PH4A 1MIUA 4JYAL 2EIFA 4WJ4A 4RMFA 4DNIA 4DV3Q 2PMZE 3BU2A 2A19A 1QZGA 1VQ8A 3S1NH 1SN8A 1VQBA 4OWXB 2WP8J 4GLVB 2BH2A 2K5HA 2R93G 3KFUA 2R93H 2ZTEA 4EX5A 1G291 2WB1G 4L5TA 3STBC 3E9IA 4RG1A 2Q2IA 4OXPA 4O2DA 4XIGS 2QA4A 1Q1BA 4LF7Q 1LM0A 1Q86C 1OXSC 4A3FG 4OWWB 3H15A 3I2ZA 4A3FH 4YWMA 4DR1L 3PUXA 1MJEA 1IBLQ 3M4OH 2VQEQ 1X55A 4POGA 3RN5A 2PQAB 5IP9G 1Q1EA 4JI8Q 2UXBL 2A1AA 5JEAJ 4C3HH 2VY3A 2QGQA 2NVTH 4LUZA 4A93G 3KLWA 2UUBL 4X66L 5C4XG 4KHPQ 3CMEA 1GM5A 5JEAG 5IYDG 4JBWA 4LF6L 2K5VA 4YWKA 2ZJQA 1X65A 3HOVH 1KXLA 3U4VA 1N9WA 1VQGA 3STBD 2UUCQ 4L5RC 4AH6A 1SROA 4FDBA 2N78A 1SE8A 2YYZA 2JEAI 5M5YH 4UY8C 1Q7YC 3M85A 1SR3A 3CC7A 3S1QH 3K8AA 1S72A 4MNOA 2B3GA 3M3YH 2E2IH 2AHOB 1HJPA 2R7DA 1IBML 2BH8A 3BZCA 2UXDQ 4GS3A 4POFA 2R6GA 4LF9Q 5IYCH 4A75A 4JI7L 2D0PA 2OCEA 4QY7A 1K73C 1A63A 3H3VI 1VQDA 1KHIA 4GOPB 1VQ4A 4X64Q 1IYJB 3ULJA 5AJ3Q 2I0QA 4B3SL 3AEVA 4K0KQ 3GTOH 3S1MH 1PFSA 4A3MG 2LXJA 4A3MH 3OW2A 1KIXA 4DR4L 2N8NA 1PYSB 2KHJA 2YU9H 1VQKA 2ASBA 1U5KA 3K7UC 1NMFA 2AWNA 3VDYA 3GTKH 3M4QA 3KF6A 3AFPA 4YWLA 4L5QA 2FXQA 4C2MH 5LMUQ 4GLXA 1N34L 4YCWA 2Y0SG 5FLMG 4HJ5A 1UE6A 2HT1A 1Y1WH 2AKWB 1E7ZA 1E3PA 1NJIC 3JC66 4P72A 1KC8C 4LF8L 1YIJA 3CCLA 5GADC 1LYLA 1E1OA 5IT9c 1Q82C 4JI0L 1L1OA 4NXNQ 1Z9FA 4GNXA 3J80c 4IFDI 1O7IA 1EQQA 3TS0A 2JA6G 4BY1G 4R4TA 4DR5L 3NENA 2EQSA 4DR3Q 4BBRH 4OO1G 2IHEA 1FL0A 2RHSB 1W2BA 2E5LL 5FJ8H 1VQJA 3I4MH 4B3RQ 3PGZA 1EIFA 1Q46A 4GN4B 4DV6L 2VUMH 4AQYQ 3L2PA 1WCMH 4PZ8A 4YHHQ 3CXCA 2IX0A 4MZ9A 3A74A 2ZTCA 3T1YL 4DAYB 1RL2A 4WJ3M 4DV0Q 3PUYA 1IXRA 1KRSA 2ZM6L 4A3DH 3AFQA 1J6QA 4B3TQ 1KQSA 2RHQB 3KOJA 3PO3G 4LFCL 1HZAA 1YI2A 3HKZG 1M1KC 1M90C 3OTOQ 3A5ZB 1IL2A 1QUQA 2VQFQ 2E2HH 2JA7G 3A0JA 2JA7H 4NPSA 2F4VL 5E7NA 4JI6L 2CWAA 3G48A 4B3ML 5FLXc 4JOIA 4OX9L 5LMNL 1K0RA 5JJKA 4JI1L 2MFIA 1MJCA 2HIVA 5M3MG 3KYHC 1QVGA 5GAGC 4HJAA 2F3IA 1XJVA 1LUZA 2Q2TA 4QGUA 4DV1L 4A76A 1CKOA 1DGSA 5LMNW 1UE1A 4OONA 1XPRA 2DGYA 1ASZA 3TRZA 3PV0A 1NE3A 4APVA 3RZOH 4Y52H 1HNZQ 2Z6KA 3W5OA 3AQQA 3FP9A 3UDIA 3BZKA 4UP9A 4IPGA 4A3KH 4A3KG 1IBKL 2HHHQ 2R92G 2R92H 2UXCL 4QJFA 1B70B 4LF4L 2B63G 1AE2A 1L0WA 2LSSA 3PSIA 5JJIA 2I5LX 1L1OC 1KRTA 1I94L 2VL6A 4GNXC 1N36L 2PQAA 2OTJA 1YHBA 1TWAH 3AYHB 1A8VA 3G4SA 4DUYQ 1PH7A 1XNRL 3I4OA 1HZCA 1HNWQ 3GTGH 1VQ6A 1CSQA 4OO1I 2CKZB 5C0XI 4DV3L 3TQYA 4BA1I 2RF4A 1QVCA 4YY3L 2OQKA 4DR2Q 1VQMA 3J80i 1VQNA 1JMCA 5IY0A 1X56A 2WFWA 4DPGA 4HJ7A 4IFDJ 1C0AA 4J15A 2K5NA 1JJCB 2XGTA 4AYBG 1K8AC 2R7ZH 1N33Q 1MKHA 2XTIA 4KI0A 1YZ6A 4HIKA 1NBWA 3HOZH 3PCOB 4IFDG 4DR4Q 1G6PA 3S24A 4DR6L 4LF7L 2MO1A 1GKHA 4HJ9A 3S16H 3PF5A 3HOYH 2ZTDA 3F8TA 1IBLL 3I55A 1YEZA 3EBEA 1TWGH 3HOVG 3K0XA 4JI8L 5IWAQ 4DR1Q 1HNXQ 4LUOA 4X65Q 1X3GA 4GKKL 2IHFA 5H1SE 3NBHB 3UDXA 1AE3A 2L15A 3CCSA 4DAMA 4GOPA 3CCRA 2H5XA 4KHPL 2ALYB 1K3RA 3DM3A 4BA2I 3PIPA 4A3GG 2Q2HA 4A3GH 2UUCL 1EIYB 3CCEA 5GROA 3RZDH 3M4PA 5IYCG 1JB7A 1I3QH 4HJ8A 4P75A 4DV4Q 4JI5Q 1Y14B 1PHJA 4DUZQ 3F2BA 2Z6KC 4NB3A 3DLLA 1D8LA 5M3FH 1KD1C 2UXDL 3E9HA 4GKJQ 4XTCS 4LF9L 5J3BA 3ULPA 3S2HH 4YCUA 1PYBA 4R4IA 3GTPH 1EUJA 3ERSX 3UDFA 2CQOA 1VQEA 4NXMQ 1WI5A 1HZBA 4X6AH 3KJPA 3HOXH 4JI7Q 1QZHA 4X64L 4K0KL 2OQ0A 1IZ6A 1J5EQ 4O0AA 1PH2A 2WB1E 4B3SQ 2UU9Q 1VQ5A 1Y1WG 3D31A 3NELA 2KCTA 5BR8Q 1C9OA 5IP7H 3Q8DA 1B8AA 1VQAA 4PG3A 3CCVA 1XPUA 5LMUL 1PH6A 1JT8A 2R7FA 4A3EH 2WAQG 4AIMA 2KCMA 1GO3E 1XMQQ 4KHZA 1UWVA 5C0XJ 2NVYH 2VW9A 1EFWA 2K4KA 4JI2Q 1CUKA 3ULLA 4BBRG 1Y1VG 4P74A 4DV7L 1Y1VH 1UE7A 1FJGL 4UP8A 1V1QA 1HH2P 4C3JH 3F1ZA 4DK3C 5FJ8G 1T9HA 1WYDA 5C0XG 4DV5L 3ER0A 4NXNL 2UUAQ 4JG2A 3I4MG 1XNQQ 4H02A 1LTLA 5DLQE 4JBKA 5IYBH 2VUMG 2PI2A 1VQIA 4MTNA 3T1HQ 1WOCA 4IOAA 1XMOQ 2JE6I 1WCMG 4A3BH 3W1GA 4C3IH 4GOPC 4JV5Q 4PZ6A 4OWTB 4R4QA 2HQLA 3GO5A 4HIMA 4LNQA 3GTQH 4BY7G 4LFAL 5EAYA 5HY6A 3U50C 4BY7H 4A3DG 1X6OA 4B3RL 2E5LQ 1SLJA 2NZOA 4DK6C
chains in the Genus database with same CATH superfamily
1Q12A 3GD7A 1ENFA 1HR0L 5LL6X 1IHZA 1WTVA 4KLKA 1YVCA 2LXKA 4HCSA 1VQ7A 3KF8A 1B53A 1U4RA 1BVSA 4XQQA 3OTOL 2V4DA 3B6YA 3JAML 1CKMA 5C44H 3QOJA 4ZKCB 1N8RC 2JSOA 4LW1A 4FYDA 2AQ1B 4JI3L 1TWCH 1KNAA 4JI6Q 4P73A 1V1OA 1B3AA 1EWIA 3RZDB 3J80E 5LMNQ 2F0VA 1JOOA 3IFDA 5M3FB 1NY4A 5I9PA 4JVZA 5CYUA 3S14H 3EJIA 4JI4Q 2EJFC 3LX0A 2RKSA 2F0FA 2IT1A 1TY2A 1JE5A 2TSSA 2OTLA 1ICFB 1W6JA 1SNPA 4DUYL 4PNYA 5FLXE 1L2FA 4BBSG 3M9BA 3K80C 2R7ZG 5BN3A 3NWTA 3A5UA 1GVPA 1T5XD 2HUGA 3HOWG 1H95A 3PIP3 3VYRA 4RGTA 2NVYB 5IGDA 1Y1VB 4YY3Q 2PNHA 4ZQ3A 2YTVA 5CV6A 2JA5G 3EIVA 1CKNB 2QDLA 1R9TH 1UE5A 1NTGA 3NUCA 1SRUA 3NSWA 2Q8RE 3GTQB 5ELFA 1V9PA 3G6EA 1W3SA 4KJOA 3TS2A 3HOUG 2E8GA 5FO9B 2EXDA 4X65L 1ICWA 3RR5A 1FNVA 3I56A 5IE8A 3N6RA 1KAWA 4PZ7A 3KLSX 1BR9A 1QB5D 5M3FG 1PRTC 3G71A 3TDQA 4X3TA 1Q81C 3M7GA 4JI5L 5D3IB 2MPMA 3PIOA 1SYEA 1RJTA 1Y8PB 1RKNA 4CKEA 1K9MC 1YHAA 1VQ9A 4K8IA 4A3LG 1PZKD 1P16A 1G51A 2N3SA 4KK7A 3T16A 1FGBD 4Y7NH 3FHWA 1PVOA 4AYBE 1VF5C 4K8JA 4R1JA 5KGUA 1V43A 1WTXA 2O5IC 2RCNA 3VR2A 5CR3A 1E1TA 1I4PA 2ZXPA 5C3EG 2FINB 3CW2C 3WOFA 1N34Q 2P5ZX 5CMDA 1EYDA 1WTQA 1AZPA 5EKLA 5IYBG 3CD6A 2KHIA 3PO2B 1ZYRC 1BBWA 4DR3L 4A3CH 1BO0A 1X9NA 3GTLH 2JEBI 4U673 1Q8IA 4A3JB 5KRUA 1EY7A 1FJGQ 4DV7Q 4BS9A 1XMOL 4JK1C 1YHQA 3C1EA 1IW7C 1NSNS 5I4DA 4DXGA 4YHHL 1CQFA 2B39A 4JV5L 3S1RH 5JJLA 4RCOA 4IPHA 4ODGA 3E3XA 2HIXA 1LT3D 3OMGA 3N52A 2NVXB 3EVQA 1NMGA 3AU7A 1QE6A 3FPUB 4LFCQ 3MTSA 4V0BA 5IGGA 5JPNC 1OXUA 3GDEA 3MXNA 4QF4A 1L1OB 3DMUA 3W1BA 4KN7C 3PUVA 3PO3H 1YNNC 3PUWA 5IGFA 1KL9A 3I72A 3CMAA 1PDQA 5C4XB 3TREA 2H4OA 2M00A 2N55A 2F3VA 3J7YW 4DV1Q 1A0IA 4DF7A 1YJ9A 2DJFC 1OXXK 4EQPA 4RAUC 5KIXA 4GN3B 5K36G 2V1CC 3AB9A 1QUQB 1IBKQ 2ZJRA 3RLOA 1DM0B 1GUNA 4LFBL 4LF4Q 2O2LD 3PO2G 1BQQT 3KF8B 1SNOA 2JP1A 1ENCA 3NTHA 4KY5A 4A3JG 5CV9A 4GLAC 4DA2A 3HKZE 3S2DB 1RTOA 1PH4A 2EY6A 4CJ1B 5HGTA 4WJ4A 4RMFA 1K28A 4RGMA 1QZGA 4I65A 4KKUA 2AQ3B 2WP8J 4K2LA 2BH2A 1G2TA 5EGTA 3E9IA 2Q2IA 4OXPA 3ND9A 1UNSA 1OXSC 4UAIA 4A3FG 3H15A 4OWWB 1S5DD 3M4OH 3PUXA 1HPCA 1X55A 3GTMB 4IFDH 2E2JB 2PQAB 3I8ZA 2JA6B 4BY1B 4RHSA 1SYGA 2VY3A 1D1KA 2CH4W 3OPOA 3KLWA 2UUBL 2K7VA 5C4XG 3V2TA 4LF6L 1A6XA 5JEAG 4JBWA 4RKBA 2ZJQA 3HOVH 1KXLA 1SROA 3FDTA 1SE8A 2YYZA 1Q7YC 1SR3A 3K8AA 2AHOB 4NW2A 1EEFD 2QKIC 3DEOA 4N8FA 4DK0A 4I7ZC 5IYCH 1QILA 1TWFB 3MXGA 3MAQA 1JORA 5IGBA 3H3VI 1JCKB 1VQDA 2NB0A 3ERQA 4IZ8A 3T4AC 1VQ4A 5AJ3Q 2I0QA 5M3MB 1PFSA 5C4JB 1FYCA 3MVVA 4A3MG 3P7JA 2N8NA 1PYSB 1UEAB 4CDEC 1TR5A 3M4QA 4H7BA 4C2MH 3H6MA 2WKCA 2HT1A 1Y1WH 1NJIC 4LF8L 1EZ8A 1STHA 1BCPB 5IT9c 1E1OA 2K5DA 1Z9FA 3VA7A 4GNXA 4NXNQ 1O7IA 2VXWA 3TS0A 2JA6G 4BY1G 4R4TA 4DR5L 3S1NB 2BCOA 2IHEA 1BCPF 1FL0A 1F77A 1SYFA 2RHSB 1AZQA 5L37A 3PGZA 4GN4B 2XSCA 2WB1B 1SSOA 2RQXA 2ZTCA 4DAYB 4DV0Q 3PUYA 4AYBB 2E75C 4A3DH 1IL8A 4X3KA 4F87A 2WINB 3VR6A 5JVH3 4BWGB 1X32A 1DCZA 3OTOQ 4C3HB 3A0JA 4NPSA 4JI6L 2CWAA 4B3ML 1CQVA 3KBXA 1U4MA 5LMNL 1K0RA 1RCVD 4JI1L 3V96A 2MFIA 1MJCA 5M3MG 3KYHC 5GAGC 3S1QB 2KVMA 3I70A 3OW7A 1XJVA 3M3YB 3NXWA 3K5MA 2E2IB 4QGUA 1UE1A 4OONA 5C4HA 4L63B 1NE3A 3RZOH 2Z6KA 3W5OA 2R92G 4UP9A 5A2QE 2LSSA 3PSIA 2YU9B 1KAAA 4EQOA 2OTJA 3AYHB 4DUYQ 1CK1A 1HNWQ 2F0WA 1HZCA 2G9HD 1VQ6A 3GTGH 4OO1I 1SDFA 1TU2B 5C0XI 4DV3L 1ILQA 3K5OA 2RF4A 4YY3L 1V1PB 2F0HA 2OQKA 1VQNA 2K5QA 2ZXOA 1C0AA 4J15A 1JJCB 4AYBG 3OOCA 2R7ZH 3QWNA 1MKHA 4HIKA 2KEDA 3PCOB 1DOMA 2KA7A 4LF7L 1GHKA 3VR4A 2X69A 4FF1A 3I4MB 5KEEA 4JI8L 4DR1Q 1NAPA 4X65Q 2IHFA 5H1SE 3UDXA 3CCSA 3HGBA 4GOPA 2H5XA 1K3RA 3DM3A 4BA2I 2Q2HA 5GROA 3HKZB 4HN7A 3RZDH 3MFGA 2B8FA 4QUCA 4HJ8A 4JI5Q 3CRKC 3TP5A 5D14A 1EWCA 1TQOA 2EY2A 3DLLA 1D8LA 5M3FH 4LF9L 1RF2D 1LO5D 5J3BA 1PTOB 3KJPA 2F0JA 4K6DA 2OEOA 3LWEA 3DHQA 1Z6HA 5IGCA 2K04A 3G7LA 2EYOA 2EJGC 4CGYB 2F0IA 4RH6A 3K5LA 3Q24A 1XPUA 4GZYC 2R7FA 1GO3E 2PZUA 2NVYH 2K5WA 4OGQC 1FJGL 2F0LA 2I46A 1Y1VH 4DV7L 4UP8A 5C0XG 3IKJA 5FJ8G 1T9HA 1WYDA 4WORA 1E2WA 3EA6A 3I4MG 4JBKA 5IYBH 1SBBB 4MTNA 1XMOQ 3SK6A 4JV5Q 4LNQA 3GTQH 3GO5A 5DNFA 4HIMA 5NUCA 1X6OA 1CTMA 2E5LQ 4DV6Q 2L55A 3JAMc 3MXUA 3T1YQ 4K5VA 4B3TL 1ENAA 1TIID 4F7XA 2DJGC 1G2SA 1JOKA 1HR0W 2C35B 3QB3A 1HQMC 2NZ1D 1BKBA 2A68D 1MSGA 4H44C 1PTOD 4ABNA 4A3GB 5IT9E 1BUVT 4RGOS 4TQUS 3TSSA 4DXFA 3CRLC 1LTRD 3EN2A 2E76C 2EYPA 3LWUA 5EBDA 1HQRD 1EQRA 5DM73 2VB3X 5EKIA 1S3OA 4KJNA 4LFBQ 4RHRA 2DNCA 2IX3A 3KDFB 4P71A 1PH5A 4QL5A 5K36H 2CW0C 3CC4A 3PMFA 1GOZA 4EVOA 1LTID 3PO2H 1U9RA 1EY5A 3S9WA 1N36Q 1IKMA 4A3JH 3CCQA 4A3EB 1XNRQ 1DD2A 3FMCA 5JAVA 2KUMA 2N49A 4X3SA 1CZGA 3R3OA 1HXYD 5ELEA 1U4PA 4NDXA 4C3JB 2HQEA 5I6WA 4N9TA 1FR3A 3DXJC 3EFXD 3SGIA 2NVXH 3U9OA 4J1MA 1CSPA 4DR6Q 2KECA 4QQBX 1HA6A 1STEA 3JAMi 2K75A 1HNXL 2UUBQ 4LF6Q 1TXYA 3FKIB 4HMJA 3I4NB 1KDCA 1Q3LA 4R4OA 5JPMC 4KD4A 5ELOA 3MEFA 5C4XH 4IUUA 5JEAH 3T51B 4DGZA 3F2CA 1VQCA 3BJUA 3T56B 1HA5A 1JB3A 1SJHD 1U4LA 2GVAA 3DUZA 2B2TC 5J39A 4CJ2C 5AJ3L 1K8GA 3CF5A 1K3BC 2NVQB 4FF2A 4NXML 3E5SA 1PXUA 3T13A 1Z47A 2ICIA 5AFWA 1E22A 1J5EL 2IL8A 4A3EG 1X3QA 3S2DH 2AMCB 1LTBD 3UDGA 4ME3A 1X3FA 1YNJD 3SXHA 4ZCKA 4C3JG 2FJ2A 3CCMA 2IWHA 1H9SA 4LF8Q 3QIAA 2CCZA 1FGUA 5GQOA 2MGSA 4DR5Q 4BBSB 1TVXA 2EYHA 1J9OA 1OXTA 3HOWB 2GVBA 4IJLA 1U0LA 4DV5Q 1EYCA 1Z7TA 4M1UB 3GTMH 2E2JH 1FD7D 1WTRA 3FKIG 3MEHA 3K59A 3I4NG 2QCPX 4DV0L 3H0GG 4BY1H 2JA6H 1FVIA 1VQOA 4DU9A 1EL0A 4CDFC 1VF7A 5C3XA 2JA5B 4LFAQ 3OHXC 1K83B 1I4HA 2D62A 4FXGC 5M5XB 1MGSA 2MP1A 1JE4A 4DR7Q 1WFQA 1PH1A 4HMIA 4DV2L 2DY8A 4LF5L 3HOUB 1STBA 3CC2A 2MO0A 4G7ZC 4B3MQ 1G91A 4JI1Q 2RSNA 1TWFH 2HCIA 2ZT9C 3E6ZX 4K5XA 2X6GA 4IPDA 2AQ2B 3Q6SA 2EE1A 4BXXG 3ZJYC 2EZVA 4HAEA 5M3MH 5C4JH 5M9OA 4X62L 2CWPA 3RD4A 2Z6BA 1SE2A 4TVAB 1N32Q 3A8KE 1A3UA 1F9RA 3UE1A 1I6HB 2B29A 3JAME 2F52A 4J8QA 3H3VH 1HNWL 1B50A 3R8BA 1LACA 5I2YA 2B2WC 5C3EB 1ONLA 3OWEB 4CJ0B 4DNIA 4DV3Q 2PMZE 4XT3B 3S15B 1VQ8A 3S1NH 4X3UA 1BBXC 1VQBA 1GUOA 4HSPA 5CORA 4OWXB 1CHQD 2K5HA 2R93G 3EQLC 2K03A 3KK7A 3STBC 1PRTB 4LF7Q 1LTAD 1G8ZD 3I2ZA 4DR1L 1WTOA 1TWHB 1Q90A 2L12A 2VQEQ 1PRTF 4POGA 3RN5A 5IP9G 4JI8Q 2A1AA 2EYMA 1M4VA 4C3HH 4LMQD 4X66L 1PYWD 2L1BA 3QO2A 1GM5A 3TZUA 2QEJC 1PZJD 2K5VA 1X65A 3STBD 4L5RC 4FDBA 1XWEA 4FVMA 3M85A 3S1QH 2Z4IA 2PCFB 2B3GA 3DWQA 4FF3A 3M3YH 2E2IH 3Q22A 3D6CA 1IBML 2WACA 2BH8A 2D9UA 3VYTA 2EDGA 4POFA 2R6GA 4LF9Q 4UDUC 2D0PA 1JWSD 1A3VA 1IYJB 4OHJA 1WVLA 2YU9H 1EWHA 4O42A 2AWNA 1WD1A 3KF6A 1Y69U 4L5QA 2FXQA 1SYDA 4YCWA 5FLMG 4HJ5A 2XRSD 2AKWB 3BDLA 3ND8A 1ML0D 2XNAC 3JC66 1HFNA 1KC8C 2K32A 2B63B 3CCLA 5GADC 4FNFA 1EQQA 1LABA 3BS1A 2EQSA 2E5LL 4OO1H 1UUPA 3TP8A 5C0XH 5FJ8H 3I4MH 4DV6L 4AQYQ 3L2PA 1B9NA 3T1YL 4OIJA 3I90A 1RL2A 1IXRA 5COYA 4A3FB 5E4WC 4B3TQ 4DN4M 1KQSA 1HZAA 1M1KC 1IL2A 3GV3A 2VQFQ 2E2HH 4IUVA 2NVTB 2JA7H 1H9SB 1CHPD 4JOIA 3E0JA 4NKLA 1PFMA 5M5YB 1B1ZA 1QVGA 4S3SA 1PTOH 2F0DA 2F3IA 1LUZA 4YIJA 4E6IA 5LMNW 2DGYA 2LFNA 3SE0A 1ASZA 3D6WA 3PV0A 4APVA 3IL8A 3H91A 2EPBA 4IPGA 4LJZC 2KJXA 4C1NI 4A3KH 1HTLD 1LTGD 3D8GA 1JWUD 2UXCL 2PW7A 1B70B 2B63G 1EY6A 1AE2A 3S1MB 4A3MB 1L1OC 1I94L 1N36L 2A6HD 1YHBA 1A8VA 1PH7A 3GTKB 1UAPA 1XNRL 1CSQA 1CT1D 1SJED 3H94A 4IUQA 5KNDA 3TZDA 5IY0A 4HJ7A 1NUCA 1K0SA 1L0XB 3S24A 4DR6L 4BBRB 4IUPA 3PF5A 3F8TA 1O78A 5EPJA 1YEZA 1FNWA 4CDDC 1DXMA 1HNXQ 2QILA 4ZRZA 1AE3A 2L15A 4DAMA 3CCRA 1KLUD 2R3ZA 2GA4B 4KHPL 3J7AV 1EYAA 4A3GH 3TBIB 2UUCL 3CCEA 1GUSA 2PMZB 3MXPA 4CHTB 3F2BA 3K6OA 2LKVA 1GHJA 2RA4A 3E9HA 4XTCS 5FOBB 4R4IA 3UDFA 4NXMQ 1WI5A 4X6AH 4WJWA 3NP8A 4K0KL 5C4ZA 2B2UC 2A69C 4LAAA 4O0AA 1J5EQ 3D4RA 4TSSA 4B3SQ 1Y8OB 5TSSA 1ET9A 1C9OA 3TP7A 2R92B 3CCVA 1VQAA 5LMUL 1PH6A 1JR0D 1V8QA 4RFBA 4A3EH 2KQ3A 1AFPA 1TWAB 4BBRG 2I07B 4C3JH 2A69D 4DV5L 3ER0A 1HTPA 4OELB 4JG2A 5DLQE 4HTHA 1D6EC 2PI2A 1E2VA 1WOCA 2BE5D 4PZ6A 2L11A 4BY7G 4LFAL 5HY6A 3F2UA 3HOZB 4B3RL 1SLJA 4F88A 2CVRA 2NZOA 1E0BA 4DK6C 4ZAIA 4DR7L 2L0CA 3DM1A 2FMCA 3S16B 2PPBC 3FKIH 3HOYB 3I4NH 3E0EA 5BN5A 2X6LA 1S40A 4DV2Q 4DNRB 1GJXA 4LF5Q 1EYGA 3H3VC 2SNMA 2HDLA 4QMGA 2NN6I 1IYVA 5C44G 4HIOA 3NWSA 1CA6A 1JICA 4IPCA 3A7AB 4FO2A 5ELNA 4CDCC 3A54A 1W6KA 2AWOA 2N88A 3KBGA 1LT5D 3C2PA 3WWVA 2OWOA 4OX9Q 3KJOA 1YJNA 1KTKA 2NVQH 2GN5A 3NK9A 3J7ZC 3LNNA 3Q23A 1N32L 4X62Q 1PA6A 1KDBA 1HHVA 3S2HB 1EFID 4BXXH 3A55A 2NTTA 3NTIA 1VS0A 3MXNB 4QIWE 5CGKA 3GTPB 1BCPD 1WD0A 4R8NA 2E74C 3QR8A 4JCVE 1WTPA 2B2TA 2RBMA 4A4IA 1XX8A 4JBJA 1YBYA 5CV4A 3GQBA 2Z0SA 5DEHA 4JC0A 3J81L 1S5ED 3CAMA 1H9KA 4BBSH 1OXVA 1D1IA 3HOZG 4KY6A 3HOWH 1EU3A 2K14A 3GP7A 2BDNA 3HOYG 3L0OA 2K50A 1EOTA 4GN5A 1N33L 1UEBA 2VQEL 1ASYA 4DAPA 2ES2A 2JA5H 4JOIC 4DR4L 1X54A 4C1NK 5M5XH 1K83H 1XTDA 5G3LF 4DKAC 1TKWB 3V05A 1X3EA 3K81C 1B2TA 5IOCA 3HOUH 4X66Q 2NBFA 2SEBD 4IOCA 3GTJB 2K1BA 1VMPA 5IP9H 1I6VC 3L3OC 1A2TA 2G9DA 3RN2A 1QCBD 2NN6G 1AN8A 3ZYYX 4PQXA 3R2IA 1IBMQ 1PH8A 4DV4L 3HEJA 4K2KA 2JA8B 4DUZL 1MBYA 3LGJA 5M5WB 3OYYA 3Q0AA 4A3LH 4A3IB 1E24A 1I6HH 4KD3A 3U58A 5IP7G 1H9RA 3NEMA 2BOSA 3CQZB 5EPKA 1EY9A 4IN3A 1JJGA 3CCJA 5C3EH 1HFGA 1Q8KA 3I4LA 2XVSA 5E3FA 1P8LA 3S15H 3F2DA 3ONAB 1EY4A 4KY7A 5GAEC 1QNUA 4A3CG 4JI2L 5FLMH 1QVFA 4FF4A 4L6TB 1JC7A 2B2WA 2UUAL 2A68C 1XNQL 5GAHC 4PV1C 1PTOC 2JK8A 4IURA 2NZHA 1TWHH 2CFMA 4AQYL 4B9WA 2SNSA 2XIWA 1EZ6A 2MHVA 4UP7A 4K6LA 3S17B 3RLNA 2Z1CA 2RCFA 2PO4A 2VQFL 2IJ0A 1AH9A 2JA8G 1TS3A 2F03A 2VNUD 4GNXB 2L9HA 2L5TA 3A7LA 2VZAA 2Z4HA 1DZ1A 4A3IG 4A93B 3K7AB 1IKLA 4N8X1 4CBVA 1F2ZA 3CU7A 1I50B 1QG7A 3FRPB 2F0GA 3IRBA 4MHEA 4CKBA 1DYQA 4LK1C 1VQPA 3C46A 2A5HA 1M8AA 3I7FA 5ELDA 2UXCQ 1BBUA 5F2DA 4ZUIA 1CKNA 1A15A 3K58A 1I94Q 3SVMA 1EU4A 2F0EA 1KABA 1MI2A 3NBHA 2AUKA 4LUVA 4UPAA 2K28A 4FXKC 3D0FA 2B63H 4C56C 4JYAL 3SEBA 1WTWA 2A19A 3OIPA 5C3WA 1ESFA 4RKLA 4DFAA 4GLVB 2K01A 1II3A 3BZDB 4EX5A 1D5MC 4HCEA 3CKIB 4RG1A 4O2DA 1LM0A 2QDBA 3OIQA 1Q86C 4A3FH 4YWMA 4ZKBB 4QIWB 2UXBL 2EVBA 3H0GB 4A93G 2NVTH 2QGQA 1EEID 1SFOB 2IW3A 4KHPQ 5E1FA 5IYDG 4YWKA 3NHHA 3U4VA 3K5NA 2UUCQ 4H13C 2M9VA 4AH6A 2N78A 2XWJB 3HS0C 2JEAI 2JN4A 5M5YH 1WTHA 2K6AA 4UY8C 1PFNA 4ZYSA 2K05A 4DNTB 1YNJC 4MNOA 1S72A 2R7DA 2B2VC 1SE4A 3BZCA 1QOHA 5ISRA 1K73C 1SNMA 2Z8LA 3D3RA 3L9AX 2WV6D 4GOPB 1PLFA 3AEVA 4B3SL 4K0KQ 3S1MH 4A3MH 2O5JC 2XRQD 3K7UC 2J4XA 1NMFA 1XTCD 3VDYA 3GTKH 3QOLA 3AFPA 5LMUQ 4XDXA 5LL6S 1UE6A 1STNA 1CZWA 1E7ZA 1E3PA 1VDZA 2NUCA 2H1EA 3HP3A 1YIJA 1LYLA 4JI0L 2LY7A 1L1OA 5J1ZA 5J22A 3NENA 4BBRH 5I6YA 3J80L 1D2BA 2R93B 3PQIA 1VQJA 5LHY1 4B3RQ 1DOLA 1Q46A 5E4XA 5D3DA 2WKDA 4PZ8A 2IX0A 4MZ9A 1K8OA 2Z9HA 5CC4A 1AP0A 1J6QA 5EBCA 3KOJA 1M90C 1QUQA 2M2LA 5E7NA 4XXEA 3G48A 4OX9L 3NBIA 1A3TA 2PQEA 5FLXL 1STAA 2QF7A 1OO9B 3BDOA 2F0OA 1CKOA 4XYOA 1DGSA 1F9QA 1GUWA 1MHWC 3TRZA 3VA5A 1BOSA 4Y52H 2EOTA 2AUJD 3AQQA 3FP9A 3UDIA 2HHHQ 2R92H 3BYYB 1NCVA 3VYSA 4QJFA 4U68A 3GTOB 1F2MA 5JJIA 4KMUC 5FO8B 1KRTA 2VL6A 4CKCA 2O4XA 2PQAA 1TWAH 2B2UA 5T1IA 5CBEE 5KNCA 1VQMA 1X56A 3I91A 4DPGA 4IFDJ 5CV8A 3PIO3 4I7AA 2NYZD 3GV6A 2XTIA 1N33Q 1YZ6A 3HOZH 1NBWA 3O13A 4DR4Q 1G6PA 1I4RA 1XXGA 1GKHA 1IYUA 1SE3A 4HJ9A 3S16H 3HOYH 2ZTDA 1IBLL 3EBEA 3VYUA 2VUMB 4IUTA 1X3GA 1WCMB 3NBHB 4WRDA 5IIFA 2OXPA 3WDNA 3PIPA 3DEPA 4HSVA 4OIKA 2B2YC 1PFBA 1D5ZC 2SOBA 3M4PA 1SXTA 1ZEQX 3HZXA 4P75A 4DV4Q 1O7ZA 1Y14B 4DUZQ 4KKTA 4P2CB 2B8GA 1KD1C 2NN6H 2UXDL 3S2HH 1PYBA 4O1NA 3GTPH 1EUJA 3ERSX 3HG9A 2CQOA 3SK8A 3URYA 1HZBA 2KEEA 4JI7Q 2F0KA 1FNUA 1QZHA 4X64L 2CQAA 2OQ0A 1IZ6A 1QJOA 1GUTA 1DOKA 2WB1E 3QG1A 2PW5A 2KOLA 5FK9C 1VQ5A 2NTSA 4KHVA 3Q8DA 2QW7A 1PRTD 3A8JE 5IP7H 4PG3A 3NE5B 4DAYA 1L0YB 4AIMA 3BDCA 4KHZA 5EQ0A 1UWVA 2VB2X 4MIUA 2VW9A 1EFWA 4JI2Q 3ULLA 3W2DA 1Y1VG 4P74A 3X3MA 1V1QA 1HH2P 4DK3C 3FVQA 3TMEA 2UUAQ 5KNBA 1XNQQ 1LTLA 4RWSC 2VUMG 4IOAA 2JE6I 1WCMG 5DM63 1CI3M 3H09A 2EY1A 2FHTA 3GTJH 5C6AA 4IJHA 3M7NA 1X3PA 1PH3A 5HGQA 2BA1A 4K14A 2D0OA 1TWGB 2KBNA 2ZM6Q 1ZYRD 5FKAC 3P1HA 1C4QA 1EOVA 1H9MA 1YITA 2JA8H 4G4KA 4OEMB 2A6HC 2F4VQ 5M5WH 4HIDA 1EIGA 1O7LA 1WJJA 1I5FA 3J81j 1IW7D 1D7QA 1I3QB 4IALA 2Y0SE 1MD2D 4A3IH 1YNXA 4RCNA 2A8VA 4NP5A 1V1PA 4JPBW 1A62A 3CQZH 1B7YB 1VCIA 2QEXA 2F0UA 4G7HC 3RMHA 3MWYW 1HNZL 2OT2A 2Q8TA 4ALPA 2WIIB 4R8IA 3HOXB 3U4ZA 4EQ5A 2NWGA 3IFTA 1VQLA 1I4GA 2PNRC 5K5PA 2SDFA 3D4DA 1YNND 3J81c 1RIPA 3TEHB 1RHPA 3BVMA 1PV4A 2PZWA 4ZK9B 4JYAQ 2JJQA 3KLRA 4B9XA 1E2ZA 2F0SA 1TS2A 2JA9A 4NMZA 1C7YA 4DR2L 1B3QA 3KUPA 1VQFA 2I5HA 1NR2A 1LT4D 1O7YA 2I5MX 2IX1A 4LWCA 2IY5B 2KENA 3T53B 1R4QB 1RTNA 3S17H 2EJMA 3NQTA 4EGVA 4A3BB 4C3IB 4IO9A 3VR3A 5CBAE 2UXBQ 1XYIA 2BA0A 4BY7B 5IWAL 2F1MA 3J7A5 2DNEA 2ID0A 3CCUA 2K52A 4RGNA 3KLSA 5EKKA 4JBMA 2ZXRA 3L7ZC 4GKKQ 4L5SA 2IPKD 4A93H 3HRZC 3K7AH 2BDOA 2RDFA 5IYDH 4PMCA 3ICEA 4YCVA 3BVGA 2FFKB 5C44B 1J8IA 4ULLA 4QUFA 3PUZA 1I50H 1JJ2A 4J6HA 1TWCB 2F0MA 3HOXG 1F9SA 4DAVA 3CPWA 4GKJL 2LS01 1SMYC 4ZLTF 4G7OC 3AMUA 2ZJPA 2DUDA 3NTKA 1I4XA 2BE5C 3ITPA 1HZ9A 1PMRA 2C5CA 4XQNA 3UE0A 4KV6A 1C48A 4FXDA 4F8MA 2UU9L 3J81i 5HURA 3HFZB 4ME5A 5BR8L 3S14B 1JOQA 5CV5A 3CPFA 1SMYD 4ID6A 2PI2E 3HKSA 4G57A 1XMQL 1AEXA 1RODA 3OMCA 1SMXA 2YTXA 4JI0Q 2MJ8A 1F2LA 4A3BG 1YJWA 4C3IG 3UI2A 1C8CA 1OTCA 1D5XC 3MHBA 1LTTD 4R4CA 2LMCB 1XPOA 1GD7A 2MNAA 3T1HL 1BNZA 1SEBD 4XYQA 2XN9C 3RNUA 3H0GH 5CV7A 2F0NA 3KF6B 1SFOH 1HUNA 3PF4A 4EQNA 1R9TB 1B44D 2YV5A 2MQHA 1S5CD 5A2QL 3R2TA 1HCZA 2R61A 5BN4A 2F0TA 1BCPC 2YTYA 1HR0Q 2VS1A 1VMCA 3BYTB 1PH9A 3I73A 2C9OA 5JJZA 3KDFA 3CP0A 1VQHA 1SYCA 4QB4A 1TS5A 2J0TD 2KCNA 1GXDC 1CFMA 2Q2UA 4JI3Q 2WAQE 2ICEC 4MTKA 3VR5A 1PZID 1LV9A 4PMWA 2HHHL 3C3LA 2KCCA 3MA2B 4ILWA 4KTAA 3RLFA 1GUGA 2B2VA 2RVLA 4ZUJA 5A35A 5EPLA 3J7AF 4Y7NB 2JQOA 4JI4L 1B4OA 2ATWA 2PZTA 1KDAA 1LLRD 1MIUA 3TN2A 2EIFA 3G6JB 3EROA 5FO7B 2D2CC 3BU2A 4OL7A 1RDPD 3R93A 2E2DC 1K8MA 4TKOB 1SN8A 1TS4A 3BVZA 4HEDA 1CM9A 2FMMA 3KFUA 2R93H 3WOEA 2ZTEA 1SNQA 1CA5A 2Y0SB 1G291 2WB1G 4L5TA 3GTLB 3TP6A 4TRDA 2QA4A 4XIGS 2DY7A 1Q1BA 3SK5A 2JYOA 1IBLQ 1MJEA 5T1GA 2EYFA 1Q1EA 3S1RB 1ILPA 5JEAJ 4C3HG 4R9WA 4LUZA 1KLGD 3CMEA 1HRJA 3P20A 4KKSA 3J81E 2EYJA 1N9WA 1VQGA 5DAUA 1H9JA 3U9SA 1MSHA 3CC7A 1HJPA 3PO3B 3D4WA 1EQVA 4H0LC 2CHBD 2UXDQ 2K33A 2E2HB 4GS3A 2JA7B 3OWFA 3OSOA 4A75A 4JI7L 1ET6A 2OCEA 4QY7A 1A63A 3IAYA 2A6EC 5I9OA 1KHIA 1QWYA 4X64Q 3ULJA 2HD3A 4N9PA 2ENBA 3QJYA 5JOBA 1SYBA 3GTOH 2LXJA 1R4PB 2A74C 3OW2A 1KIXA 2CH4A 1DJRD 2KHJA 1BF4A 1VQKA 1ESRA 2ASBA 1U5KA 5G3LD 4Z9CB 1JWMD 1KNEA 3DWAA 1PTOF 4YWLA 4GLXA 1N34L 2Y0SG 3MC0B 5I2XA 2A6ED 1F2YA 3MZ5A 4A3KB 4P72A 5KYIA 2G5DA 1DONA 2XWBB 1Q82C 3NQIA 1STGA 2D5DA 1S5BD 3J80c 4IFDI 2F0QA 1TY0A 5IT9L 4DR3Q 2A73B 1HUMA 4OO1G 1W2BA 1F9PA 2F0PA 1EIFA 2EYLA 2VUMH 4K5WA 1WCMH 4YHHQ 3CXCA 3A74A 4WJ3M 1KRSA 2ZM6L 1A2UA 3M4OB 3AFQA 1NNXA 2RHQB 3PO3G 4LFCL 1YI2A 2MUYA 3HKZG 3A5ZB 1TT2A 2JA7G 2F4VL 4PMBA 2TMPA 5FLXc 3HOVB 4L8JA 2PYKA 5JJKA 1BDOA 4XQJA 2HIVA 1ZXTA 3SK4A 4HJAA 2B2YA 4HR7B 2Q2TA 4DV1L 1O80A 1T5EA 4A76A 4B08A 1XPRA 2F4IA 4RA8A 3RUZA 4IUNA 1HNZQ 3BZKA 4A3KG 1IBKL 2EY5A 2OF1A 1RD9D 1SAPA 3SHLA 4DK1A 4LF4L 1L0WA 2I5LX 4GNXC 4UHVA 3G4SA 3I4OA 2RSOA 4IQZA 4QCLA 2CKZB 3M4YA 4C2MB 4JW0A 4XT1B 2Q8IB 3TQYA 4BA1I 3CHBD 1QVCA 2EXZA 1Y1WB 1STYA 4DR2Q 3J80i 1S5FD 5KYLA 1JMCA 2WFWA 3A8IE 2K5NA 2XGTA 1K8AC 3K57A 2WAQB 4KI0A 4IFDG 3FEWX 3FPPA 2MO1A 2CW0D 1I4QA 3I55A 1QNKA 1TWGH 3HOVG 3K0XA 1G6ZA 1LT6D 5IWAQ 1AW7A 3MFYA 4LUOA 4GKKL 4FP5D 1SNDA 2DN8A 2ALYB 4A3DB 2RDGA 2JXMB 4A3GG 1EIYB 4Q0FA 3P75A 2J7ZA 1JB7A 5IYCG 1I3QH 1PHJA 4KN4C 5EJWA 5ELCA 3SR1A 2Z6KC 5JVG3 4NB3A 5C5MA 1BXTA 1Y8NB 4GKJQ 3ULPA 2HDMA 1EY8A 4YCUA 1EIHA 3SDZA 1SNCA 2KHSA 1VQEA 1B9MA 3A56A 1JQYD 3I3CA 3HOXH 3W3AA 4Q5VA 3DWPA 1PH2A 1NR4A 3RZOB 2UU9Q 4V190 4M8AA 1Y1WG 3D31A 3NELA 5C5LA 1ZKOA 4WFN3 2KCTA 5BR8Q 3C1FA 1B8AA 2HCCA 1S4ZA 5ELBA 1JT8A 2WAQG 1EY0A 2KCMA 1XMQQ 5IGEA 5C0XJ 3K0YA 2K4KA 1LTSD 4MN3A 1CUKA 1UE7A 3BG3A 3GTGB 3F1ZA 4NXNL 2F3WA 4H02A 1VQIA 2RDHA 3T1HQ 1EQTA 4A3BH 3W1GA 5IODA 4C3IH 3X3NA 3NPPA 4GOPC 4R4QA 4OWTB 2HQLA 5D65A 4A3DG 5EAYA 3U50C 4BY7H 2R7ZB 2L4NA
chains in the Genus database with same CATH topology
1Q12A 3GD7A 3GTJH 4IJHA 3M7NA 4DR7L 4DV6Q 3FKIH 1HR0L 1PH3A 3E0EA 3I4NH 4KLKA 1YVCA 5HGQA 2LXKA 1VQ7A 2BA1A 3JAMc 3T1YQ 2D0OA 4B3TL 1S40A 4DV2Q 2KBNA 4LF5Q 1EYGA 2ZM6Q 1BVSA 3OTOL 3B6YA 2NN6I 5C44G 1CKMA 4HIOA 5C44H 4IPCA 1EOVA 1HR0W 2C35B 1N8RC 5ELNA 1YITA 1BKBA 4LW1A 2JA8H 4JI3L 1TWCH 2F4VQ 5M5WH 4HIDA 2AWOA 1WJJA 1I5FA 3J81j 4JI6Q 4P73A 1EWIA 4TQUS 3WWVA 2OWOA 4OX9Q 1D7QA 3KJOA 1YJNA 2Y0SE 5LMNQ 2NVQH 2GN5A 4A3IH 3EN2A 3J7ZC 1YNXA 2A8VA 1N32L 4X62Q 1NY4A 1PA6A 1A62A 1EQRA 3CQZH 1B7YB 1VCIA 2QEXA 4BXXH 4QIWE 1VS0A 3MXNB 1S3OA 1HNZL 4LFBQ 4ALPA 4JCVE 3S14H 3KDFB 4P71A 3U4ZA 1PH5A 4JI4Q 4QL5A 4A4IA 4EQ5A 4JBJA 1VQLA 3CC4A 1YBYA 2IT1A 3J81c 1RIPA 1JE5A 2Z0SA 3TEHB 1PV4A 2OTLA 4JC0A 3PO2H 4JYAQ 2JJQA 4DUYL 1N36Q 3CAMA 1L2FA 4BBSG 3M9BA 4BBSH 3K80C 4A3JH 2R7ZG 3A5UA 1GVPA 1OXVA 3CCQA 2JA9A 1XNRQ 3HOWG 3HOZG 3HOWH 1H95A 1C7YA 2K14A 4DR2L 2N49A 1VQFA 2I5HA 4YY3Q 3HOYG 3L0OA 2K50A 2I5MX 2PNHA 2IX1A 4LWCA 4GN5A 1N33L 1UEBA 2YTVA 2VQEL 2KENA 2IY5B 2JA5G 1ASYA 3EIVA 1CKNB 2ES2A 4JOIC 1UE5A 1NTGA 1X54A 1R9TH 2JA5H 1SRUA 3SGIA 5M5XH 1K83H 1XTDA 2NVXH 4DKAC 4IO9A 1CSPA 4DR6Q 1X3EA 2UXBQ 1V9PA 3G6EA 4QQBX 3K81C 1W3SA 2BA0A 3TS2A 3JAMi 3HOUG 2E8GA 3HOUH 2K75A 5IWAL 4X66Q 1HNXL 2UUBQ 2EXDA 4X65L 4IOCA 4LF6Q 3J7A5 2ID0A 3CCUA 3RR5A 2K52A 1TXYA 5IP9H 3I56A 4R4OA 4GKKQ 4JBMA 3L7ZC 4L5SA 5ELOA 5IE8A 4A93H 1KAWA 3MEFA 4PZ7A 3K7AH 5C4XH 5M3FG 3RN2A 2NN6G 3ICEA 5IYDH 3F2CA 1VQCA 3BJUA 4YCVA 3G71A 1Q81C 1IBMQ 1PH8A 3PUZA 4JI5L 4DV4L 1I50H 1JJ2A 4DUZL 3LGJA 3PIOA 3HOXG 3OYYA 2GVAA 3CPWA 5AJ3L 1K9MC 1K8GA 4GKJL 1YHAA 3CF5A 1VQ9A 4A3LG 4A3LH 1P16A 1E24A 2ZJPA 4NXML 1G51A 2N3SA 1I6HH 1Z47A 2DUDA 4Y7NH 3U58A 3FHWA 5IP7G 1PVOA 3NEMA 1E22A 4AYBE 1HZ9A 4R1JA 1V43A 1J5EL 3UE0A 2RCNA 4A3EG 1E1TA 1JJGA 3CCJA 5C3EG 2UU9L 3J81i 5C3EH 3S2DH 1Q8KA 3HFZB 2AMCB 5BR8L 3CW2C 3UDGA 1N34Q 4ME3A 1X3FA 3CPFA 1P8LA 3CCMA 3F2DA 3S15H 2PI2E 3HKSA 1XMQL 4LF8Q 5IYBG 3CD6A 2KHIA 5GAEC 1SMXA 2CCZA 2YTXA 4JI0Q 4A3CG 1BBWA 4DR3L 4JI2L 4A3BG 4A3CH 1YJWA 5FLMH 1X9NA 1QVFA 3GTLH 1OTCA 2JEBI 1FGUA 5GQOA 4DR5Q 1FJGQ 4R4CA 2UUAL 4DV7Q 1XNQL 1OXTA 5GAHC 2JK8A 1XPOA 2NZHA 1GD7A 2MNAA 2GVBA 4IJLA 1U0LA 3T1HL 4DV5Q 1TWHH 2CFMA 4AQYL 1XMOL 1YHQA 4YHHL 3GTMH 2E2JH 4JV5L 3FKIG 3S1RH 3I4NG 4DV0L 2JA6H 3H0GG 4BY1H 3RNUA 1FVIA 3H0GH 4IPHA 1VQOA 5JJLA 4UP7A 3KF6B 1SFOH 3PF4A 2HIXA 3RLNA 4LFAQ 2YV5A 2MQHA 2D62A 2VQFL 1NMGA 4LFCQ 1AH9A 4DR7Q 1WFQA 1OXUA 3GDEA 1PH1A 2JA8G 2YTYA 1HR0Q 2VS1A 4DV2L 4LF5L 1PH9A 2VNUD 1L1OB 3CC2A 4GNXB 2MO0A 3W1BA 3S17H 3KDFA 4B3MQ 3CP0A 1VQHA 2VZAA 3PO3H 3PUVA 3PUWA 4A3IG 4JI1Q 1KL9A 3CMAA 1TWFH 3TREA 2Q2UA 4JI3Q 4IPDA 4DV1Q 2WAQE 1A0IA 1YJ9A 4BXXG 3ZJYC 1OXXK 4GN3B 5M3MH 4PMWA 3IRBA 5C4JH 4X62L 2HHHL 2CWPA 5K36G 2V1CC 3RLFA 1VQPA 3I7FA 4TVAB 1N32Q 1QUQB 1IBKQ 2ZJRA 3RLOA 1BBUA 2UXCQ 4LFBL 4LF4Q 3UE1A 2B29A 3PO2G 1CKNA 2JQOA 3KF8B 4JI4L 1I94Q 2ATWA 2F52A 1HNWL 3H3VH 4LUVA 4A3JG 4GLAC 4UPAA 3D0FA 3HKZE 2B63H 1PH4A 1MIUA 4JYAL 2EIFA 4WJ4A 4RMFA 4DNIA 4DV3Q 2PMZE 3BU2A 2A19A 1QZGA 1VQ8A 3S1NH 1SN8A 1VQBA 4OWXB 2WP8J 4GLVB 2BH2A 2K5HA 2R93G 3KFUA 2R93H 2ZTEA 4EX5A 1G291 2WB1G 4L5TA 3STBC 3E9IA 4RG1A 2Q2IA 4OXPA 4O2DA 4XIGS 2QA4A 1Q1BA 4LF7Q 1LM0A 1Q86C 1OXSC 4A3FG 4OWWB 3H15A 3I2ZA 4A3FH 4YWMA 4DR1L 3PUXA 1MJEA 1IBLQ 3M4OH 2VQEQ 1X55A 4POGA 3RN5A 2PQAB 5IP9G 1Q1EA 4JI8Q 2UXBL 2A1AA 5JEAJ 4C3HH 2VY3A 2QGQA 2NVTH 4LUZA 4A93G 3KLWA 2UUBL 4X66L 5C4XG 4KHPQ 3CMEA 1GM5A 5JEAG 5IYDG 4JBWA 4LF6L 2K5VA 4YWKA 2ZJQA 1X65A 3HOVH 1KXLA 3U4VA 1N9WA 1VQGA 3STBD 2UUCQ 4L5RC 4AH6A 1SROA 4FDBA 2N78A 1SE8A 2YYZA 2JEAI 5M5YH 4UY8C 1Q7YC 3M85A 1SR3A 3CC7A 3S1QH 3K8AA 1S72A 4MNOA 2B3GA 3M3YH 2E2IH 2AHOB 1HJPA 2R7DA 1IBML 2BH8A 3BZCA 2UXDQ 4GS3A 4POFA 2R6GA 4LF9Q 5IYCH 4A75A 4JI7L 2D0PA 2OCEA 4QY7A 1K73C 1A63A 3H3VI 1VQDA 1KHIA 4GOPB 1VQ4A 4X64Q 1IYJB 3ULJA 5AJ3Q 2I0QA 4B3SL 3AEVA 4K0KQ 3GTOH 3S1MH 1PFSA 4A3MG 2LXJA 4A3MH 3OW2A 1KIXA 4DR4L 2N8NA 1PYSB 2KHJA 2YU9H 1VQKA 2ASBA 1U5KA 3K7UC 1NMFA 2AWNA 3VDYA 3GTKH 3M4QA 3KF6A 3AFPA 4YWLA 4L5QA 2FXQA 4C2MH 5LMUQ 4GLXA 1N34L 4YCWA 2Y0SG 5FLMG 4HJ5A 1UE6A 2HT1A 1Y1WH 2AKWB 1E7ZA 1E3PA 1NJIC 3JC66 4P72A 1KC8C 4LF8L 1YIJA 3CCLA 5GADC 1LYLA 1E1OA 5IT9c 1Q82C 4JI0L 1L1OA 4NXNQ 1Z9FA 4GNXA 3J80c 4IFDI 1O7IA 1EQQA 3TS0A 2JA6G 4BY1G 4R4TA 4DR5L 3NENA 2EQSA 4DR3Q 4BBRH 4OO1G 2IHEA 1FL0A 2RHSB 1W2BA 2E5LL 5FJ8H 1VQJA 3I4MH 4B3RQ 3PGZA 1EIFA 1Q46A 4GN4B 4DV6L 2VUMH 4AQYQ 3L2PA 1WCMH 4PZ8A 4YHHQ 3CXCA 2IX0A 4MZ9A 3A74A 2ZTCA 3T1YL 4DAYB 1RL2A 4WJ3M 4DV0Q 3PUYA 1IXRA 1KRSA 2ZM6L 4A3DH 3AFQA 1J6QA 4B3TQ 1KQSA 2RHQB 3KOJA 3PO3G 4LFCL 1HZAA 1YI2A 3HKZG 1M1KC 1M90C 3OTOQ 3A5ZB 1IL2A 1QUQA 2VQFQ 2E2HH 2JA7G 3A0JA 2JA7H 4NPSA 2F4VL 5E7NA 4JI6L 2CWAA 3G48A 4B3ML 5FLXc 4JOIA 4OX9L 5LMNL 1K0RA 5JJKA 4JI1L 2MFIA 1MJCA 2HIVA 5M3MG 3KYHC 1QVGA 5GAGC 4HJAA 2F3IA 1XJVA 1LUZA 2Q2TA 4QGUA 4DV1L 4A76A 1CKOA 1DGSA 5LMNW 1UE1A 4OONA 1XPRA 2DGYA 1ASZA 3TRZA 3PV0A 1NE3A 4APVA 3RZOH 4Y52H 1HNZQ 2Z6KA 3W5OA 3AQQA 3FP9A 3UDIA 3BZKA 4UP9A 4IPGA 4A3KH 4A3KG 1IBKL 2HHHQ 2R92G 2R92H 2UXCL 4QJFA 1B70B 4LF4L 2B63G 1AE2A 1L0WA 2LSSA 3PSIA 5JJIA 2I5LX 1L1OC 1KRTA 1I94L 2VL6A 4GNXC 1N36L 2PQAA 2OTJA 1YHBA 1TWAH 3AYHB 1A8VA 3G4SA 4DUYQ 1PH7A 1XNRL 3I4OA 1HZCA 1HNWQ 3GTGH 1VQ6A 1CSQA 4OO1I 2CKZB 5C0XI 4DV3L 3TQYA 4BA1I 2RF4A 1QVCA 4YY3L 2OQKA 4DR2Q 1VQMA 3J80i 1VQNA 1JMCA 5IY0A 1X56A 2WFWA 4DPGA 4HJ7A 4IFDJ 1C0AA 4J15A 2K5NA 1JJCB 2XGTA 4AYBG 1K8AC 2R7ZH 1N33Q 1MKHA 2XTIA 4KI0A 1YZ6A 4HIKA 1NBWA 3HOZH 3PCOB 4IFDG 4DR4Q 1G6PA 3S24A 4DR6L 4LF7L 2MO1A 1GKHA 4HJ9A 3S16H 3PF5A 3HOYH 2ZTDA 3F8TA 1IBLL 3I55A 1YEZA 3EBEA 1TWGH 3HOVG 3K0XA 4JI8L 5IWAQ 4DR1Q 1HNXQ 4LUOA 4X65Q 1X3GA 4GKKL 2IHFA 5H1SE 3NBHB 3UDXA 1AE3A 2L15A 3CCSA 4DAMA 4GOPA 3CCRA 2H5XA 4KHPL 2ALYB 1K3RA 3DM3A 4BA2I 3PIPA 4A3GG 2Q2HA 4A3GH 2UUCL 1EIYB 3CCEA 5GROA 3RZDH 3M4PA 5IYCG 1JB7A 1I3QH 4HJ8A 4P75A 4DV4Q 4JI5Q 1Y14B 1PHJA 4DUZQ 3F2BA 2Z6KC 4NB3A 3DLLA 1D8LA 5M3FH 1KD1C 2UXDL 3E9HA 4GKJQ 4XTCS 4LF9L 5J3BA 3ULPA 3S2HH 4YCUA 1PYBA 4R4IA 3GTPH 1EUJA 3ERSX 3UDFA 2CQOA 1VQEA 4NXMQ 1WI5A 1HZBA 4X6AH 3KJPA 3HOXH 4JI7Q 1QZHA 4X64L 4K0KL 2OQ0A 1IZ6A 1J5EQ 4O0AA 1PH2A 2WB1E 4B3SQ 2UU9Q 1VQ5A 1Y1WG 3D31A 3NELA 2KCTA 5BR8Q 1C9OA 5IP7H 3Q8DA 1B8AA 1VQAA 4PG3A 3CCVA 1XPUA 5LMUL 1PH6A 1JT8A 2R7FA 4A3EH 2WAQG 4AIMA 2KCMA 1GO3E 1XMQQ 4KHZA 1UWVA 5C0XJ 2NVYH 2VW9A 1EFWA 2K4KA 4JI2Q 1CUKA 3ULLA 4BBRG 1Y1VG 4P74A 4DV7L 1Y1VH 1UE7A 1FJGL 4UP8A 1V1QA 1HH2P 4C3JH 3F1ZA 4DK3C 5FJ8G 1T9HA 1WYDA 5C0XG 4DV5L 3ER0A 4NXNL 2UUAQ 4JG2A 3I4MG 1XNQQ 4H02A 1LTLA 5DLQE 4JBKA 5IYBH 2VUMG 2PI2A 1VQIA 4MTNA 3T1HQ 1WOCA 4IOAA 1XMOQ 2JE6I 1WCMG 4A3BH 3W1GA 4C3IH 4GOPC 4JV5Q 4PZ6A 4OWTB 4R4QA 2HQLA 3GO5A 4HIMA 4LNQA 3GTQH 4BY7G 4LFAL 5EAYA 5HY6A 3U50C 4BY7H 4A3DG 1X6OA 4B3RL 2E5LQ 1SLJA 2NZOA 4DK6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q12 A;  3GD7 A;  3GTJ H;  4IJH A;  3M7N A;  4DR7 L;  4DV6 Q;  3FKI H;  1HR0 L;  1PH3 A;  3E0E A;  3I4N H;  4KLK A;  1YVC A;  5HGQ A;  2LXK A;  1VQ7 A;  2BA1 A;  3JAM c;  3T1Y Q;  2D0O A;  4B3T L;  1S40 A;  4DV2 Q;  2KBN A;  4LF5 Q;  1EYG A;  2ZM6 Q;  1BVS A;  3OTO L;  3B6Y A;  2NN6 I;  5C44 G;  1CKM A;  4HIO A;  5C44 H;  4IPC A;  1EOV A;  1HR0 W;  2C35 B;  1N8R C;  5ELN A;  1YIT A;  1BKB A;  4LW1 A;  2JA8 H;  4JI3 L;  1TWC H;  2F4V Q;  5M5W H;  4HID A;  2AWO A;  1WJJ A;  1I5F A;  3J81 j;  4JI6 Q;  4P73 A;  1EWI A;  4TQU S;  3WWV A;  2OWO A;  4OX9 Q;  1D7Q A;  3KJO A;  1YJN A;  2Y0S E;  5LMN Q;  2NVQ H;  2GN5 A;  4A3I H;  3EN2 A;  3J7Z C;  1YNX A;  2A8V A;  1N32 L;  4X62 Q;  1NY4 A;  1PA6 A;  1A62 A;  1EQR A;  3CQZ H;  1B7Y B;  1VCI A;  2QEX A;  4BXX H;  4QIW E;  1VS0 A;  3MXN B;  1S3O A;  1HNZ L;  4LFB Q;  4ALP A;  4JCV E;  3S14 H;  3KDF B;  4P71 A;  3U4Z A;  1PH5 A;  4JI4 Q;  4QL5 A;  4A4I A;  4EQ5 A;  4JBJ A;  1VQL A;  3CC4 A;  1YBY A;  2IT1 A;  3J81 c;  1RIP A;  1JE5 A;  2Z0S A;  3TEH B;  1PV4 A;  2OTL A;  4JC0 A;  3PO2 H;  4JYA Q;  2JJQ A;  4DUY L;  1N36 Q;  3CAM A;  1L2F A;  4BBS G;  3M9B A;  4BBS H;  3K80 C;  4A3J H;  2R7Z G;  3A5U A;  1GVP A;  1OXV A;  3CCQ A;  2JA9 A;  1XNR Q;  3HOW G;  3HOZ G;  3HOW H;  1H95 A;  1C7Y A;  2K14 A;  4DR2 L;  2N49 A;  1VQF A;  2I5H A;  4YY3 Q;  3HOY G;  3L0O A;  2K50 A;  2I5M X;  2PNH A;  2IX1 A;  4LWC A;  4GN5 A;  1N33 L;  1UEB A;  2YTV A;  2VQE L;  2KEN A;  2IY5 B;  2JA5 G;  1ASY A;  3EIV A;  1CKN B;  2ES2 A;  4JOI C;  1UE5 A;  1NTG A;  1X54 A;  1R9T H;  2JA5 H;  1SRU A;  3SGI A;  5M5X H;  1K83 H;  1XTD A;  2NVX H;  4DKA C;  4IO9 A;  1CSP A;  4DR6 Q;  1X3E A;  2UXB Q;  1V9P A;  3G6E A;  4QQB X;  3K81 C;  1W3S A;  2BA0 A;  3TS2 A;  3JAM i;  3HOU G;  2E8G A;  3HOU H;  2K75 A;  5IWA L;  4X66 Q;  1HNX L;  2UUB Q;  2EXD A;  4X65 L;  4IOC A;  4LF6 Q;  3J7A 5;  2ID0 A;  3CCU A;  3RR5 A;  2K52 A;  1TXY A;  5IP9 H;  3I56 A;  4R4O A;  4GKK Q;  4JBM A;  3L7Z C;  4L5S A;  5ELO A;  5IE8 A;  4A93 H;  1KAW A;  3MEF A;  4PZ7 A;  3K7A H;  5C4X H;  5M3F G;  3RN2 A;  2NN6 G;  3ICE A;  5IYD H;  3F2C A;  1VQC A;  3BJU A;  4YCV A;  3G71 A;  1Q81 C;  1IBM Q;  1PH8 A;  3PUZ A;  4JI5 L;  4DV4 L;  1I50 H;  1JJ2 A;  4DUZ L;  3LGJ A;  3PIO A;  3HOX G;  3OYY A;  2GVA A;  3CPW A;  5AJ3 L;  1K9M C;  1K8G A;  4GKJ L;  1YHA A;  3CF5 A;  1VQ9 A;  4A3L G;  4A3L H;  1P16 A;  1E24 A;  2ZJP A;  4NXM L;  1G51 A;  2N3S A;  1I6H H;  1Z47 A;  2DUD A;  4Y7N H;  3U58 A;  3FHW A;  5IP7 G;  1PVO A;  3NEM A;  1E22 A;  4AYB E;  1HZ9 A;  4R1J A;  1V43 A;  1J5E L;  3UE0 A;  2RCN A;  4A3E G;  1E1T A;  1JJG A;  3CCJ A;  5C3E G;  2UU9 L;  3J81 i;  5C3E H;  3S2D H;  1Q8K A;  3HFZ B;  2AMC B;  5BR8 L;  3CW2 C;  3UDG A;  1N34 Q;  4ME3 A;  1X3F A;  3CPF A;  1P8L A;  3CCM A;  3F2D A;  3S15 H;  2PI2 E;  3HKS A;  1XMQ L;  4LF8 Q;  5IYB G;  3CD6 A;  2KHI A;  5GAE C;  1SMX A;  2CCZ A;  2YTX A;  4JI0 Q;  4A3C G;  1BBW A;  4DR3 L;  4JI2 L;  4A3B G;  4A3C H;  1YJW A;  5FLM H;  1X9N A;  1QVF A;  3GTL H;  1OTC A;  2JEB I;  1FGU A;  5GQO A;  4DR5 Q;  1FJG Q;  4R4C A;  2UUA L;  4DV7 Q;  1XNQ L;  1OXT A;  5GAH C;  2JK8 A;  1XPO A;  2NZH A;  1GD7 A;  2MNA A;  2GVB A;  4IJL A;  1U0L A;  3T1H L;  4DV5 Q;  1TWH H;  2CFM A;  4AQY L;  1XMO L;  1YHQ A;  4YHH L;  3GTM H;  2E2J H;  4JV5 L;  3FKI G;  3S1R H;  3I4N G;  4DV0 L;  2JA6 H;  3H0G G;  4BY1 H;  3RNU A;  1FVI A;  3H0G H;  4IPH A;  1VQO A;  5JJL A;  4UP7 A;  3KF6 B;  1SFO H;  3PF4 A;  2HIX A;  3RLN A;  4LFA Q;  2YV5 A;  2MQH A;  2D62 A;  2VQF L;  1NMG A;  4LFC Q;  1AH9 A;  4DR7 Q;  1WFQ A;  1OXU A;  3GDE A;  1PH1 A;  2JA8 G;  2YTY A;  1HR0 Q;  2VS1 A;  4DV2 L;  4LF5 L;  1PH9 A;  2VNU D;  1L1O B;  3CC2 A;  4GNX B;  2MO0 A;  3W1B A;  3S17 H;  3KDF A;  4B3M Q;  3CP0 A;  1VQH A;  2VZA A;  3PO3 H;  3PUV A;  3PUW A;  4A3I G;  4JI1 Q;  1KL9 A;  3CMA A;  1TWF H;  3TRE A;  2Q2U A;  4JI3 Q;  4IPD A;  4DV1 Q;  2WAQ E;  1A0I A;  1YJ9 A;  4BXX G;  3ZJY C;  1OXX K;  4GN3 B;  5M3M H;  4PMW A;  3IRB A;  5C4J H;  4X62 L;  2HHH L;  2CWP A;  5K36 G;  2V1C C;  3RLF A;  1VQP A;  3I7F A;  4TVA B;  1N32 Q;  1QUQ B;  1IBK Q;  2ZJR A;  3RLO A;  1BBU A;  2UXC Q;  4LFB L;  4LF4 Q;  3UE1 A;  2B29 A;  3PO2 G;  1CKN A;  2JQO A;  3KF8 B;  4JI4 L;  1I94 Q;  2ATW A;  2F52 A;  1HNW L;  3H3V H;  4LUV A;  4A3J G;  4GLA C;  4UPA A;  3D0F A;  3HKZ E;  2B63 H;  1PH4 A;  1MIU A;  4JYA L;  2EIF A;  4WJ4 A;  4RMF A;  4DNI A;  4DV3 Q;  2PMZ E;  3BU2 A;  2A19 A;  1QZG A;  1VQ8 A;  3S1N H;  1SN8 A;  1VQB A;  4OWX B;  2WP8 J;  4GLV B;  2BH2 A;  2K5H A;  2R93 G;  3KFU A;  2R93 H;  2ZTE A;  4EX5 A;  1G29 1;  2WB1 G;  4L5T A;  3STB C;  3E9I A;  4RG1 A;  2Q2I A;  4OXP A;  4O2D A;  4XIG S;  2QA4 A;  1Q1B A;  4LF7 Q;  1LM0 A;  1Q86 C;  1OXS C;  4A3F G;  4OWW B;  3H15 A;  3I2Z A;  4A3F H;  4YWM A;  4DR1 L;  3PUX A;  1MJE A;  1IBL Q;  3M4O H;  2VQE Q;  1X55 A;  4POG A;  3RN5 A;  2PQA B;  5IP9 G;  1Q1E A;  4JI8 Q;  2UXB L;  2A1A A;  5JEA J;  4C3H H;  2VY3 A;  2QGQ A;  2NVT H;  4LUZ A;  4A93 G;  3KLW A;  2UUB L;  4X66 L;  5C4X G;  4KHP Q;  3CME A;  1GM5 A;  5JEA G;  5IYD G;  4JBW A;  4LF6 L;  2K5V A;  4YWK A;  2ZJQ A;  1X65 A;  3HOV H;  1KXL A;  3U4V A;  1N9W A;  1VQG A;  3STB D;  2UUC Q;  4L5R C;  4AH6 A;  1SRO A;  4FDB A;  2N78 A;  1SE8 A;  2YYZ A;  2JEA I;  5M5Y H;  4UY8 C;  1Q7Y C;  3M85 A;  1SR3 A;  3CC7 A;  3S1Q H;  3K8A A;  1S72 A;  4MNO A;  2B3G A;  3M3Y H;  2E2I H;  2AHO B;  1HJP A;  2R7D A;  1IBM L;  2BH8 A;  3BZC A;  2UXD Q;  4GS3 A;  4POF A;  2R6G A;  4LF9 Q;  5IYC H;  4A75 A;  4JI7 L;  2D0P A;  2OCE A;  4QY7 A;  1K73 C;  1A63 A;  3H3V I;  1VQD A;  1KHI A;  4GOP B;  1VQ4 A;  4X64 Q;  1IYJ B;  3ULJ A;  5AJ3 Q;  2I0Q A;  4B3S L;  3AEV A;  4K0K Q;  3GTO H;  3S1M H;  1PFS A;  4A3M G;  2LXJ A;  4A3M H;  3OW2 A;  1KIX A;  4DR4 L;  2N8N A;  1PYS B;  2KHJ A;  2YU9 H;  1VQK A;  2ASB A;  1U5K A;  3K7U C;  1NMF A;  2AWN A;  3VDY A;  3GTK H;  3M4Q A;  3KF6 A;  3AFP A;  4YWL A;  4L5Q A;  2FXQ A;  4C2M H;  5LMU Q;  4GLX A;  1N34 L;  4YCW A;  2Y0S G;  5FLM G;  4HJ5 A;  1UE6 A;  2HT1 A;  1Y1W H;  2AKW B;  1E7Z A;  1E3P A;  1NJI C;  3JC6 6;  4P72 A;  1KC8 C;  4LF8 L;  1YIJ A;  3CCL A;  5GAD C;  1LYL A;  1E1O A;  5IT9 c;  1Q82 C;  4JI0 L;  1L1O A;  4NXN Q;  1Z9F A;  4GNX A;  3J80 c;  4IFD I;  1O7I A;  1EQQ A;  3TS0 A;  2JA6 G;  4BY1 G;  4R4T A;  4DR5 L;  3NEN A;  2EQS A;  4DR3 Q;  4BBR H;  4OO1 G;  2IHE A;  1FL0 A;  2RHS B;  1W2B A;  2E5L L;  5FJ8 H;  1VQJ A;  3I4M H;  4B3R Q;  3PGZ A;  1EIF A;  1Q46 A;  4GN4 B;  4DV6 L;  2VUM H;  4AQY Q;  3L2P A;  1WCM H;  4PZ8 A;  4YHH Q;  3CXC A;  2IX0 A;  4MZ9 A;  3A74 A;  2ZTC A;  3T1Y L;  4DAY B;  1RL2 A;  4WJ3 M;  4DV0 Q;  3PUY A;  1IXR A;  1KRS A;  2ZM6 L;  4A3D H;  3AFQ A;  1J6Q A;  4B3T Q;  1KQS A;  2RHQ B;  3KOJ A;  3PO3 G;  4LFC L;  1HZA A;  1YI2 A;  3HKZ G;  1M1K C;  1M90 C;  3OTO Q;  3A5Z B;  1IL2 A;  1QUQ A;  2VQF Q;  2E2H H;  2JA7 G;  3A0J A;  2JA7 H;  4NPS A;  2F4V L;  5E7N A;  4JI6 L;  2CWA A;  3G48 A;  4B3M L;  5FLX c;  4JOI A;  4OX9 L;  5LMN L;  1K0R A;  5JJK A;  4JI1 L;  2MFI A;  1MJC A;  2HIV A;  5M3M G;  3KYH C;  1QVG A;  5GAG C;  4HJA A;  2F3I A;  1XJV A;  1LUZ A;  2Q2T A;  4QGU A;  4DV1 L;  4A76 A;  1CKO A;  1DGS A;  5LMN W;  1UE1 A;  4OON A;  1XPR A;  2DGY A;  1ASZ A;  3TRZ A;  3PV0 A;  1NE3 A;  4APV A;  3RZO H;  4Y52 H;  1HNZ Q;  2Z6K A;  3W5O A;  3AQQ A;  3FP9 A;  3UDI A;  3BZK A;  4UP9 A;  4IPG A;  4A3K H;  4A3K G;  1IBK L;  2HHH Q;  2R92 G;  2R92 H;  2UXC L;  4QJF A;  1B70 B;  4LF4 L;  2B63 G;  1AE2 A;  1L0W A;  2LSS A;  3PSI A;  5JJI A;  2I5L X;  1L1O C;  1KRT A;  1I94 L;  2VL6 A;  4GNX C;  1N36 L;  2PQA A;  2OTJ A;  1YHB A;  1TWA H;  3AYH B;  1A8V A;  3G4S A;  4DUY Q;  1PH7 A;  1XNR L;  3I4O A;  1HZC A;  1HNW Q;  3GTG H;  1VQ6 A;  1CSQ A;  4OO1 I;  2CKZ B;  5C0X I;  4DV3 L;  3TQY A;  4BA1 I;  2RF4 A;  1QVC A;  4YY3 L;  2OQK A;  4DR2 Q;  1VQM A;  3J80 i;  1VQN A;  1JMC A;  5IY0 A;  1X56 A;  2WFW A;  4DPG A;  4HJ7 A;  4IFD J;  1C0A A;  4J15 A;  2K5N A;  1JJC B;  2XGT A;  4AYB G;  1K8A C;  2R7Z H;  1N33 Q;  1MKH A;  2XTI A;  4KI0 A;  1YZ6 A;  4HIK A;  1NBW A;  3HOZ H;  3PCO B;  4IFD G;  4DR4 Q;  1G6P A;  3S24 A;  4DR6 L;  4LF7 L;  2MO1 A;  1GKH A;  4HJ9 A;  3S16 H;  3PF5 A;  3HOY H;  2ZTD A;  3F8T A;  1IBL L;  3I55 A;  1YEZ A;  3EBE A;  1TWG H;  3HOV G;  3K0X A;  4JI8 L;  5IWA Q;  4DR1 Q;  1HNX Q;  4LUO A;  4X65 Q;  1X3G A;  4GKK L;  2IHF A;  5H1S E;  3NBH B;  3UDX A;  1AE3 A;  2L15 A;  3CCS A;  4DAM A;  4GOP A;  3CCR A;  2H5X A;  4KHP L;  2ALY B;  1K3R A;  3DM3 A;  4BA2 I;  3PIP A;  4A3G G;  2Q2H A;  4A3G H;  2UUC L;  1EIY B;  3CCE A;  5GRO A;  3RZD H;  3M4P A;  5IYC G;  1JB7 A;  1I3Q H;  4HJ8 A;  4P75 A;  4DV4 Q;  4JI5 Q;  1Y14 B;  1PHJ A;  4DUZ Q;  3F2B A;  2Z6K C;  4NB3 A;  3DLL A;  1D8L A;  5M3F H;  1KD1 C;  2UXD L;  3E9H A;  4GKJ Q;  4XTC S;  4LF9 L;  5J3B A;  3ULP A;  3S2H H;  4YCU A;  1PYB A;  4R4I A;  3GTP H;  1EUJ A;  3ERS X;  3UDF A;  2CQO A;  1VQE A;  4NXM Q;  1WI5 A;  1HZB A;  4X6A H;  3KJP A;  3HOX H;  4JI7 Q;  1QZH A;  4X64 L;  4K0K L;  2OQ0 A;  1IZ6 A;  1J5E Q;  4O0A A;  1PH2 A;  2WB1 E;  4B3S Q;  2UU9 Q;  1VQ5 A;  1Y1W G;  3D31 A;  3NEL A;  2KCT A;  5BR8 Q;  1C9O A;  5IP7 H;  3Q8D A;  1B8A A;  1VQA A;  4PG3 A;  3CCV A;  1XPU A;  5LMU L;  1PH6 A;  1JT8 A;  2R7F A;  4A3E H;  2WAQ G;  4AIM A;  2KCM A;  1GO3 E;  1XMQ Q;  4KHZ A;  1UWV A;  5C0X J;  2NVY H;  2VW9 A;  1EFW A;  2K4K A;  4JI2 Q;  1CUK A;  3ULL A;  4BBR G;  1Y1V G;  4P74 A;  4DV7 L;  1Y1V H;  1UE7 A;  1FJG L;  4UP8 A;  1V1Q A;  1HH2 P;  4C3J H;  3F1Z A;  4DK3 C;  5FJ8 G;  1T9H A;  1WYD A;  5C0X G;  4DV5 L;  3ER0 A;  4NXN L;  2UUA Q;  4JG2 A;  3I4M G;  1XNQ Q;  4H02 A;  1LTL A;  5DLQ E;  4JBK A;  5IYB H;  2VUM G;  2PI2 A;  1VQI A;  4MTN A;  3T1H Q;  1WOC A;  4IOA A;  1XMO Q;  2JE6 I;  1WCM G;  4A3B H;  3W1G A;  4C3I H;  4GOP C;  4JV5 Q;  4PZ6 A;  4OWT B;  4R4Q A;  2HQL A;  3GO5 A;  4HIM A;  4LNQ A;  3GTQ H;  4BY7 G;  4LFA L;  5EAY A;  5HY6 A;  3U50 C;  4BY7 H;  4A3D G;  1X6O A;  4B3R L;  2E5L Q;  1SLJ A;  2NZO A;  4DK6 C; 
#chains in the Genus database with same CATH topology
 1Q12 A;  3GD7 A;  1ENF A;  1HR0 L;  5LL6 X;  1IHZ A;  1WTV A;  4KLK A;  1YVC A;  2LXK A;  4HCS A;  1VQ7 A;  3KF8 A;  1B53 A;  1U4R A;  1BVS A;  4XQQ A;  3OTO L;  2V4D A;  3B6Y A;  3JAM L;  1CKM A;  5C44 H;  3QOJ A;  4ZKC B;  1N8R C;  2JSO A;  4LW1 A;  4FYD A;  2AQ1 B;  4JI3 L;  1TWC H;  1KNA A;  4JI6 Q;  4P73 A;  1V1O A;  1B3A A;  1EWI A;  3RZD B;  3J80 E;  5LMN Q;  2F0V A;  1JOO A;  3IFD A;  5M3F B;  1NY4 A;  5I9P A;  4JVZ A;  5CYU A;  3S14 H;  3EJI A;  4JI4 Q;  2EJF C;  3LX0 A;  2RKS A;  2F0F A;  2IT1 A;  1TY2 A;  1JE5 A;  2TSS A;  2OTL A;  1ICF B;  1W6J A;  1SNP A;  4DUY L;  4PNY A;  5FLX E;  1L2F A;  4BBS G;  3M9B A;  3K80 C;  2R7Z G;  5BN3 A;  3NWT A;  3A5U A;  1GVP A;  1T5X D;  2HUG A;  3HOW G;  1H95 A;  3PIP 3;  3VYR A;  4RGT A;  2NVY B;  5IGD A;  1Y1V B;  4YY3 Q;  2PNH A;  4ZQ3 A;  2YTV A;  5CV6 A;  2JA5 G;  3EIV A;  1CKN B;  2QDL A;  1R9T H;  1UE5 A;  1NTG A;  3NUC A;  1SRU A;  3NSW A;  2Q8R E;  3GTQ B;  5ELF A;  1V9P A;  3G6E A;  1W3S A;  4KJO A;  3TS2 A;  3HOU G;  2E8G A;  5FO9 B;  2EXD A;  4X65 L;  1ICW A;  3RR5 A;  1FNV A;  3I56 A;  5IE8 A;  3N6R A;  1KAW A;  4PZ7 A;  3KLS X;  1BR9 A;  1QB5 D;  5M3F G;  1PRT C;  3G71 A;  3TDQ A;  4X3T A;  1Q81 C;  3M7G A;  4JI5 L;  5D3I B;  2MPM A;  3PIO A;  1SYE A;  1RJT A;  1Y8P B;  1RKN A;  4CKE A;  1K9M C;  1YHA A;  1VQ9 A;  4K8I A;  4A3L G;  1PZK D;  1P16 A;  1G51 A;  2N3S A;  4KK7 A;  3T16 A;  1FGB D;  4Y7N H;  3FHW A;  1PVO A;  4AYB E;  1VF5 C;  4K8J A;  4R1J A;  5KGU A;  1V43 A;  1WTX A;  2O5I C;  2RCN A;  3VR2 A;  5CR3 A;  1E1T A;  1I4P A;  2ZXP A;  5C3E G;  2FIN B;  3CW2 C;  3WOF A;  1N34 Q;  2P5Z X;  5CMD A;  1EYD A;  1WTQ A;  1AZP A;  5EKL A;  5IYB G;  3CD6 A;  2KHI A;  3PO2 B;  1ZYR C;  1BBW A;  4DR3 L;  4A3C H;  1BO0 A;  1X9N A;  3GTL H;  2JEB I;  4U67 3;  1Q8I A;  4A3J B;  5KRU A;  1EY7 A;  1FJG Q;  4DV7 Q;  4BS9 A;  1XMO L;  4JK1 C;  1YHQ A;  3C1E A;  1IW7 C;  1NSN S;  5I4D A;  4DXG A;  4YHH L;  1CQF A;  2B39 A;  4JV5 L;  3S1R H;  5JJL A;  4RCO A;  4IPH A;  4ODG A;  3E3X A;  2HIX A;  1LT3 D;  3OMG A;  3N52 A;  2NVX B;  3EVQ A;  1NMG A;  3AU7 A;  1QE6 A;  3FPU B;  4LFC Q;  3MTS A;  4V0B A;  5IGG A;  5JPN C;  1OXU A;  3GDE A;  3MXN A;  4QF4 A;  1L1O B;  3DMU A;  3W1B A;  4KN7 C;  3PUV A;  3PO3 H;  1YNN C;  3PUW A;  5IGF A;  1KL9 A;  3I72 A;  3CMA A;  1PDQ A;  5C4X B;  3TRE A;  2H4O A;  2M00 A;  2N55 A;  2F3V A;  3J7Y W;  4DV1 Q;  1A0I A;  4DF7 A;  1YJ9 A;  2DJF C;  1OXX K;  4EQP A;  4RAU C;  5KIX A;  4GN3 B;  5K36 G;  2V1C C;  3AB9 A;  1QUQ B;  1IBK Q;  2ZJR A;  3RLO A;  1DM0 B;  1GUN A;  4LFB L;  4LF4 Q;  2O2L D;  3PO2 G;  1BQQ T;  3KF8 B;  1SNO A;  2JP1 A;  1ENC A;  3NTH A;  4KY5 A;  4A3J G;  5CV9 A;  4GLA C;  4DA2 A;  3HKZ E;  3S2D B;  1RTO A;  1PH4 A;  2EY6 A;  4CJ1 B;  5HGT A;  4WJ4 A;  4RMF A;  1K28 A;  4RGM A;  1QZG A;  4I65 A;  4KKU A;  2AQ3 B;  2WP8 J;  4K2L A;  2BH2 A;  1G2T A;  5EGT A;  3E9I A;  2Q2I A;  4OXP A;  3ND9 A;  1UNS A;  1OXS C;  4UAI A;  4A3F G;  3H15 A;  4OWW B;  1S5D D;  3M4O H;  3PUX A;  1HPC A;  1X55 A;  3GTM B;  4IFD H;  2E2J B;  2PQA B;  3I8Z A;  2JA6 B;  4BY1 B;  4RHS A;  1SYG A;  2VY3 A;  1D1K A;  2CH4 W;  3OPO A;  3KLW A;  2UUB L;  2K7V A;  5C4X G;  3V2T A;  4LF6 L;  1A6X A;  5JEA G;  4JBW A;  4RKB A;  2ZJQ A;  3HOV H;  1KXL A;  1SRO A;  3FDT A;  1SE8 A;  2YYZ A;  1Q7Y C;  1SR3 A;  3K8A A;  2AHO B;  4NW2 A;  1EEF D;  2QKI C;  3DEO A;  4N8F A;  4DK0 A;  4I7Z C;  5IYC H;  1QIL A;  1TWF B;  3MXG A;  3MAQ A;  1JOR A;  5IGB A;  3H3V I;  1JCK B;  1VQD A;  2NB0 A;  3ERQ A;  4IZ8 A;  3T4A C;  1VQ4 A;  5AJ3 Q;  2I0Q A;  5M3M B;  1PFS A;  5C4J B;  1FYC A;  3MVV A;  4A3M G;  3P7J A;  2N8N A;  1PYS B;  1UEA B;  4CDE C;  1TR5 A;  3M4Q A;  4H7B A;  4C2M H;  3H6M A;  2WKC A;  2HT1 A;  1Y1W H;  1NJI C;  4LF8 L;  1EZ8 A;  1STH A;  1BCP B;  5IT9 c;  1E1O A;  2K5D A;  1Z9F A;  3VA7 A;  4GNX A;  4NXN Q;  1O7I A;  2VXW A;  3TS0 A;  2JA6 G;  4BY1 G;  4R4T A;  4DR5 L;  3S1N B;  2BCO A;  2IHE A;  1BCP F;  1FL0 A;  1F77 A;  1SYF A;  2RHS B;  1AZQ A;  5L37 A;  3PGZ A;  4GN4 B;  2XSC A;  2WB1 B;  1SSO A;  2RQX A;  2ZTC A;  4DAY B;  4DV0 Q;  3PUY A;  4AYB B;  2E75 C;  4A3D H;  1IL8 A;  4X3K A;  4F87 A;  2WIN B;  3VR6 A;  5JVH 3;  4BWG B;  1X32 A;  1DCZ A;  3OTO Q;  4C3H B;  3A0J A;  4NPS A;  4JI6 L;  2CWA A;  4B3M L;  1CQV A;  3KBX A;  1U4M A;  5LMN L;  1K0R A;  1RCV D;  4JI1 L;  3V96 A;  2MFI A;  1MJC A;  5M3M G;  3KYH C;  5GAG C;  3S1Q B;  2KVM A;  3I70 A;  3OW7 A;  1XJV A;  3M3Y B;  3NXW A;  3K5M A;  2E2I B;  4QGU A;  1UE1 A;  4OON A;  5C4H A;  4L63 B;  1NE3 A;  3RZO H;  2Z6K A;  3W5O A;  2R92 G;  4UP9 A;  5A2Q E;  2LSS A;  3PSI A;  2YU9 B;  1KAA A;  4EQO A;  2OTJ A;  3AYH B;  4DUY Q;  1CK1 A;  1HNW Q;  2F0W A;  1HZC A;  2G9H D;  1VQ6 A;  3GTG H;  4OO1 I;  1SDF A;  1TU2 B;  5C0X I;  4DV3 L;  1ILQ A;  3K5O A;  2RF4 A;  4YY3 L;  1V1P B;  2F0H A;  2OQK A;  1VQN A;  2K5Q A;  2ZXO A;  1C0A A;  4J15 A;  1JJC B;  4AYB G;  3OOC A;  2R7Z H;  3QWN A;  1MKH A;  4HIK A;  2KED A;  3PCO B;  1DOM A;  2KA7 A;  4LF7 L;  1GHK A;  3VR4 A;  2X69 A;  4FF1 A;  3I4M B;  5KEE A;  4JI8 L;  4DR1 Q;  1NAP A;  4X65 Q;  2IHF A;  5H1S E;  3UDX A;  3CCS A;  3HGB A;  4GOP A;  2H5X A;  1K3R A;  3DM3 A;  4BA2 I;  2Q2H A;  5GRO A;  3HKZ B;  4HN7 A;  3RZD H;  3MFG A;  2B8F A;  4QUC A;  4HJ8 A;  4JI5 Q;  3CRK C;  3TP5 A;  5D14 A;  1EWC A;  1TQO A;  2EY2 A;  3DLL A;  1D8L A;  5M3F H;  4LF9 L;  1RF2 D;  1LO5 D;  5J3B A;  1PTO B;  3KJP A;  2F0J A;  4K6D A;  2OEO A;  3LWE A;  3DHQ A;  1Z6H A;  5IGC A;  2K04 A;  3G7L A;  2EYO A;  2EJG C;  4CGY B;  2F0I A;  4RH6 A;  3K5L A;  3Q24 A;  1XPU A;  4GZY C;  2R7F A;  1GO3 E;  2PZU A;  2NVY H;  2K5W A;  4OGQ C;  1FJG L;  2F0L A;  2I46 A;  1Y1V H;  4DV7 L;  4UP8 A;  5C0X G;  3IKJ A;  5FJ8 G;  1T9H A;  1WYD A;  4WOR A;  1E2W A;  3EA6 A;  3I4M G;  4JBK A;  5IYB H;  1SBB B;  4MTN A;  1XMO Q;  3SK6 A;  4JV5 Q;  4LNQ A;  3GTQ H;  3GO5 A;  5DNF A;  4HIM A;  5NUC A;  1X6O A;  1CTM A;  2E5L Q;  4DV6 Q;  2L55 A;  3JAM c;  3MXU A;  3T1Y Q;  4K5V A;  4B3T L;  1ENA A;  1TII D;  4F7X A;  2DJG C;  1G2S A;  1JOK A;  1HR0 W;  2C35 B;  3QB3 A;  1HQM C;  2NZ1 D;  1BKB A;  2A68 D;  1MSG A;  4H44 C;  1PTO D;  4ABN A;  4A3G B;  5IT9 E;  1BUV T;  4RGO S;  4TQU S;  3TSS A;  4DXF A;  3CRL C;  1LTR D;  3EN2 A;  2E76 C;  2EYP A;  3LWU A;  5EBD A;  1HQR D;  1EQR A;  5DM7 3;  2VB3 X;  5EKI A;  1S3O A;  4KJN A;  4LFB Q;  4RHR A;  2DNC A;  2IX3 A;  3KDF B;  4P71 A;  1PH5 A;  4QL5 A;  5K36 H;  2CW0 C;  3CC4 A;  3PMF A;  1GOZ A;  4EVO A;  1LTI D;  3PO2 H;  1U9R A;  1EY5 A;  3S9W A;  1N36 Q;  1IKM A;  4A3J H;  3CCQ A;  4A3E B;  1XNR Q;  1DD2 A;  3FMC A;  5JAV A;  2KUM A;  2N49 A;  4X3S A;  1CZG A;  3R3O A;  1HXY D;  5ELE A;  1U4P A;  4NDX A;  4C3J B;  2HQE A;  5I6W A;  4N9T A;  1FR3 A;  3DXJ C;  3EFX D;  3SGI A;  2NVX H;  3U9O A;  4J1M A;  1CSP A;  4DR6 Q;  2KEC A;  4QQB X;  1HA6 A;  1STE A;  3JAM i;  2K75 A;  1HNX L;  2UUB Q;  4LF6 Q;  1TXY A;  3FKI B;  4HMJ A;  3I4N B;  1KDC A;  1Q3L A;  4R4O A;  5JPM C;  4KD4 A;  5ELO A;  3MEF A;  5C4X H;  4IUU A;  5JEA H;  3T51 B;  4DGZ A;  3F2C A;  1VQC A;  3BJU A;  3T56 B;  1HA5 A;  1JB3 A;  1SJH D;  1U4L A;  2GVA A;  3DUZ A;  2B2T C;  5J39 A;  4CJ2 C;  5AJ3 L;  1K8G A;  3CF5 A;  1K3B C;  2NVQ B;  4FF2 A;  4NXM L;  3E5S A;  1PXU A;  3T13 A;  1Z47 A;  2ICI A;  5AFW A;  1E22 A;  1J5E L;  2IL8 A;  4A3E G;  1X3Q A;  3S2D H;  2AMC B;  1LTB D;  3UDG A;  4ME3 A;  1X3F A;  1YNJ D;  3SXH A;  4ZCK A;  4C3J G;  2FJ2 A;  3CCM A;  2IWH A;  1H9S A;  4LF8 Q;  3QIA A;  2CCZ A;  1FGU A;  5GQO A;  2MGS A;  4DR5 Q;  4BBS B;  1TVX A;  2EYH A;  1J9O A;  1OXT A;  3HOW B;  2GVB A;  4IJL A;  1U0L A;  4DV5 Q;  1EYC A;  1Z7T A;  4M1U B;  3GTM H;  2E2J H;  1FD7 D;  1WTR A;  3FKI G;  3MEH A;  3K59 A;  3I4N G;  2QCP X;  4DV0 L;  3H0G G;  4BY1 H;  2JA6 H;  1FVI A;  1VQO A;  4DU9 A;  1EL0 A;  4CDF C;  1VF7 A;  5C3X A;  2JA5 B;  4LFA Q;  3OHX C;  1K83 B;  1I4H A;  2D62 A;  4FXG C;  5M5X B;  1MGS A;  2MP1 A;  1JE4 A;  4DR7 Q;  1WFQ A;  1PH1 A;  4HMI A;  4DV2 L;  2DY8 A;  4LF5 L;  3HOU B;  1STB A;  3CC2 A;  2MO0 A;  4G7Z C;  4B3M Q;  1G91 A;  4JI1 Q;  2RSN A;  1TWF H;  2HCI A;  2ZT9 C;  3E6Z X;  4K5X A;  2X6G A;  4IPD A;  2AQ2 B;  3Q6S A;  2EE1 A;  4BXX G;  3ZJY C;  2EZV A;  4HAE A;  5M3M H;  5C4J H;  5M9O A;  4X62 L;  2CWP A;  3RD4 A;  2Z6B A;  1SE2 A;  4TVA B;  1N32 Q;  3A8K E;  1A3U A;  1F9R A;  3UE1 A;  1I6H B;  2B29 A;  3JAM E;  2F52 A;  4J8Q A;  3H3V H;  1HNW L;  1B50 A;  3R8B A;  1LAC A;  5I2Y A;  2B2W C;  5C3E B;  1ONL A;  3OWE B;  4CJ0 B;  4DNI A;  4DV3 Q;  2PMZ E;  4XT3 B;  3S15 B;  1VQ8 A;  3S1N H;  4X3U A;  1BBX C;  1VQB A;  1GUO A;  4HSP A;  5COR A;  4OWX B;  1CHQ D;  2K5H A;  2R93 G;  3EQL C;  2K03 A;  3KK7 A;  3STB C;  1PRT B;  4LF7 Q;  1LTA D;  1G8Z D;  3I2Z A;  4DR1 L;  1WTO A;  1TWH B;  1Q90 A;  2L12 A;  2VQE Q;  1PRT F;  4POG A;  3RN5 A;  5IP9 G;  4JI8 Q;  2A1A A;  2EYM A;  1M4V A;  4C3H H;  4LMQ D;  4X66 L;  1PYW D;  2L1B A;  3QO2 A;  1GM5 A;  3TZU A;  2QEJ C;  1PZJ D;  2K5V A;  1X65 A;  3STB D;  4L5R C;  4FDB A;  1XWE A;  4FVM A;  3M85 A;  3S1Q H;  2Z4I A;  2PCF B;  2B3G A;  3DWQ A;  4FF3 A;  3M3Y H;  2E2I H;  3Q22 A;  3D6C A;  1IBM L;  2WAC A;  2BH8 A;  2D9U A;  3VYT A;  2EDG A;  4POF A;  2R6G A;  4LF9 Q;  4UDU C;  2D0P A;  1JWS D;  1A3V A;  1IYJ B;  4OHJ A;  1WVL A;  2YU9 H;  1EWH A;  4O42 A;  2AWN A;  1WD1 A;  3KF6 A;  1Y69 U;  4L5Q A;  2FXQ A;  1SYD A;  4YCW A;  5FLM G;  4HJ5 A;  2XRS D;  2AKW B;  3BDL A;  3ND8 A;  1ML0 D;  2XNA C;  3JC6 6;  1HFN A;  1KC8 C;  2K32 A;  2B63 B;  3CCL A;  5GAD C;  4FNF A;  1EQQ A;  1LAB A;  3BS1 A;  2EQS A;  2E5L L;  4OO1 H;  1UUP A;  3TP8 A;  5C0X H;  5FJ8 H;  3I4M H;  4DV6 L;  4AQY Q;  3L2P A;  1B9N A;  3T1Y L;  4OIJ A;  3I90 A;  1RL2 A;  1IXR A;  5COY A;  4A3F B;  5E4W C;  4B3T Q;  4DN4 M;  1KQS A;  1HZA A;  1M1K C;  1IL2 A;  3GV3 A;  2VQF Q;  2E2H H;  4IUV A;  2NVT B;  2JA7 H;  1H9S B;  1CHP D;  4JOI A;  3E0J A;  4NKL A;  1PFM A;  5M5Y B;  1B1Z A;  1QVG A;  4S3S A;  1PTO H;  2F0D A;  2F3I A;  1LUZ A;  4YIJ A;  4E6I A;  5LMN W;  2DGY A;  2LFN A;  3SE0 A;  1ASZ A;  3D6W A;  3PV0 A;  4APV A;  3IL8 A;  3H91 A;  2EPB A;  4IPG A;  4LJZ C;  2KJX A;  4C1N I;  4A3K H;  1HTL D;  1LTG D;  3D8G A;  1JWU D;  2UXC L;  2PW7 A;  1B70 B;  2B63 G;  1EY6 A;  1AE2 A;  3S1M B;  4A3M B;  1L1O C;  1I94 L;  1N36 L;  2A6H D;  1YHB A;  1A8V A;  1PH7 A;  3GTK B;  1UAP A;  1XNR L;  1CSQ A;  1CT1 D;  1SJE D;  3H94 A;  4IUQ A;  5KND A;  3TZD A;  5IY0 A;  4HJ7 A;  1NUC A;  1K0S A;  1L0X B;  3S24 A;  4DR6 L;  4BBR B;  4IUP A;  3PF5 A;  3F8T A;  1O78 A;  5EPJ A;  1YEZ A;  1FNW A;  4CDD C;  1DXM A;  1HNX Q;  2QIL A;  4ZRZ A;  1AE3 A;  2L15 A;  4DAM A;  3CCR A;  1KLU D;  2R3Z A;  2GA4 B;  4KHP L;  3J7A V;  1EYA A;  4A3G H;  3TBI B;  2UUC L;  3CCE A;  1GUS A;  2PMZ B;  3MXP A;  4CHT B;  3F2B A;  3K6O A;  2LKV A;  1GHJ A;  2RA4 A;  3E9H A;  4XTC S;  5FOB B;  4R4I A;  3UDF A;  4NXM Q;  1WI5 A;  4X6A H;  4WJW A;  3NP8 A;  4K0K L;  5C4Z A;  2B2U C;  2A69 C;  4LAA A;  4O0A A;  1J5E Q;  3D4R A;  4TSS A;  4B3S Q;  1Y8O B;  5TSS A;  1ET9 A;  1C9O A;  3TP7 A;  2R92 B;  3CCV A;  1VQA A;  5LMU L;  1PH6 A;  1JR0 D;  1V8Q A;  4RFB A;  4A3E H;  2KQ3 A;  1AFP A;  1TWA B;  4BBR G;  2I07 B;  4C3J H;  2A69 D;  4DV5 L;  3ER0 A;  1HTP A;  4OEL B;  4JG2 A;  5DLQ E;  4HTH A;  1D6E C;  2PI2 A;  1E2V A;  1WOC A;  2BE5 D;  4PZ6 A;  2L11 A;  4BY7 G;  4LFA L;  5HY6 A;  3F2U A;  3HOZ B;  4B3R L;  1SLJ A;  4F88 A;  2CVR A;  2NZO A;  1E0B A;  4DK6 C;  4ZAI A;  4DR7 L;  2L0C A;  3DM1 A;  2FMC A;  3S16 B;  2PPB C;  3FKI H;  3HOY B;  3I4N H;  3E0E A;  5BN5 A;  2X6L A;  1S40 A;  4DV2 Q;  4DNR B;  1GJX A;  4LF5 Q;  1EYG A;  3H3V C;  2SNM A;  2HDL A;  4QMG A;  2NN6 I;  1IYV A;  5C44 G;  4HIO A;  3NWS A;  1CA6 A;  1JIC A;  4IPC A;  3A7A B;  4FO2 A;  5ELN A;  4CDC C;  3A54 A;  1W6K A;  2AWO A;  2N88 A;  3KBG A;  1LT5 D;  3C2P A;  3WWV A;  2OWO A;  4OX9 Q;  3KJO A;  1YJN A;  1KTK A;  2NVQ H;  2GN5 A;  3NK9 A;  3J7Z C;  3LNN A;  3Q23 A;  1N32 L;  4X62 Q;  1PA6 A;  1KDB A;  1HHV A;  3S2H B;  1EFI D;  4BXX H;  3A55 A;  2NTT A;  3NTI A;  1VS0 A;  3MXN B;  4QIW E;  5CGK A;  3GTP B;  1BCP D;  1WD0 A;  4R8N A;  2E74 C;  3QR8 A;  4JCV E;  1WTP A;  2B2T A;  2RBM A;  4A4I A;  1XX8 A;  4JBJ A;  1YBY A;  5CV4 A;  3GQB A;  2Z0S A;  5DEH A;  4JC0 A;  3J81 L;  1S5E D;  3CAM A;  1H9K A;  4BBS H;  1OXV A;  1D1I A;  3HOZ G;  4KY6 A;  3HOW H;  1EU3 A;  2K14 A;  3GP7 A;  2BDN A;  3HOY G;  3L0O A;  2K50 A;  1EOT A;  4GN5 A;  1N33 L;  1UEB A;  2VQE L;  1ASY A;  4DAP A;  2ES2 A;  2JA5 H;  4JOI C;  4DR4 L;  1X54 A;  4C1N K;  5M5X H;  1K83 H;  1XTD A;  5G3L F;  4DKA C;  1TKW B;  3V05 A;  1X3E A;  3K81 C;  1B2T A;  5IOC A;  3HOU H;  4X66 Q;  2NBF A;  2SEB D;  4IOC A;  3GTJ B;  2K1B A;  1VMP A;  5IP9 H;  1I6V C;  3L3O C;  1A2T A;  2G9D A;  3RN2 A;  1QCB D;  2NN6 G;  1AN8 A;  3ZYY X;  4PQX A;  3R2I A;  1IBM Q;  1PH8 A;  4DV4 L;  3HEJ A;  4K2K A;  2JA8 B;  4DUZ L;  1MBY A;  3LGJ A;  5M5W B;  3OYY A;  3Q0A A;  4A3L H;  4A3I B;  1E24 A;  1I6H H;  4KD3 A;  3U58 A;  5IP7 G;  1H9R A;  3NEM A;  2BOS A;  3CQZ B;  5EPK A;  1EY9 A;  4IN3 A;  1JJG A;  3CCJ A;  5C3E H;  1HFG A;  1Q8K A;  3I4L A;  2XVS A;  5E3F A;  1P8L A;  3S15 H;  3F2D A;  3ONA B;  1EY4 A;  4KY7 A;  5GAE C;  1QNU A;  4A3C G;  4JI2 L;  5FLM H;  1QVF A;  4FF4 A;  4L6T B;  1JC7 A;  2B2W A;  2UUA L;  2A68 C;  1XNQ L;  5GAH C;  4PV1 C;  1PTO C;  2JK8 A;  4IUR A;  2NZH A;  1TWH H;  2CFM A;  4AQY L;  4B9W A;  2SNS A;  2XIW A;  1EZ6 A;  2MHV A;  4UP7 A;  4K6L A;  3S17 B;  3RLN A;  2Z1C A;  2RCF A;  2PO4 A;  2VQF L;  2IJ0 A;  1AH9 A;  2JA8 G;  1TS3 A;  2F03 A;  2VNU D;  4GNX B;  2L9H A;  2L5T A;  3A7L A;  2VZA A;  2Z4H A;  1DZ1 A;  4A3I G;  4A93 B;  3K7A B;  1IKL A;  4N8X 1;  4CBV A;  1F2Z A;  3CU7 A;  1I50 B;  1QG7 A;  3FRP B;  2F0G A;  3IRB A;  4MHE A;  4CKB A;  1DYQ A;  4LK1 C;  1VQP A;  3C46 A;  2A5H A;  1M8A A;  3I7F A;  5ELD A;  2UXC Q;  1BBU A;  5F2D A;  4ZUI A;  1CKN A;  1A15 A;  3K58 A;  1I94 Q;  3SVM A;  1EU4 A;  2F0E A;  1KAB A;  1MI2 A;  3NBH A;  2AUK A;  4LUV A;  4UPA A;  2K28 A;  4FXK C;  3D0F A;  2B63 H;  4C56 C;  4JYA L;  3SEB A;  1WTW A;  2A19 A;  3OIP A;  5C3W A;  1ESF A;  4RKL A;  4DFA A;  4GLV B;  2K01 A;  1II3 A;  3BZD B;  4EX5 A;  1D5M C;  4HCE A;  3CKI B;  4RG1 A;  4O2D A;  1LM0 A;  2QDB A;  3OIQ A;  1Q86 C;  4A3F H;  4YWM A;  4ZKB B;  4QIW B;  2UXB L;  2EVB A;  3H0G B;  4A93 G;  2NVT H;  2QGQ A;  1EEI D;  1SFO B;  2IW3 A;  4KHP Q;  5E1F A;  5IYD G;  4YWK A;  3NHH A;  3U4V A;  3K5N A;  2UUC Q;  4H13 C;  2M9V A;  4AH6 A;  2N78 A;  2XWJ B;  3HS0 C;  2JEA I;  2JN4 A;  5M5Y H;  1WTH A;  2K6A A;  4UY8 C;  1PFN A;  4ZYS A;  2K05 A;  4DNT B;  1YNJ C;  4MNO A;  1S72 A;  2R7D A;  2B2V C;  1SE4 A;  3BZC A;  1QOH A;  5ISR A;  1K73 C;  1SNM A;  2Z8L A;  3D3R A;  3L9A X;  2WV6 D;  4GOP B;  1PLF A;  3AEV A;  4B3S L;  4K0K Q;  3S1M H;  4A3M H;  2O5J C;  2XRQ D;  3K7U C;  2J4X A;  1NMF A;  1XTC D;  3VDY A;  3GTK H;  3QOL A;  3AFP A;  5LMU Q;  4XDX A;  5LL6 S;  1UE6 A;  1STN A;  1CZW A;  1E7Z A;  1E3P A;  1VDZ A;  2NUC A;  2H1E A;  3HP3 A;  1YIJ A;  1LYL A;  4JI0 L;  2LY7 A;  1L1O A;  5J1Z A;  5J22 A;  3NEN A;  4BBR H;  5I6Y A;  3J80 L;  1D2B A;  2R93 B;  3PQI A;  1VQJ A;  5LHY 1;  4B3R Q;  1DOL A;  1Q46 A;  5E4X A;  5D3D A;  2WKD A;  4PZ8 A;  2IX0 A;  4MZ9 A;  1K8O A;  2Z9H A;  5CC4 A;  1AP0 A;  1J6Q A;  5EBC A;  3KOJ A;  1M90 C;  1QUQ A;  2M2L A;  5E7N A;  4XXE A;  3G48 A;  4OX9 L;  3NBI A;  1A3T A;  2PQE A;  5FLX L;  1STA A;  2QF7 A;  1OO9 B;  3BDO A;  2F0O A;  1CKO A;  4XYO A;  1DGS A;  1F9Q A;  1GUW A;  1MHW C;  3TRZ A;  3VA5 A;  1BOS A;  4Y52 H;  2EOT A;  2AUJ D;  3AQQ A;  3FP9 A;  3UDI A;  2HHH Q;  2R92 H;  3BYY B;  1NCV A;  3VYS A;  4QJF A;  4U68 A;  3GTO B;  1F2M A;  5JJI A;  4KMU C;  5FO8 B;  1KRT A;  2VL6 A;  4CKC A;  2O4X A;  2PQA A;  1TWA H;  2B2U A;  5T1I A;  5CBE E;  5KNC A;  1VQM A;  1X56 A;  3I91 A;  4DPG A;  4IFD J;  5CV8 A;  3PIO 3;  4I7A A;  2NYZ D;  3GV6 A;  2XTI A;  1N33 Q;  1YZ6 A;  3HOZ H;  1NBW A;  3O13 A;  4DR4 Q;  1G6P A;  1I4R A;  1XXG A;  1GKH A;  1IYU A;  1SE3 A;  4HJ9 A;  3S16 H;  3HOY H;  2ZTD A;  1IBL L;  3EBE A;  3VYU A;  2VUM B;  4IUT A;  1X3G A;  1WCM B;  3NBH B;  4WRD A;  5IIF A;  2OXP A;  3WDN A;  3PIP A;  3DEP A;  4HSV A;  4OIK A;  2B2Y C;  1PFB A;  1D5Z C;  2SOB A;  3M4P A;  1SXT A;  1ZEQ X;  3HZX A;  4P75 A;  4DV4 Q;  1O7Z A;  1Y14 B;  4DUZ Q;  4KKT A;  4P2C B;  2B8G A;  1KD1 C;  2NN6 H;  2UXD L;  3S2H H;  1PYB A;  4O1N A;  3GTP H;  1EUJ A;  3ERS X;  3HG9 A;  2CQO A;  3SK8 A;  3URY A;  1HZB A;  2KEE A;  4JI7 Q;  2F0K A;  1FNU A;  1QZH A;  4X64 L;  2CQA A;  2OQ0 A;  1IZ6 A;  1QJO A;  1GUT A;  1DOK A;  2WB1 E;  3QG1 A;  2PW5 A;  2KOL A;  5FK9 C;  1VQ5 A;  2NTS A;  4KHV A;  3Q8D A;  2QW7 A;  1PRT D;  3A8J E;  5IP7 H;  4PG3 A;  3NE5 B;  4DAY A;  1L0Y B;  4AIM A;  3BDC A;  4KHZ A;  5EQ0 A;  1UWV A;  2VB2 X;  4MIU A;  2VW9 A;  1EFW A;  4JI2 Q;  3ULL A;  3W2D A;  1Y1V G;  4P74 A;  3X3M A;  1V1Q A;  1HH2 P;  4DK3 C;  3FVQ A;  3TME A;  2UUA Q;  5KNB A;  1XNQ Q;  1LTL A;  4RWS C;  2VUM G;  4IOA A;  2JE6 I;  1WCM G;  5DM6 3;  1CI3 M;  3H09 A;  2EY1 A;  2FHT A;  3GTJ H;  5C6A A;  4IJH A;  3M7N A;  1X3P A;  1PH3 A;  5HGQ A;  2BA1 A;  4K14 A;  2D0O A;  1TWG B;  2KBN A;  2ZM6 Q;  1ZYR D;  5FKA C;  3P1H A;  1C4Q A;  1EOV A;  1H9M A;  1YIT A;  2JA8 H;  4G4K A;  4OEM B;  2A6H C;  2F4V Q;  5M5W H;  4HID A;  1EIG A;  1O7L A;  1WJJ A;  1I5F A;  3J81 j;  1IW7 D;  1D7Q A;  1I3Q B;  4IAL A;  2Y0S E;  1MD2 D;  4A3I H;  1YNX A;  4RCN A;  2A8V A;  4NP5 A;  1V1P A;  4JPB W;  1A62 A;  3CQZ H;  1B7Y B;  1VCI A;  2QEX A;  2F0U A;  4G7H C;  3RMH A;  3MWY W;  1HNZ L;  2OT2 A;  2Q8T A;  4ALP A;  2WII B;  4R8I A;  3HOX B;  3U4Z A;  4EQ5 A;  2NWG A;  3IFT A;  1VQL A;  1I4G A;  2PNR C;  5K5P A;  2SDF A;  3D4D A;  1YNN D;  3J81 c;  1RIP A;  3TEH B;  1RHP A;  3BVM A;  1PV4 A;  2PZW A;  4ZK9 B;  4JYA Q;  2JJQ A;  3KLR A;  4B9X A;  1E2Z A;  2F0S A;  1TS2 A;  2JA9 A;  4NMZ A;  1C7Y A;  4DR2 L;  1B3Q A;  3KUP A;  1VQF A;  2I5H A;  1NR2 A;  1LT4 D;  1O7Y A;  2I5M X;  2IX1 A;  4LWC A;  2IY5 B;  2KEN A;  3T53 B;  1R4Q B;  1RTN A;  3S17 H;  2EJM A;  3NQT A;  4EGV A;  4A3B B;  4C3I B;  4IO9 A;  3VR3 A;  5CBA E;  2UXB Q;  1XYI A;  2BA0 A;  4BY7 B;  5IWA L;  2F1M A;  3J7A 5;  2DNE A;  2ID0 A;  3CCU A;  2K52 A;  4RGN A;  3KLS A;  5EKK A;  4JBM A;  2ZXR A;  3L7Z C;  4GKK Q;  4L5S A;  2IPK D;  4A93 H;  3HRZ C;  3K7A H;  2BDO A;  2RDF A;  5IYD H;  4PMC A;  3ICE A;  4YCV A;  3BVG A;  2FFK B;  5C44 B;  1J8I A;  4ULL A;  4QUF A;  3PUZ A;  1I50 H;  1JJ2 A;  4J6H A;  1TWC B;  2F0M A;  3HOX G;  1F9S A;  4DAV A;  3CPW A;  4GKJ L;  2LS0 1;  1SMY C;  4ZLT F;  4G7O C;  3AMU A;  2ZJP A;  2DUD A;  3NTK A;  1I4X A;  2BE5 C;  3ITP A;  1HZ9 A;  1PMR A;  2C5C A;  4XQN A;  3UE0 A;  4KV6 A;  1C48 A;  4FXD A;  4F8M A;  2UU9 L;  3J81 i;  5HUR A;  3HFZ B;  4ME5 A;  5BR8 L;  3S14 B;  1JOQ A;  5CV5 A;  3CPF A;  1SMY D;  4ID6 A;  2PI2 E;  3HKS A;  4G57 A;  1XMQ L;  1AEX A;  1ROD A;  3OMC A;  1SMX A;  2YTX A;  4JI0 Q;  2MJ8 A;  1F2L A;  4A3B G;  1YJW A;  4C3I G;  3UI2 A;  1C8C A;  1OTC A;  1D5X C;  3MHB A;  1LTT D;  4R4C A;  2LMC B;  1XPO A;  1GD7 A;  2MNA A;  3T1H L;  1BNZ A;  1SEB D;  4XYQ A;  2XN9 C;  3RNU A;  3H0G H;  5CV7 A;  2F0N A;  3KF6 B;  1SFO H;  1HUN A;  3PF4 A;  4EQN A;  1R9T B;  1B44 D;  2YV5 A;  2MQH A;  1S5C D;  5A2Q L;  3R2T A;  1HCZ A;  2R61 A;  5BN4 A;  2F0T A;  1BCP C;  2YTY A;  1HR0 Q;  2VS1 A;  1VMC A;  3BYT B;  1PH9 A;  3I73 A;  2C9O A;  5JJZ A;  3KDF A;  3CP0 A;  1VQH A;  1SYC A;  4QB4 A;  1TS5 A;  2J0T D;  2KCN A;  1GXD C;  1CFM A;  2Q2U A;  4JI3 Q;  2WAQ E;  2ICE C;  4MTK A;  3VR5 A;  1PZI D;  1LV9 A;  4PMW A;  2HHH L;  3C3L A;  2KCC A;  3MA2 B;  4ILW A;  4KTA A;  3RLF A;  1GUG A;  2B2V A;  2RVL A;  4ZUJ A;  5A35 A;  5EPL A;  3J7A F;  4Y7N B;  2JQO A;  4JI4 L;  1B4O A;  2ATW A;  2PZT A;  1KDA A;  1LLR D;  1MIU A;  3TN2 A;  2EIF A;  3G6J B;  3ERO A;  5FO7 B;  2D2C C;  3BU2 A;  4OL7 A;  1RDP D;  3R93 A;  2E2D C;  1K8M A;  4TKO B;  1SN8 A;  1TS4 A;  3BVZ A;  4HED A;  1CM9 A;  2FMM A;  3KFU A;  2R93 H;  3WOE A;  2ZTE A;  1SNQ A;  1CA5 A;  2Y0S B;  1G29 1;  2WB1 G;  4L5T A;  3GTL B;  3TP6 A;  4TRD A;  2QA4 A;  4XIG S;  2DY7 A;  1Q1B A;  3SK5 A;  2JYO A;  1IBL Q;  1MJE A;  5T1G A;  2EYF A;  1Q1E A;  3S1R B;  1ILP A;  5JEA J;  4C3H G;  4R9W A;  4LUZ A;  1KLG D;  3CME A;  1HRJ A;  3P20 A;  4KKS A;  3J81 E;  2EYJ A;  1N9W A;  1VQG A;  5DAU A;  1H9J A;  3U9S A;  1MSH A;  3CC7 A;  1HJP A;  3PO3 B;  3D4W A;  1EQV A;  4H0L C;  2CHB D;  2UXD Q;  2K33 A;  2E2H B;  4GS3 A;  2JA7 B;  3OWF A;  3OSO A;  4A75 A;  4JI7 L;  1ET6 A;  2OCE A;  4QY7 A;  1A63 A;  3IAY A;  2A6E C;  5I9O A;  1KHI A;  1QWY A;  4X64 Q;  3ULJ A;  2HD3 A;  4N9P A;  2ENB A;  3QJY A;  5JOB A;  1SYB A;  3GTO H;  2LXJ A;  1R4P B;  2A74 C;  3OW2 A;  1KIX A;  2CH4 A;  1DJR D;  2KHJ A;  1BF4 A;  1VQK A;  1ESR A;  2ASB A;  1U5K A;  5G3L D;  4Z9C B;  1JWM D;  1KNE A;  3DWA A;  1PTO F;  4YWL A;  4GLX A;  1N34 L;  2Y0S G;  3MC0 B;  5I2X A;  2A6E D;  1F2Y A;  3MZ5 A;  4A3K B;  4P72 A;  5KYI A;  2G5D A;  1DON A;  2XWB B;  1Q82 C;  3NQI A;  1STG A;  2D5D A;  1S5B D;  3J80 c;  4IFD I;  2F0Q A;  1TY0 A;  5IT9 L;  4DR3 Q;  2A73 B;  1HUM A;  4OO1 G;  1W2B A;  1F9P A;  2F0P A;  1EIF A;  2EYL A;  2VUM H;  4K5W A;  1WCM H;  4YHH Q;  3CXC A;  3A74 A;  4WJ3 M;  1KRS A;  2ZM6 L;  1A2U A;  3M4O B;  3AFQ A;  1NNX A;  2RHQ B;  3PO3 G;  4LFC L;  1YI2 A;  2MUY A;  3HKZ G;  3A5Z B;  1TT2 A;  2JA7 G;  2F4V L;  4PMB A;  2TMP A;  5FLX c;  3HOV B;  4L8J A;  2PYK A;  5JJK A;  1BDO A;  4XQJ A;  2HIV A;  1ZXT A;  3SK4 A;  4HJA A;  2B2Y A;  4HR7 B;  2Q2T A;  4DV1 L;  1O80 A;  1T5E A;  4A76 A;  4B08 A;  1XPR A;  2F4I A;  4RA8 A;  3RUZ A;  4IUN A;  1HNZ Q;  3BZK A;  4A3K G;  1IBK L;  2EY5 A;  2OF1 A;  1RD9 D;  1SAP A;  3SHL A;  4DK1 A;  4LF4 L;  1L0W A;  2I5L X;  4GNX C;  4UHV A;  3G4S A;  3I4O A;  2RSO A;  4IQZ A;  4QCL A;  2CKZ B;  3M4Y A;  4C2M B;  4JW0 A;  4XT1 B;  2Q8I B;  3TQY A;  4BA1 I;  3CHB D;  1QVC A;  2EXZ A;  1Y1W B;  1STY A;  4DR2 Q;  3J80 i;  1S5F D;  5KYL A;  1JMC A;  2WFW A;  3A8I E;  2K5N A;  2XGT A;  1K8A C;  3K57 A;  2WAQ B;  4KI0 A;  4IFD G;  3FEW X;  3FPP A;  2MO1 A;  2CW0 D;  1I4Q A;  3I55 A;  1QNK A;  1TWG H;  3HOV G;  3K0X A;  1G6Z A;  1LT6 D;  5IWA Q;  1AW7 A;  3MFY A;  4LUO A;  4GKK L;  4FP5 D;  1SND A;  2DN8 A;  2ALY B;  4A3D B;  2RDG A;  2JXM B;  4A3G G;  1EIY B;  4Q0F A;  3P75 A;  2J7Z A;  1JB7 A;  5IYC G;  1I3Q H;  1PHJ A;  4KN4 C;  5EJW A;  5ELC A;  3SR1 A;  2Z6K C;  5JVG 3;  4NB3 A;  5C5M A;  1BXT A;  1Y8N B;  4GKJ Q;  3ULP A;  2HDM A;  1EY8 A;  4YCU A;  1EIH A;  3SDZ A;  1SNC A;  2KHS A;  1VQE A;  1B9M A;  3A56 A;  1JQY D;  3I3C A;  3HOX H;  3W3A A;  4Q5V A;  3DWP A;  1PH2 A;  1NR4 A;  3RZO B;  2UU9 Q;  4V19 0;  4M8A A;  1Y1W G;  3D31 A;  3NEL A;  5C5L A;  1ZKO A;  4WFN 3;  2KCT A;  5BR8 Q;  3C1F A;  1B8A A;  2HCC A;  1S4Z A;  5ELB A;  1JT8 A;  2WAQ G;  1EY0 A;  2KCM A;  1XMQ Q;  5IGE A;  5C0X J;  3K0Y A;  2K4K A;  1LTS D;  4MN3 A;  1CUK A;  1UE7 A;  3BG3 A;  3GTG B;  3F1Z A;  4NXN L;  2F3W A;  4H02 A;  1VQI A;  2RDH A;  3T1H Q;  1EQT A;  4A3B H;  3W1G A;  5IOD A;  4C3I H;  3X3N A;  3NPP A;  4GOP C;  4R4Q A;  4OWT B;  2HQL A;  5D65 A;  4A3D G;  5EAY A;  3U50 C;  4BY7 H;  2R7Z B;  2L4N A; 
#chains in the Genus database with same CATH homology
 1Q12 A;  3GD7 A;  3GTJ H;  4IJH A;  3M7N A;  4DR7 L;  4DV6 Q;  3FKI H;  1HR0 L;  1PH3 A;  3E0E A;  3I4N H;  4KLK A;  1YVC A;  5HGQ A;  2LXK A;  1VQ7 A;  2BA1 A;  3JAM c;  3T1Y Q;  2D0O A;  4B3T L;  1S40 A;  4DV2 Q;  2KBN A;  4LF5 Q;  1EYG A;  2ZM6 Q;  1BVS A;  3OTO L;  3B6Y A;  2NN6 I;  5C44 G;  1CKM A;  4HIO A;  5C44 H;  4IPC A;  1EOV A;  1HR0 W;  2C35 B;  1N8R C;  5ELN A;  1YIT A;  1BKB A;  4LW1 A;  2JA8 H;  4JI3 L;  1TWC H;  2F4V Q;  5M5W H;  4HID A;  2AWO A;  1WJJ A;  1I5F A;  3J81 j;  4JI6 Q;  4P73 A;  1EWI A;  4TQU S;  3WWV A;  2OWO A;  4OX9 Q;  1D7Q A;  3KJO A;  1YJN A;  2Y0S E;  5LMN Q;  2NVQ H;  2GN5 A;  4A3I H;  3EN2 A;  3J7Z C;  1YNX A;  2A8V A;  1N32 L;  4X62 Q;  1NY4 A;  1PA6 A;  1A62 A;  1EQR A;  3CQZ H;  1B7Y B;  1VCI A;  2QEX A;  4BXX H;  4QIW E;  1VS0 A;  3MXN B;  1S3O A;  1HNZ L;  4LFB Q;  4ALP A;  4JCV E;  3S14 H;  3KDF B;  4P71 A;  3U4Z A;  1PH5 A;  4JI4 Q;  4QL5 A;  4A4I A;  4EQ5 A;  4JBJ A;  1VQL A;  3CC4 A;  1YBY A;  2IT1 A;  3J81 c;  1RIP A;  1JE5 A;  2Z0S A;  3TEH B;  1PV4 A;  2OTL A;  4JC0 A;  3PO2 H;  4JYA Q;  2JJQ A;  4DUY L;  1N36 Q;  3CAM A;  1L2F A;  4BBS G;  3M9B A;  4BBS H;  3K80 C;  4A3J H;  2R7Z G;  3A5U A;  1GVP A;  1OXV A;  3CCQ A;  2JA9 A;  1XNR Q;  3HOW G;  3HOZ G;  3HOW H;  1H95 A;  1C7Y A;  2K14 A;  4DR2 L;  2N49 A;  1VQF A;  2I5H A;  4YY3 Q;  3HOY G;  3L0O A;  2K50 A;  2I5M X;  2PNH A;  2IX1 A;  4LWC A;  4GN5 A;  1N33 L;  1UEB A;  2YTV A;  2VQE L;  2KEN A;  2IY5 B;  2JA5 G;  1ASY A;  3EIV A;  1CKN B;  2ES2 A;  4JOI C;  1UE5 A;  1NTG A;  1X54 A;  1R9T H;  2JA5 H;  1SRU A;  3SGI A;  5M5X H;  1K83 H;  1XTD A;  2NVX H;  4DKA C;  4IO9 A;  1CSP A;  4DR6 Q;  1X3E A;  2UXB Q;  1V9P A;  3G6E A;  4QQB X;  3K81 C;  1W3S A;  2BA0 A;  3TS2 A;  3JAM i;  3HOU G;  2E8G A;  3HOU H;  2K75 A;  5IWA L;  4X66 Q;  1HNX L;  2UUB Q;  2EXD A;  4X65 L;  4IOC A;  4LF6 Q;  3J7A 5;  2ID0 A;  3CCU A;  3RR5 A;  2K52 A;  1TXY A;  5IP9 H;  3I56 A;  4R4O A;  4GKK Q;  4JBM A;  3L7Z C;  4L5S A;  5ELO A;  5IE8 A;  4A93 H;  1KAW A;  3MEF A;  4PZ7 A;  3K7A H;  5C4X H;  5M3F G;  3RN2 A;  2NN6 G;  3ICE A;  5IYD H;  3F2C A;  1VQC A;  3BJU A;  4YCV A;  3G71 A;  1Q81 C;  1IBM Q;  1PH8 A;  3PUZ A;  4JI5 L;  4DV4 L;  1I50 H;  1JJ2 A;  4DUZ L;  3LGJ A;  3PIO A;  3HOX G;  3OYY A;  2GVA A;  3CPW A;  5AJ3 L;  1K9M C;  1K8G A;  4GKJ L;  1YHA A;  3CF5 A;  1VQ9 A;  4A3L G;  4A3L H;  1P16 A;  1E24 A;  2ZJP A;  4NXM L;  1G51 A;  2N3S A;  1I6H H;  1Z47 A;  2DUD A;  4Y7N H;  3U58 A;  3FHW A;  5IP7 G;  1PVO A;  3NEM A;  1E22 A;  4AYB E;  1HZ9 A;  4R1J A;  1V43 A;  1J5E L;  3UE0 A;  2RCN A;  4A3E G;  1E1T A;  1JJG A;  3CCJ A;  5C3E G;  2UU9 L;  3J81 i;  5C3E H;  3S2D H;  1Q8K A;  3HFZ B;  2AMC B;  5BR8 L;  3CW2 C;  3UDG A;  1N34 Q;  4ME3 A;  1X3F A;  3CPF A;  1P8L A;  3CCM A;  3F2D A;  3S15 H;  2PI2 E;  3HKS A;  1XMQ L;  4LF8 Q;  5IYB G;  3CD6 A;  2KHI A;  5GAE C;  1SMX A;  2CCZ A;  2YTX A;  4JI0 Q;  4A3C G;  1BBW A;  4DR3 L;  4JI2 L;  4A3B G;  4A3C H;  1YJW A;  5FLM H;  1X9N A;  1QVF A;  3GTL H;  1OTC A;  2JEB I;  1FGU A;  5GQO A;  4DR5 Q;  1FJG Q;  4R4C A;  2UUA L;  4DV7 Q;  1XNQ L;  1OXT A;  5GAH C;  2JK8 A;  1XPO A;  2NZH A;  1GD7 A;  2MNA A;  2GVB A;  4IJL A;  1U0L A;  3T1H L;  4DV5 Q;  1TWH H;  2CFM A;  4AQY L;  1XMO L;  1YHQ A;  4YHH L;  3GTM H;  2E2J H;  4JV5 L;  3FKI G;  3S1R H;  3I4N G;  4DV0 L;  2JA6 H;  3H0G G;  4BY1 H;  3RNU A;  1FVI A;  3H0G H;  4IPH A;  1VQO A;  5JJL A;  4UP7 A;  3KF6 B;  1SFO H;  3PF4 A;  2HIX A;  3RLN A;  4LFA Q;  2YV5 A;  2MQH A;  2D62 A;  2VQF L;  1NMG A;  4LFC Q;  1AH9 A;  4DR7 Q;  1WFQ A;  1OXU A;  3GDE A;  1PH1 A;  2JA8 G;  2YTY A;  1HR0 Q;  2VS1 A;  4DV2 L;  4LF5 L;  1PH9 A;  2VNU D;  1L1O B;  3CC2 A;  4GNX B;  2MO0 A;  3W1B A;  3S17 H;  3KDF A;  4B3M Q;  3CP0 A;  1VQH A;  2VZA A;  3PO3 H;  3PUV A;  3PUW A;  4A3I G;  4JI1 Q;  1KL9 A;  3CMA A;  1TWF H;  3TRE A;  2Q2U A;  4JI3 Q;  4IPD A;  4DV1 Q;  2WAQ E;  1A0I A;  1YJ9 A;  4BXX G;  3ZJY C;  1OXX K;  4GN3 B;  5M3M H;  4PMW A;  3IRB A;  5C4J H;  4X62 L;  2HHH L;  2CWP A;  5K36 G;  2V1C C;  3RLF A;  1VQP A;  3I7F A;  4TVA B;  1N32 Q;  1QUQ B;  1IBK Q;  2ZJR A;  3RLO A;  1BBU A;  2UXC Q;  4LFB L;  4LF4 Q;  3UE1 A;  2B29 A;  3PO2 G;  1CKN A;  2JQO A;  3KF8 B;  4JI4 L;  1I94 Q;  2ATW A;  2F52 A;  1HNW L;  3H3V H;  4LUV A;  4A3J G;  4GLA C;  4UPA A;  3D0F A;  3HKZ E;  2B63 H;  1PH4 A;  1MIU A;  4JYA L;  2EIF A;  4WJ4 A;  4RMF A;  4DNI A;  4DV3 Q;  2PMZ E;  3BU2 A;  2A19 A;  1QZG A;  1VQ8 A;  3S1N H;  1SN8 A;  1VQB A;  4OWX B;  2WP8 J;  4GLV B;  2BH2 A;  2K5H A;  2R93 G;  3KFU A;  2R93 H;  2ZTE A;  4EX5 A;  1G29 1;  2WB1 G;  4L5T A;  3STB C;  3E9I A;  4RG1 A;  2Q2I A;  4OXP A;  4O2D A;  4XIG S;  2QA4 A;  1Q1B A;  4LF7 Q;  1LM0 A;  1Q86 C;  1OXS C;  4A3F G;  4OWW B;  3H15 A;  3I2Z A;  4A3F H;  4YWM A;  4DR1 L;  3PUX A;  1MJE A;  1IBL Q;  3M4O H;  2VQE Q;  1X55 A;  4POG A;  3RN5 A;  2PQA B;  5IP9 G;  1Q1E A;  4JI8 Q;  2UXB L;  2A1A A;  5JEA J;  4C3H H;  2VY3 A;  2QGQ A;  2NVT H;  4LUZ A;  4A93 G;  3KLW A;  2UUB L;  4X66 L;  5C4X G;  4KHP Q;  3CME A;  1GM5 A;  5JEA G;  5IYD G;  4JBW A;  4LF6 L;  2K5V A;  4YWK A;  2ZJQ A;  1X65 A;  3HOV H;  1KXL A;  3U4V A;  1N9W A;  1VQG A;  3STB D;  2UUC Q;  4L5R C;  4AH6 A;  1SRO A;  4FDB A;  2N78 A;  1SE8 A;  2YYZ A;  2JEA I;  5M5Y H;  4UY8 C;  1Q7Y C;  3M85 A;  1SR3 A;  3CC7 A;  3S1Q H;  3K8A A;  1S72 A;  4MNO A;  2B3G A;  3M3Y H;  2E2I H;  2AHO B;  1HJP A;  2R7D A;  1IBM L;  2BH8 A;  3BZC A;  2UXD Q;  4GS3 A;  4POF A;  2R6G A;  4LF9 Q;  5IYC H;  4A75 A;  4JI7 L;  2D0P A;  2OCE A;  4QY7 A;  1K73 C;  1A63 A;  3H3V I;  1VQD A;  1KHI A;  4GOP B;  1VQ4 A;  4X64 Q;  1IYJ B;  3ULJ A;  5AJ3 Q;  2I0Q A;  4B3S L;  3AEV A;  4K0K Q;  3GTO H;  3S1M H;  1PFS A;  4A3M G;  2LXJ A;  4A3M H;  3OW2 A;  1KIX A;  4DR4 L;  2N8N A;  1PYS B;  2KHJ A;  2YU9 H;  1VQK A;  2ASB A;  1U5K A;  3K7U C;  1NMF A;  2AWN A;  3VDY A;  3GTK H;  3M4Q A;  3KF6 A;  3AFP A;  4YWL A;  4L5Q A;  2FXQ A;  4C2M H;  5LMU Q;  4GLX A;  1N34 L;  4YCW A;  2Y0S G;  5FLM G;  4HJ5 A;  1UE6 A;  2HT1 A;  1Y1W H;  2AKW B;  1E7Z A;  1E3P A;  1NJI C;  3JC6 6;  4P72 A;  1KC8 C;  4LF8 L;  1YIJ A;  3CCL A;  5GAD C;  1LYL A;  1E1O A;  5IT9 c;  1Q82 C;  4JI0 L;  1L1O A;  4NXN Q;  1Z9F A;  4GNX A;  3J80 c;  4IFD I;  1O7I A;  1EQQ A;  3TS0 A;  2JA6 G;  4BY1 G;  4R4T A;  4DR5 L;  3NEN A;  2EQS A;  4DR3 Q;  4BBR H;  4OO1 G;  2IHE A;  1FL0 A;  2RHS B;  1W2B A;  2E5L L;  5FJ8 H;  1VQJ A;  3I4M H;  4B3R Q;  3PGZ A;  1EIF A;  1Q46 A;  4GN4 B;  4DV6 L;  2VUM H;  4AQY Q;  3L2P A;  1WCM H;  4PZ8 A;  4YHH Q;  3CXC A;  2IX0 A;  4MZ9 A;  3A74 A;  2ZTC A;  3T1Y L;  4DAY B;  1RL2 A;  4WJ3 M;  4DV0 Q;  3PUY A;  1IXR A;  1KRS A;  2ZM6 L;  4A3D H;  3AFQ A;  1J6Q A;  4B3T Q;  1KQS A;  2RHQ B;  3KOJ A;  3PO3 G;  4LFC L;  1HZA A;  1YI2 A;  3HKZ G;  1M1K C;  1M90 C;  3OTO Q;  3A5Z B;  1IL2 A;  1QUQ A;  2VQF Q;  2E2H H;  2JA7 G;  3A0J A;  2JA7 H;  4NPS A;  2F4V L;  5E7N A;  4JI6 L;  2CWA A;  3G48 A;  4B3M L;  5FLX c;  4JOI A;  4OX9 L;  5LMN L;  1K0R A;  5JJK A;  4JI1 L;  2MFI A;  1MJC A;  2HIV A;  5M3M G;  3KYH C;  1QVG A;  5GAG C;  4HJA A;  2F3I A;  1XJV A;  1LUZ A;  2Q2T A;  4QGU A;  4DV1 L;  4A76 A;  1CKO A;  1DGS A;  5LMN W;  1UE1 A;  4OON A;  1XPR A;  2DGY A;  1ASZ A;  3TRZ A;  3PV0 A;  1NE3 A;  4APV A;  3RZO H;  4Y52 H;  1HNZ Q;  2Z6K A;  3W5O A;  3AQQ A;  3FP9 A;  3UDI A;  3BZK A;  4UP9 A;  4IPG A;  4A3K H;  4A3K G;  1IBK L;  2HHH Q;  2R92 G;  2R92 H;  2UXC L;  4QJF A;  1B70 B;  4LF4 L;  2B63 G;  1AE2 A;  1L0W A;  2LSS A;  3PSI A;  5JJI A;  2I5L X;  1L1O C;  1KRT A;  1I94 L;  2VL6 A;  4GNX C;  1N36 L;  2PQA A;  2OTJ A;  1YHB A;  1TWA H;  3AYH B;  1A8V A;  3G4S A;  4DUY Q;  1PH7 A;  1XNR L;  3I4O A;  1HZC A;  1HNW Q;  3GTG H;  1VQ6 A;  1CSQ A;  4OO1 I;  2CKZ B;  5C0X I;  4DV3 L;  3TQY A;  4BA1 I;  2RF4 A;  1QVC A;  4YY3 L;  2OQK A;  4DR2 Q;  1VQM A;  3J80 i;  1VQN A;  1JMC A;  5IY0 A;  1X56 A;  2WFW A;  4DPG A;  4HJ7 A;  4IFD J;  1C0A A;  4J15 A;  2K5N A;  1JJC B;  2XGT A;  4AYB G;  1K8A C;  2R7Z H;  1N33 Q;  1MKH A;  2XTI A;  4KI0 A;  1YZ6 A;  4HIK A;  1NBW A;  3HOZ H;  3PCO B;  4IFD G;  4DR4 Q;  1G6P A;  3S24 A;  4DR6 L;  4LF7 L;  2MO1 A;  1GKH A;  4HJ9 A;  3S16 H;  3PF5 A;  3HOY H;  2ZTD A;  3F8T A;  1IBL L;  3I55 A;  1YEZ A;  3EBE A;  1TWG H;  3HOV G;  3K0X A;  4JI8 L;  5IWA Q;  4DR1 Q;  1HNX Q;  4LUO A;  4X65 Q;  1X3G A;  4GKK L;  2IHF A;  5H1S E;  3NBH B;  3UDX A;  1AE3 A;  2L15 A;  3CCS A;  4DAM A;  4GOP A;  3CCR A;  2H5X A;  4KHP L;  2ALY B;  1K3R A;  3DM3 A;  4BA2 I;  3PIP A;  4A3G G;  2Q2H A;  4A3G H;  2UUC L;  1EIY B;  3CCE A;  5GRO A;  3RZD H;  3M4P A;  5IYC G;  1JB7 A;  1I3Q H;  4HJ8 A;  4P75 A;  4DV4 Q;  4JI5 Q;  1Y14 B;  1PHJ A;  4DUZ Q;  3F2B A;  2Z6K C;  4NB3 A;  3DLL A;  1D8L A;  5M3F H;  1KD1 C;  2UXD L;  3E9H A;  4GKJ Q;  4XTC S;  4LF9 L;  5J3B A;  3ULP A;  3S2H H;  4YCU A;  1PYB A;  4R4I A;  3GTP H;  1EUJ A;  3ERS X;  3UDF A;  2CQO A;  1VQE A;  4NXM Q;  1WI5 A;  1HZB A;  4X6A H;  3KJP A;  3HOX H;  4JI7 Q;  1QZH A;  4X64 L;  4K0K L;  2OQ0 A;  1IZ6 A;  1J5E Q;  4O0A A;  1PH2 A;  2WB1 E;  4B3S Q;  2UU9 Q;  1VQ5 A;  1Y1W G;  3D31 A;  3NEL A;  2KCT A;  5BR8 Q;  1C9O A;  5IP7 H;  3Q8D A;  1B8A A;  1VQA A;  4PG3 A;  3CCV A;  1XPU A;  5LMU L;  1PH6 A;  1JT8 A;  2R7F A;  4A3E H;  2WAQ G;  4AIM A;  2KCM A;  1GO3 E;  1XMQ Q;  4KHZ A;  1UWV A;  5C0X J;  2NVY H;  2VW9 A;  1EFW A;  2K4K A;  4JI2 Q;  1CUK A;  3ULL A;  4BBR G;  1Y1V G;  4P74 A;  4DV7 L;  1Y1V H;  1UE7 A;  1FJG L;  4UP8 A;  1V1Q A;  1HH2 P;  4C3J H;  3F1Z A;  4DK3 C;  5FJ8 G;  1T9H A;  1WYD A;  5C0X G;  4DV5 L;  3ER0 A;  4NXN L;  2UUA Q;  4JG2 A;  3I4M G;  1XNQ Q;  4H02 A;  1LTL A;  5DLQ E;  4JBK A;  5IYB H;  2VUM G;  2PI2 A;  1VQI A;  4MTN A;  3T1H Q;  1WOC A;  4IOA A;  1XMO Q;  2JE6 I;  1WCM G;  4A3B H;  3W1G A;  4C3I H;  4GOP C;  4JV5 Q;  4PZ6 A;  4OWT B;  4R4Q A;  2HQL A;  3GO5 A;  4HIM A;  4LNQ A;  3GTQ H;  4BY7 G;  4LFA L;  5EAY A;  5HY6 A;  3U50 C;  4BY7 H;  4A3D G;  1X6O A;  4B3R L;  2E5L Q;  1SLJ A;  2NZO A;  4DK6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...