1KB9H

Yeast cytochrome bc1 complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
93
Chain Sequence
GPPSGKTYMGWWGHMGGPKQKGITSYAVSPYAQKPLQGIFHNAVFNSFRRFKSQFLYVLIPAGIYWYWWKNGNEYNEFLYSKAGREELERVNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 17
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1kb9H00
2BCCG 4PD4H 1L0LG 3CWBG 1BE3G 3H1LG 1NTZG 1BGYG 3L72G 1PPJG 1SQVG 3H1IG 1L0NG 4U3FG 3L70G 1PP9G 3L73G 1KYOH 1SQQG 3TGUG 1NTMG 2FYUG 3BCCG 3L74G 3H1KG 1BCCG 1NTKG 1NU1G 1SQPG 3CX5H 3L75G 3H1HG 5KLVG 3L71G 1EZVG 1P84H 2IBZG 3CXHH 4D6TG 1KB9H 1SQBG 1SQXG 3H1JG 2A06G
chains in the Genus database with same CATH superfamily
2BCCG 1UIIA 3H1KD 2E76C 5H2FH 1IFJA 1K05A 1JY3N 1LP1A 4LLHA 2Z5HA 2FY8A 1NAFA 4DJGA 1PGPA 1RE3C 5AW5B 1HJBA 1RHZB 3MGNA 1BGYG 5TISE 2J59M 1YJ9P 2OYIC 5APWA 1SQVJ 5CJ4A 1NO4A 3BATA 1FZAA 4ZKUA 2P58A 2A45G 2W27A 3GHGC 2Q3EA 1GD2E 3IFMA 4KJMA 1VF5D 4K3AA 4D6TD 5GTIH 2MKVA 1MKMA 4PD4D 4H13B 3H32B 3KYQA 2H7HA 4IFMA 3CLQA 1U57A 1S72P 5GTHE 3H1KG 3MUDA 2K37A 2AXTE 2WT7B 1JCDA 3WUTA 5BU5A 1IFIA 1M1KQ 1GW3A 1NKNA 2WWWA 3IF4A 2A45H 1FOSE 1M90Q 4BRYA 1KB9H 1S4XA 1SQXG 3L70D 1DD4A 3F89A 4KHXA 4BXLA 2K9JB 2A45I 2ITAA 2M3BA 3L71D 3H1KE 4JF7A 5AW7B 4DOJA 3T97B 1AFOA 5BVZA 1LT9A 1LTJA 1DIPA 1KB9I 2WSSH 1ZMEC 1JCCA 2A06D 2KS1A 3AE2C 3MP7B 1JY2O 3RL0C 3GF3A 3B5NB 3U59A 5AVXB 5KTBA 3H1LD 2MJZA 4GODA 3KXDA 3RK2D 2D2CC 2K1AA 4EI2A 3KZIH 3WUVA 4N78E 4GT1A 1CI6B 1TU3F 5APTA 3GW6A 4N6JA 3O6QB 1SQXJ 2WPRA 3AE6C 2FYUK 2ZYDA 3L75E 3AECC 2OYOA 1ZXGA 2POHA 3LIEA 3S4RA 3M0DC 1X8YA 1N73A 1NTZD 1P84D 1BSNA 1YBKA 3Q5SA 3RL0D 2E76B 2Q9IA 1DH3A 1BGYJ 3II6A 1QL1A 1PP9E 4PD4I 1JY2N 1OVVA 1VF5B 2JO1A 3A0BH 2H43A 5B66E 1URQD 5E79H 1ZR4A 2OYIB 3CCEP 1PL5A 3H1JJ 1R5SA 1BCCJ 2OTJP 3G71P 3E7KA 1NYHA 2FYNB 1GMJA 2FYUE 4WBAA 5AW0B 3GMAA 1AJYA 2A06E 1NTZG 4RO0A 2HODA 2SPZA 3H1IG 4H44D 3SFDC 4ZMDA 1NWQA 1VQMP 3K5BA 4WY4A 1HVVA 2FXMA 3MUDC 1SQBD 3RBZA 3H1JE 2YKQA 1JM0A 3L37A 3L72E 2WT7A 1S3JA 3LW5J 2D2CD 3NMDA 1MFTA 1PZQA 3RK3B 1GU5A 3V5BA 1EDKA 3BCCG 1FJKA 1NTMJ 5APQA 1NTZE 1P84E 2W8ZA 3L74J 3TYYA 1VQ6P 3A0BE 3RK3C 2ZYGA 3D6ZA 2Q3IA 2HPCB 1SFCB 1KILD 2UWJE 2WQYC 2G3AA 5C39A 1Y47A 2XNXA 1M1JA 2N1TB 1SQBG 3B5NC 3HTKA 1KILA 2JR8A 5AW3B 1JY3O 4JYBA 3FWLA 1EXIA 4HKZH 3AEEC 1G2CA 1OVRA 4ASVA 3CMAP 2FYUD 2V4HA 1KC8Q 2VRSA 5AVTB 5KLIB 1FE6A 1NTZK 1SP4A 3Q2YA 1HH0A 1IZNB 2WMMA 1JUNA 3CC7P 1HUCA 1SFCD 1KTMA 1SQBE 1J1DC 3CX5I 3L73G 3L72D 2XNDH 4A7PA 2QJPC 5APXA 1NU1D 3WU2E 3CD6P 3U1CA 5AW6B 1NTMG 2OGUA 4LC1A 2LR2A 1Q90D 1JMBA 1J1EC 2KK7A 2WITA 3GF7A 2FFDA 1EDJA 3H1KJ 3CI9A 3CWBE 5AW9B 2KSJA 1IJDB 1GTWA 1H89A 2P67A 1N7SD 3BCCE 3PHLA 4YXWH 5KLVK 2XDJA 3FXDA 1J1EB 3CL3D 1PGQA 2AXTH 2IBZG 4OWFA 1KD1Q 1LNQA 3TGUD 1CW5A 1SQBK 4N3YB 1WRGA 2YO3A 3CCUP 1BSHA 1RE4C 4PV1C 2G8YA 1S1CX 3PRJA 1MFZA 5DJUB 2C0XA 4I7ZB 1HJ0A 1BCCD 1DEBA 3TDKA 3AE7C 2YIUC 2W83C 4U3FG 1ZV8A 1N7SA 1GK6A 1YIJP 3S9OA 2QG4A 4H0LD 3V4QA 5KLVE 3HD7D 3RL0B 1IK9A 2R5BA 2W6AA 4ZKPA 1NU1E 3TGUG 3Q1MA 1SFCC 2Q7CA 2BEZF 1W2BO 2J58A 2O01N 3GHGA 1Q81Q 2KXPB 2KS1B 2PFXA 3QWOC 3PH0A 3CCLP 3AE9C 1T6AA 2KSEA 1S5LE 3L74D 2Q6QA 3USSA 2QM7A 3V2RA 1FZFA 4TLFA 3D70A 3I56P 2YXQB 5AW2B 1SQQD 1T2KD 3GG2A 4EDFA 5KAFH 3IAOA 3B8EB 2ZVOB 3HUSB 4PD4H 3VMAA 2QVAA 2OYHA 1L0ND 2IZ1A 1L0LG 1SQPE 2WPSA 2YKOA 3CXHD 4OH8B 1VQ8P 3TF5A 1P84I 1BCCE 1QLED 3SWKA 1RF0C 3HUSC 1G1JA 2E43A 5CCGD 1M8OB 2XKMA 1IO4A 4DZOA 1SQXE 3ZDMA 2RN0A 1NHLA 3V6IA 1AA0A 1Z56A 1VQLP 5AW1B 1ZRTE 3BRTB 3MHVA 4UB6H 4OGQD 1RE3A 2AEMA 1FU1A 2IDBA 2W6JH 1L0LD 1SQVE 1RH5B 4L76A 1VL2A 2LXCB 1AQTA 4B86A 2E74D 3L74E 3TNUB 3V2QA 3EFGA 1L4AA 1JB0J 3L73J 4H13D 5H2FE 5KAIE 4DT0A 3I55P 3CCMP 1LT1A 1IK7A 4WY4D 1KQLA 2B9BA 3A0HH 1CZQA 2PGDA 1ZW0A 2JEEA 2AXCA 2K9YA 2RKLA 3CWBJ 2WSFH 1SQPD 4H44B 1OIPA 2N1TC 2R3CA 3P8CD 5AVSB 1KZUB 2DW3A 5AVWB 2AEFA 4EYYQ 1HWTC 3SFEC 4QMAA 4C46A 1IFDA 2IYPA 1EZVI 2R44A 4JQ0D 1LJ2A 1NOHA 1SFCA 1URQA 5KLVJ 2FBWC 4EOTA 1H0TA 3MTUE 5APUA 2ZFCA 3HTKB 1LWUA 5KLIC 3U1AA 3VOPA 2R5DA 1GL2A 3OJAB 3A5TA 2C9LY 1ZRTD 1A02J 2FFDC 1GDTA 3AEDC 1GK4A 1NTKJ 5CCGA 2V7QH 1BGYE 5EFWB 1L0LE 1QL2A 1SQPG 1JNMA 2OTLP 1X0TA 5L8RJ 2P1JA 1NTME 1YYCA 2KUBA 2R3SA 2QE7H 3E1IA 3JCUE 4U3FJ 2HYNA 4GDOA 3H1IJ 1VQ4P 2BCCE 2E5YA 1P84H 1GZLA 1RQVA 2OARA 3H1HE 3VN0A 2FYZA 3I5CA 1MUUA 3H32A 1M56D 2XV5A 4HJGH 1R8EA 3AEBC 1DD3A 2I1KA 2KZIA 3E1RA 1SLQA 3FWNA 4PJ0E 3B5ND 3TSIA 1YJWP 3BCCJ 1X79B 3Q5PA 3VP8A 3S1KA 1QVGO 1M57D 3M91A 2XZRA 3H1HJ 3HD7A 1CI6A 1Q86Q 3AE4C 4I7ZC 2WPVB 1FZCA 4AQRD 2QIWA 2XU6A 1QEXA 2YIUB 3AE5C 3R2PA 1N73B 1SQBJ 3P7KA 1BE3E 4U7JA 1RQUA 2FKWB 4BWNA 3RK2C 4UB8E 5APSA 1LTIC 3C9IA 2E74C 3LIDA 2JWDA 3NFQA 5CMZA 1NTMD 1KV4A 5AVVB 1VDFA 3L36A 2QJKC 1N86A 2WSEH 4H44C 3L4FA 1HGZA 1XTGB 1SS1A 2BCCD 3KQGA 4IL6X 5AW4B 4U3FE 1GU4A 1L0LK 3CXHH 3L73D 4DCKA 1T8ZA 4H0LB 5B5EE 3L71E 1QX8A 1T2KC 3M9BA 3QH9A 2K9JA 1S5LX 3AEGC 3CWBG 3CXHI 2KNCA 1GW4A 1Q2NA 2Y0EA 4L75A 3TK1A 4H0LC 4GIFA 1SQPJ 1N7LA 3GHGB 1NTZJ 2NPSA 3PJSK 2IPPA 1VQKP 3H1LE 4TT3H 5CHXA 5GTHH 2HFED 3FGAD 3W68A 5CCGC 2KI7B 2B87B 1T3JA 2H8PD 1Q82Q 3IR9A 3A7OA 1W2EA 1H8AA 1DX7A 1RF0A 3HUSA 3L75D 1SQQJ 1YJNP 3O6QA 1BE3D 1FBMA 1NU1J 4R4LA 5BU8B 2PP6A 3RK3E 1NTKG 1FDOA 3C8VA 4C7NB 4YXDC 5TISH 1FS0E 1L0NJ 4IL6H 3WUUA 2OQQA 4IFFA 4PV1B 4HYTB 4M3LA 3LW5H 1PP9D 2RMZA 5AVQB 4U3FD 3V4WA 3UIAA 5KAFE 3NTNA 2JP3A 1LP1B 1K04A 3RBXA 2O1JA 1JTHB 2B89A 1PPJD 2W90A 3G9RA 3TGUJ 3WU2H 1BDCA 3H1LG 1BE3G 1FZCC 2KLUA 2C0WA 4O9BA 2LXBA 2QRXA 2HPCA 1MZ9A 2ZAEB 3PTZA 1L4AB 1L0NG 1NAYA 2Y9ZA 2HODB 2K3RA 1OW8A 1GL2D 5CCHC 2HLOA 1PP9G 2IYOA 3CCQP 4D6TE 1PIXA 1SQQG 1QGKB 2PRRA 3JC22 1SQQK 1N2DC 4L74A 3SSUA 3OA7A 4WB4A 2IFNA 1K8AQ 4LGDE 1LTBC 4IOIH 2I1JA 1FC2C 2GUSA 1VQOP 2QM8A 4GKGA 1XTCC 1NKZB 1ZP0C 3H1HG 2LKMA 2FFDB 1KFNA 5DJTB 2YXRB 1KILE 1T3UA 4PJ0H 4D6TJ 3D71A 2PAJA 4IFDK 1EZVG 4UB8H 5AVUB 1E5WA 3CCRP 3VTPC 3CCSP 1HGVA 3L70E 2QA4P 2BCCJ 3V2NA 3HE5A 1PPJE 1AVYA 1UIXA 2O1KA 3G6EP 1NH4A 2H89C 1FDIA 1RF1C 2P10A 1LTTC 1S2EA 5AVRB 1G2CB 5TJHA 4I2LC 2QJYB 2M8RA 3BASA 5AW8B 5CBNA 1ZR2A 4XA4A 2QEXP 1VQ9P 1OWAA 4ZNCA 5AVYB 2M5AA 3HE4A 4N78D 1OX3A 4KT0J 3H1ID 2JWAA 4BRYB 4GOEA 1YI2P 1X9VA 1X22A 2O3JA 4HH2A 4K35A 4Y99C 3IN6A 2BEQD 3ITKA 2Y0CA 1OMIA 3KZIE 3T97A 1U7JA 3L75J 4RESB 1BE3J 1SQPK 3OW2O 2GA1A 4Y99B 3BCCD 3B5NA 5KLVG 3RK2B 1YITP 2KLVA 3F5HA 5KKZC 1FZCB 1EC5A 1L2PA 3AEFC 3G4SP 3FX0A 3M0DA 1G1IA 1LGHB 2WSEJ 2KIKA 4GOFA 4AYCA 1MV8A 5KKZB 1IFMA 3EQ2A 1HTLC 3PLNA 1VQ5P 2AEJA 1K9MQ 2W6BA 3VMZA 3H6PA 1KQFB 1KYOI 1N7SC 3Q5RA 3C1LA 2Y9YA 1SQVK 1Y9BA 3N7NA 1HF9A 5KLVD 3M06A 3H1JD 3H1IE 3MD0A 4WVZA 1CSBA 2HG5D 2NPSC 3A0HE 5APYA 2H88C 1Q7YQ 3G3ZA 1EQ7A 2WZ7A 3KHUA 3MIWA 1FJPA 1D7MA 1E79H 1NU1G 1URQC 2WPQA 2CPBA 5KJ7C 2NPSB 3AEAC 4JBZA 3P32A 4RJTA 4I1LA 4XE5B 3KDPB 2E75D 1M1JB 2B87A 2N1TA 3RGUA 1H88A 2ZXEB 1SQQE 4XFJA 1FZGA 2OYHC 1USEA 3M9QA 2CK3H 2NRGA 1USDA 2IZ0A 3WMM0 5B5EH 1M1JC 1EDIA 3O8ZA 1L0NE 3AE8C 3CXHE 4RKUJ 1YQ3C 5GTIE 3BRVB 4JYCA 1H0TB 1FDMA 5KJ7D 1N73C 2ZYAA 1KMIZ 3H25A 1RF1B 1KQSO 4AUWA 3PP5A 1LTGC 2BASA 1NTMK 2JDIH 4Z1MH 3B4SA 1SQXD 2E74B 1KORA 3L70G 3V2PA 2N1TD 4WY4B 3CPWO 2Z4EA 1PV3A 2QJKB 1JTHA 2FYUJ 3RL0g 1KILB 5CBOA 5AVZB 3M0AA 3L74G 2IX7C 5CCHA 4WY4C 1KN7A 2D2CB 3A3YB 3CWBD 1J2JB 1SQVD 3L75G 3NXSA 1SVFA 2Z5IA 2O01H 4OGQB 3L71G 2L91A 3VMYA 1LWUB 1IFPA 2RH0A 3FXEA 2CPSA 3TGUE 1FZEA 1WMKA 1HBWA 2A06G 4OGQC 2KOGA 1A02F 1OZHA 3B71A 1IC2A 1NGMB 1ZN5A 1EXJA 1EDLA 1KYOD 4L73A 2E75C 2Y0DA 3P8CE 4IL6E 3CCVP 5CCHD 3GLMA 2IFMA 1NTKD 3R4YA 1BDDA 1OW6A 1SQVG 1JOCA 1JEKA 1PPJG 2B88A 2FXOA 2YMKA 3KPEA 1L0NK 3L70J 2E75B 4H13C 4NPFX 1FZBA 2E5TA 1URQB 4PV1D 2FYNC 2QJYC 2NPSD 3HE5B 2WSCJ 3OAKA 2Q1KA 1YHQP 1PGOA 2R32A 3HRNA 4W7ZA 1FOSF 1LTAC 3MZWB 2E76D 2ZT9D 4NPEA 1U7MA 2YNYA 1LTJB 1LT9B 4WWIA 1YTZT 3H1LJ 5B66H 2C9NY 2E42A 1IFNA 1JY2P 2J5UA 3HD7B 1FAVA 4EIJA 2K88A 1KFMA 2M5AB 1LTJC 1LT9C 2WVRA 3HE4B 3M9HA 4MN4C 2WTYA 1PFIA 2WSFJ 3CX5E 3H1HD 1PP9J 1VQPP 1L4AC 1SQXK 1JMMA 3AE1C 5APVA 1YQ4C 2P2UA 2ZXXA 3SWYA 1AV1A 1KYOE 2KB7P 5KAIH 4JPZB 1JO5A 4W7YA 1NTKE 1AQ5A 1GL2C 1W5CE 1OFCX 3L72J 1YTZI 4C7RA 3P8MC 3JSVC 1KYOH 1N7SB 5CJ0A 1EZVD 3W67A 2I8DA 2V7QJ 4UB6E 2OYIA 1OXZA 2P7JA 3CC4P 2FYUG 1LWUC 2JKVA 1LTSC 1Y8AA 2ZT9B 3EWKA 1NJIQ 2QSIA 1K73Q 1RE4A 1KB9E 1J1DB 1KQGB 2IBZE 1OW7A 1VF5C 3CX5H 2OTKE 1OVUA 2Q5UA 2QJPB 2YKPA 2ZT9C 2ZVNB 3A2AA 3L35A 1S9KD 1AVOA 3VYIA 2YO2A 3VMXA 2KP8A 2WSCH 1NU1K 3EFFK 3L71J 3SWFA 3Q3DA 1RY3A 3CX5D 4ASWA 2NZ2A 4Y28J 1VQ7P 3L73E 3ABVC 3VP9A 2IBZI 4I6MC 4NPDA 4YPCA 1PGJA 2N9YB 5E79E 1L0LJ 1ZOYC 2ZJSE 5K5GB 1R5LA 1DEEG 2GUVA 2YMYA 1N8RQ 2OYHB 3JCUH 4HB1A 3D6YA 2N9BA 2KNCB 1S5LH 3L72G 1VPCA 3N4XA 2M3EA 3TNUA 2GM4A 3AE3C 3BVHA 3CCJP 3CC2P 1NTKK 1EZVE 4CPGA 5M1BA 2JJLA 3HD7C 4PD4E 2KZJA 4W80A 4YTPC 2FXPA 1JY3P 4OVNF 1BCCG 3RK3D 4R4MA 1BGYD 1ZLLA 1KB9D 3CMEP 2IBZD 1WT6A 1KILC 1VQNP 4C7NA 1S9KE 2M0BA 1NVOA 1QVFO 1RF1A 5KJ7A 4D6TG 1L4AD 2L5GB 1M7LA 2HR3A 3H1JG 2O01J 1GL2B 2KYVA
chains in the Genus database with same CATH topology
2BCCG 4PD4H 1L0LG 3CWBG 1BE3G 3H1LG 1NTZG 1BGYG 3L72G 1PPJG 1SQVG 3H1IG 1L0NG 4U3FG 3L70G 1PP9G 3L73G 1KYOH 1SQQG 3TGUG 1NTMG 2FYUG 3BCCG 3L74G 3H1KG 1BCCG 1NTKG 1NU1G 1SQPG 3CX5H 3L75G 3H1HG 5KLVG 3L71G 1EZVG 1P84H 2IBZG 3CXHH 4D6TG 1KB9H 1SQBG 1SQXG 3H1JG 2A06G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BCC G;  4PD4 H;  1L0L G;  3CWB G;  1BE3 G;  3H1L G;  1NTZ G;  1BGY G;  3L72 G;  1PPJ G;  1SQV G;  3H1I G;  1L0N G;  4U3F G;  3L70 G;  1PP9 G;  3L73 G;  1KYO H;  1SQQ G;  3TGU G;  1NTM G;  2FYU G;  3BCC G;  3L74 G;  3H1K G;  1BCC G;  1NTK G;  1NU1 G;  1SQP G;  3CX5 H;  3L75 G;  3H1H G;  5KLV G;  3L71 G;  1EZV G;  1P84 H;  2IBZ G;  3CXH H;  4D6T G;  1KB9 H;  1SQB G;  1SQX G;  3H1J G;  2A06 G; 
#chains in the Genus database with same CATH topology
 2BCC G;  1UII A;  3H1K D;  2E76 C;  5H2F H;  1IFJ A;  1K05 A;  1JY3 N;  1LP1 A;  4LLH A;  2Z5H A;  2FY8 A;  1NAF A;  4DJG A;  1PGP A;  1RE3 C;  5AW5 B;  1HJB A;  1RHZ B;  3MGN A;  1BGY G;  5TIS E;  2J59 M;  1YJ9 P;  2OYI C;  5APW A;  1SQV J;  5CJ4 A;  1NO4 A;  3BAT A;  1FZA A;  4ZKU A;  2P58 A;  2A45 G;  2W27 A;  3GHG C;  2Q3E A;  1GD2 E;  3IFM A;  4KJM A;  1VF5 D;  4K3A A;  4D6T D;  5GTI H;  2MKV A;  1MKM A;  4PD4 D;  4H13 B;  3H32 B;  3KYQ A;  2H7H A;  4IFM A;  3CLQ A;  1U57 A;  1S72 P;  5GTH E;  3H1K G;  3MUD A;  2K37 A;  2AXT E;  2WT7 B;  1JCD A;  3WUT A;  5BU5 A;  1IFI A;  1M1K Q;  1GW3 A;  1NKN A;  2WWW A;  3IF4 A;  2A45 H;  1FOS E;  1M90 Q;  4BRY A;  1KB9 H;  1S4X A;  1SQX G;  3L70 D;  1DD4 A;  3F89 A;  4KHX A;  4BXL A;  2K9J B;  2A45 I;  2ITA A;  2M3B A;  3L71 D;  3H1K E;  4JF7 A;  5AW7 B;  4DOJ A;  3T97 B;  1AFO A;  5BVZ A;  1LT9 A;  1LTJ A;  1DIP A;  1KB9 I;  2WSS H;  1ZME C;  1JCC A;  2A06 D;  2KS1 A;  3AE2 C;  3MP7 B;  1JY2 O;  3RL0 C;  3GF3 A;  3B5N B;  3U59 A;  5AVX B;  5KTB A;  3H1L D;  2MJZ A;  4GOD A;  3KXD A;  3RK2 D;  2D2C C;  2K1A A;  4EI2 A;  3KZI H;  3WUV A;  4N78 E;  4GT1 A;  1CI6 B;  1TU3 F;  5APT A;  3GW6 A;  4N6J A;  3O6Q B;  1SQX J;  2WPR A;  3AE6 C;  2FYU K;  2ZYD A;  3L75 E;  3AEC C;  2OYO A;  1ZXG A;  2POH A;  3LIE A;  3S4R A;  3M0D C;  1X8Y A;  1N73 A;  1NTZ D;  1P84 D;  1BSN A;  1YBK A;  3Q5S A;  3RL0 D;  2E76 B;  2Q9I A;  1DH3 A;  1BGY J;  3II6 A;  1QL1 A;  1PP9 E;  4PD4 I;  1JY2 N;  1OVV A;  1VF5 B;  2JO1 A;  3A0B H;  2H43 A;  5B66 E;  1URQ D;  5E79 H;  1ZR4 A;  2OYI B;  3CCE P;  1PL5 A;  3H1J J;  1R5S A;  1BCC J;  2OTJ P;  3G71 P;  3E7K A;  1NYH A;  2FYN B;  1GMJ A;  2FYU E;  4WBA A;  5AW0 B;  3GMA A;  1AJY A;  2A06 E;  1NTZ G;  4RO0 A;  2HOD A;  2SPZ A;  3H1I G;  4H44 D;  3SFD C;  4ZMD A;  1NWQ A;  1VQM P;  3K5B A;  4WY4 A;  1HVV A;  2FXM A;  3MUD C;  1SQB D;  3RBZ A;  3H1J E;  2YKQ A;  1JM0 A;  3L37 A;  3L72 E;  2WT7 A;  1S3J A;  3LW5 J;  2D2C D;  3NMD A;  1MFT A;  1PZQ A;  3RK3 B;  1GU5 A;  3V5B A;  1EDK A;  3BCC G;  1FJK A;  1NTM J;  5APQ A;  1NTZ E;  1P84 E;  2W8Z A;  3L74 J;  3TYY A;  1VQ6 P;  3A0B E;  3RK3 C;  2ZYG A;  3D6Z A;  2Q3I A;  2HPC B;  1SFC B;  1KIL D;  2UWJ E;  2WQY C;  2G3A A;  5C39 A;  1Y47 A;  2XNX A;  1M1J A;  2N1T B;  1SQB G;  3B5N C;  3HTK A;  1KIL A;  2JR8 A;  5AW3 B;  1JY3 O;  4JYB A;  3FWL A;  1EXI A;  4HKZ H;  3AEE C;  1G2C A;  1OVR A;  4ASV A;  3CMA P;  2FYU D;  2V4H A;  1KC8 Q;  2VRS A;  5AVT B;  5KLI B;  1FE6 A;  1NTZ K;  1SP4 A;  3Q2Y A;  1HH0 A;  1IZN B;  2WMM A;  1JUN A;  3CC7 P;  1HUC A;  1SFC D;  1KTM A;  1SQB E;  1J1D C;  3CX5 I;  3L73 G;  3L72 D;  2XND H;  4A7P A;  2QJP C;  5APX A;  1NU1 D;  3WU2 E;  3CD6 P;  3U1C A;  5AW6 B;  1NTM G;  2OGU A;  4LC1 A;  2LR2 A;  1Q90 D;  1JMB A;  1J1E C;  2KK7 A;  2WIT A;  3GF7 A;  2FFD A;  1EDJ A;  3H1K J;  3CI9 A;  3CWB E;  5AW9 B;  2KSJ A;  1IJD B;  1GTW A;  1H89 A;  2P67 A;  1N7S D;  3BCC E;  3PHL A;  4YXW H;  5KLV K;  2XDJ A;  3FXD A;  1J1E B;  3CL3 D;  1PGQ A;  2AXT H;  2IBZ G;  4OWF A;  1KD1 Q;  1LNQ A;  3TGU D;  1CW5 A;  1SQB K;  4N3Y B;  1WRG A;  2YO3 A;  3CCU P;  1BSH A;  1RE4 C;  4PV1 C;  2G8Y A;  1S1C X;  3PRJ A;  1MFZ A;  5DJU B;  2C0X A;  4I7Z B;  1HJ0 A;  1BCC D;  1DEB A;  3TDK A;  3AE7 C;  2YIU C;  2W83 C;  4U3F G;  1ZV8 A;  1N7S A;  1GK6 A;  1YIJ P;  3S9O A;  2QG4 A;  4H0L D;  3V4Q A;  5KLV E;  3HD7 D;  3RL0 B;  1IK9 A;  2R5B A;  2W6A A;  4ZKP A;  1NU1 E;  3TGU G;  3Q1M A;  1SFC C;  2Q7C A;  2BEZ F;  1W2B O;  2J58 A;  2O01 N;  3GHG A;  1Q81 Q;  2KXP B;  2KS1 B;  2PFX A;  3QWO C;  3PH0 A;  3CCL P;  3AE9 C;  1T6A A;  2KSE A;  1S5L E;  3L74 D;  2Q6Q A;  3USS A;  2QM7 A;  3V2R A;  1FZF A;  4TLF A;  3D70 A;  3I56 P;  2YXQ B;  5AW2 B;  1SQQ D;  1T2K D;  3GG2 A;  4EDF A;  5KAF H;  3IAO A;  3B8E B;  2ZVO B;  3HUS B;  4PD4 H;  3VMA A;  2QVA A;  2OYH A;  1L0N D;  2IZ1 A;  1L0L G;  1SQP E;  2WPS A;  2YKO A;  3CXH D;  4OH8 B;  1VQ8 P;  3TF5 A;  1P84 I;  1BCC E;  1QLE D;  3SWK A;  1RF0 C;  3HUS C;  1G1J A;  2E43 A;  5CCG D;  1M8O B;  2XKM A;  1IO4 A;  4DZO A;  1SQX E;  3ZDM A;  2RN0 A;  1NHL A;  3V6I A;  1AA0 A;  1Z56 A;  1VQL P;  5AW1 B;  1ZRT E;  3BRT B;  3MHV A;  4UB6 H;  4OGQ D;  1RE3 A;  2AEM A;  1FU1 A;  2IDB A;  2W6J H;  1L0L D;  1SQV E;  1RH5 B;  4L76 A;  1VL2 A;  2LXC B;  1AQT A;  4B86 A;  2E74 D;  3L74 E;  3TNU B;  3V2Q A;  3EFG A;  1L4A A;  1JB0 J;  3L73 J;  4H13 D;  5H2F E;  5KAI E;  4DT0 A;  3I55 P;  3CCM P;  1LT1 A;  1IK7 A;  4WY4 D;  1KQL A;  2B9B A;  3A0H H;  1CZQ A;  2PGD A;  1ZW0 A;  2JEE A;  2AXC A;  2K9Y A;  2RKL A;  3CWB J;  2WSF H;  1SQP D;  4H44 B;  1OIP A;  2N1T C;  2R3C A;  3P8C D;  5AVS B;  1KZU B;  2DW3 A;  5AVW B;  2AEF A;  4EYY Q;  1HWT C;  3SFE C;  4QMA A;  4C46 A;  1IFD A;  2IYP A;  1EZV I;  2R44 A;  4JQ0 D;  1LJ2 A;  1NOH A;  1SFC A;  1URQ A;  5KLV J;  2FBW C;  4EOT A;  1H0T A;  3MTU E;  5APU A;  2ZFC A;  3HTK B;  1LWU A;  5KLI C;  3U1A A;  3VOP A;  2R5D A;  1GL2 A;  3OJA B;  3A5T A;  2C9L Y;  1ZRT D;  1A02 J;  2FFD C;  1GDT A;  3AED C;  1GK4 A;  1NTK J;  5CCG A;  2V7Q H;  1BGY E;  5EFW B;  1L0L E;  1QL2 A;  1SQP G;  1JNM A;  2OTL P;  1X0T A;  5L8R J;  2P1J A;  1NTM E;  1YYC A;  2KUB A;  2R3S A;  2QE7 H;  3E1I A;  3JCU E;  4U3F J;  2HYN A;  4GDO A;  3H1I J;  1VQ4 P;  2BCC E;  2E5Y A;  1P84 H;  1GZL A;  1RQV A;  2OAR A;  3H1H E;  3VN0 A;  2FYZ A;  3I5C A;  1MUU A;  3H32 A;  1M56 D;  2XV5 A;  4HJG H;  1R8E A;  3AEB C;  1DD3 A;  2I1K A;  2KZI A;  3E1R A;  1SLQ A;  3FWN A;  4PJ0 E;  3B5N D;  3TSI A;  1YJW P;  3BCC J;  1X79 B;  3Q5P A;  3VP8 A;  3S1K A;  1QVG O;  1M57 D;  3M91 A;  2XZR A;  3H1H J;  3HD7 A;  1CI6 A;  1Q86 Q;  3AE4 C;  4I7Z C;  2WPV B;  1FZC A;  4AQR D;  2QIW A;  2XU6 A;  1QEX A;  2YIU B;  3AE5 C;  3R2P A;  1N73 B;  1SQB J;  3P7K A;  1BE3 E;  4U7J A;  1RQU A;  2FKW B;  4BWN A;  3RK2 C;  4UB8 E;  5APS A;  1LTI C;  3C9I A;  2E74 C;  3LID A;  2JWD A;  3NFQ A;  5CMZ A;  1NTM D;  1KV4 A;  5AVV B;  1VDF A;  3L36 A;  2QJK C;  1N86 A;  2WSE H;  4H44 C;  3L4F A;  1HGZ A;  1XTG B;  1SS1 A;  2BCC D;  3KQG A;  4IL6 X;  5AW4 B;  4U3F E;  1GU4 A;  1L0L K;  3CXH H;  3L73 D;  4DCK A;  1T8Z A;  4H0L B;  5B5E E;  3L71 E;  1QX8 A;  1T2K C;  3M9B A;  3QH9 A;  2K9J A;  1S5L X;  3AEG C;  3CWB G;  3CXH I;  2KNC A;  1GW4 A;  1Q2N A;  2Y0E A;  4L75 A;  3TK1 A;  4H0L C;  4GIF A;  1SQP J;  1N7L A;  3GHG B;  1NTZ J;  2NPS A;  3PJS K;  2IPP A;  1VQK P;  3H1L E;  4TT3 H;  5CHX A;  5GTH H;  2HFE D;  3FGA D;  3W68 A;  5CCG C;  2KI7 B;  2B87 B;  1T3J A;  2H8P D;  1Q82 Q;  3IR9 A;  3A7O A;  1W2E A;  1H8A A;  1DX7 A;  1RF0 A;  3HUS A;  3L75 D;  1SQQ J;  1YJN P;  3O6Q A;  1BE3 D;  1FBM A;  1NU1 J;  4R4L A;  5BU8 B;  2PP6 A;  3RK3 E;  1NTK G;  1FDO A;  3C8V A;  4C7N B;  4YXD C;  5TIS H;  1FS0 E;  1L0N J;  4IL6 H;  3WUU A;  2OQQ A;  4IFF A;  4PV1 B;  4HYT B;  4M3L A;  3LW5 H;  1PP9 D;  2RMZ A;  5AVQ B;  4U3F D;  3V4W A;  3UIA A;  5KAF E;  3NTN A;  2JP3 A;  1LP1 B;  1K04 A;  3RBX A;  2O1J A;  1JTH B;  2B89 A;  1PPJ D;  2W90 A;  3G9R A;  3TGU J;  3WU2 H;  1BDC A;  3H1L G;  1BE3 G;  1FZC C;  2KLU A;  2C0W A;  4O9B A;  2LXB A;  2QRX A;  2HPC A;  1MZ9 A;  2ZAE B;  3PTZ A;  1L4A B;  1L0N G;  1NAY A;  2Y9Z A;  2HOD B;  2K3R A;  1OW8 A;  1GL2 D;  5CCH C;  2HLO A;  1PP9 G;  2IYO A;  3CCQ P;  4D6T E;  1PIX A;  1SQQ G;  1QGK B;  2PRR A;  3JC2 2;  1SQQ K;  1N2D C;  4L74 A;  3SSU A;  3OA7 A;  4WB4 A;  2IFN A;  1K8A Q;  4LGD E;  1LTB C;  4IOI H;  2I1J A;  1FC2 C;  2GUS A;  1VQO P;  2QM8 A;  4GKG A;  1XTC C;  1NKZ B;  1ZP0 C;  3H1H G;  2LKM A;  2FFD B;  1KFN A;  5DJT B;  2YXR B;  1KIL E;  1T3U A;  4PJ0 H;  4D6T J;  3D71 A;  2PAJ A;  4IFD K;  1EZV G;  4UB8 H;  5AVU B;  1E5W A;  3CCR P;  3VTP C;  3CCS P;  1HGV A;  3L70 E;  2QA4 P;  2BCC J;  3V2N A;  3HE5 A;  1PPJ E;  1AVY A;  1UIX A;  2O1K A;  3G6E P;  1NH4 A;  2H89 C;  1FDI A;  1RF1 C;  2P10 A;  1LTT C;  1S2E A;  5AVR B;  1G2C B;  5TJH A;  4I2L C;  2QJY B;  2M8R A;  3BAS A;  5AW8 B;  5CBN A;  1ZR2 A;  4XA4 A;  2QEX P;  1VQ9 P;  1OWA A;  4ZNC A;  5AVY B;  2M5A A;  3HE4 A;  4N78 D;  1OX3 A;  4KT0 J;  3H1I D;  2JWA A;  4BRY B;  4GOE A;  1YI2 P;  1X9V A;  1X22 A;  2O3J A;  4HH2 A;  4K35 A;  4Y99 C;  3IN6 A;  2BEQ D;  3ITK A;  2Y0C A;  1OMI A;  3KZI E;  3T97 A;  1U7J A;  3L75 J;  4RES B;  1BE3 J;  1SQP K;  3OW2 O;  2GA1 A;  4Y99 B;  3BCC D;  3B5N A;  5KLV G;  3RK2 B;  1YIT P;  2KLV A;  3F5H A;  5KKZ C;  1FZC B;  1EC5 A;  1L2P A;  3AEF C;  3G4S P;  3FX0 A;  3M0D A;  1G1I A;  1LGH B;  2WSE J;  2KIK A;  4GOF A;  4AYC A;  1MV8 A;  5KKZ B;  1IFM A;  3EQ2 A;  1HTL C;  3PLN A;  1VQ5 P;  2AEJ A;  1K9M Q;  2W6B A;  3VMZ A;  3H6P A;  1KQF B;  1KYO I;  1N7S C;  3Q5R A;  3C1L A;  2Y9Y A;  1SQV K;  1Y9B A;  3N7N A;  1HF9 A;  5KLV D;  3M06 A;  3H1J D;  3H1I E;  3MD0 A;  4WVZ A;  1CSB A;  2HG5 D;  2NPS C;  3A0H E;  5APY A;  2H88 C;  1Q7Y Q;  3G3Z A;  1EQ7 A;  2WZ7 A;  3KHU A;  3MIW A;  1FJP A;  1D7M A;  1E79 H;  1NU1 G;  1URQ C;  2WPQ A;  2CPB A;  5KJ7 C;  2NPS B;  3AEA C;  4JBZ A;  3P32 A;  4RJT A;  4I1L A;  4XE5 B;  3KDP B;  2E75 D;  1M1J B;  2B87 A;  2N1T A;  3RGU A;  1H88 A;  2ZXE B;  1SQQ E;  4XFJ A;  1FZG A;  2OYH C;  1USE A;  3M9Q A;  2CK3 H;  2NRG A;  1USD A;  2IZ0 A;  3WMM 0;  5B5E H;  1M1J C;  1EDI A;  3O8Z A;  1L0N E;  3AE8 C;  3CXH E;  4RKU J;  1YQ3 C;  5GTI E;  3BRV B;  4JYC A;  1H0T B;  1FDM A;  5KJ7 D;  1N73 C;  2ZYA A;  1KMI Z;  3H25 A;  1RF1 B;  1KQS O;  4AUW A;  3PP5 A;  1LTG C;  2BAS A;  1NTM K;  2JDI H;  4Z1M H;  3B4S A;  1SQX D;  2E74 B;  1KOR A;  3L70 G;  3V2P A;  2N1T D;  4WY4 B;  3CPW O;  2Z4E A;  1PV3 A;  2QJK B;  1JTH A;  2FYU J;  3RL0 g;  1KIL B;  5CBO A;  5AVZ B;  3M0A A;  3L74 G;  2IX7 C;  5CCH A;  4WY4 C;  1KN7 A;  2D2C B;  3A3Y B;  3CWB D;  1J2J B;  1SQV D;  3L75 G;  3NXS A;  1SVF A;  2Z5I A;  2O01 H;  4OGQ B;  3L71 G;  2L91 A;  3VMY A;  1LWU B;  1IFP A;  2RH0 A;  3FXE A;  2CPS A;  3TGU E;  1FZE A;  1WMK A;  1HBW A;  2A06 G;  4OGQ C;  2KOG A;  1A02 F;  1OZH A;  3B71 A;  1IC2 A;  1NGM B;  1ZN5 A;  1EXJ A;  1EDL A;  1KYO D;  4L73 A;  2E75 C;  2Y0D A;  3P8C E;  4IL6 E;  3CCV P;  5CCH D;  3GLM A;  2IFM A;  1NTK D;  3R4Y A;  1BDD A;  1OW6 A;  1SQV G;  1JOC A;  1JEK A;  1PPJ G;  2B88 A;  2FXO A;  2YMK A;  3KPE A;  1L0N K;  3L70 J;  2E75 B;  4H13 C;  4NPF X;  1FZB A;  2E5T A;  1URQ B;  4PV1 D;  2FYN C;  2QJY C;  2NPS D;  3HE5 B;  2WSC J;  3OAK A;  2Q1K A;  1YHQ P;  1PGO A;  2R32 A;  3HRN A;  4W7Z A;  1FOS F;  1LTA C;  3MZW B;  2E76 D;  2ZT9 D;  4NPE A;  1U7M A;  2YNY A;  1LTJ B;  1LT9 B;  4WWI A;  1YTZ T;  3H1L J;  5B66 H;  2C9N Y;  2E42 A;  1IFN A;  1JY2 P;  2J5U A;  3HD7 B;  1FAV A;  4EIJ A;  2K88 A;  1KFM A;  2M5A B;  1LTJ C;  1LT9 C;  2WVR A;  3HE4 B;  3M9H A;  4MN4 C;  2WTY A;  1PFI A;  2WSF J;  3CX5 E;  3H1H D;  1PP9 J;  1VQP P;  1L4A C;  1SQX K;  1JMM A;  3AE1 C;  5APV A;  1YQ4 C;  2P2U A;  2ZXX A;  3SWY A;  1AV1 A;  1KYO E;  2KB7 P;  5KAI H;  4JPZ B;  1JO5 A;  4W7Y A;  1NTK E;  1AQ5 A;  1GL2 C;  1W5C E;  1OFC X;  3L72 J;  1YTZ I;  4C7R A;  3P8M C;  3JSV C;  1KYO H;  1N7S B;  5CJ0 A;  1EZV D;  3W67 A;  2I8D A;  2V7Q J;  4UB6 E;  2OYI A;  1OXZ A;  2P7J A;  3CC4 P;  2FYU G;  1LWU C;  2JKV A;  1LTS C;  1Y8A A;  2ZT9 B;  3EWK A;  1NJI Q;  2QSI A;  1K73 Q;  1RE4 A;  1KB9 E;  1J1D B;  1KQG B;  2IBZ E;  1OW7 A;  1VF5 C;  3CX5 H;  2OTK E;  1OVU A;  2Q5U A;  2QJP B;  2YKP A;  2ZT9 C;  2ZVN B;  3A2A A;  3L35 A;  1S9K D;  1AVO A;  3VYI A;  2YO2 A;  3VMX A;  2KP8 A;  2WSC H;  1NU1 K;  3EFF K;  3L71 J;  3SWF A;  3Q3D A;  1RY3 A;  3CX5 D;  4ASW A;  2NZ2 A;  4Y28 J;  1VQ7 P;  3L73 E;  3ABV C;  3VP9 A;  2IBZ I;  4I6M C;  4NPD A;  4YPC A;  1PGJ A;  2N9Y B;  5E79 E;  1L0L J;  1ZOY C;  2ZJS E;  5K5G B;  1R5L A;  1DEE G;  2GUV A;  2YMY A;  1N8R Q;  2OYH B;  3JCU H;  4HB1 A;  3D6Y A;  2N9B A;  2KNC B;  1S5L H;  3L72 G;  1VPC A;  3N4X A;  2M3E A;  3TNU A;  2GM4 A;  3AE3 C;  3BVH A;  3CCJ P;  3CC2 P;  1NTK K;  1EZV E;  4CPG A;  5M1B A;  2JJL A;  3HD7 C;  4PD4 E;  2KZJ A;  4W80 A;  4YTP C;  2FXP A;  1JY3 P;  4OVN F;  1BCC G;  3RK3 D;  4R4M A;  1BGY D;  1ZLL A;  1KB9 D;  3CME P;  2IBZ D;  1WT6 A;  1KIL C;  1VQN P;  4C7N A;  1S9K E;  2M0B A;  1NVO A;  1QVF O;  1RF1 A;  5KJ7 A;  4D6T G;  1L4A D;  2L5G B;  1M7L A;  2HR3 A;  3H1J G;  2O01 J;  1GL2 B;  2KYV A; 
#chains in the Genus database with same CATH homology
 2BCC G;  4PD4 H;  1L0L G;  3CWB G;  1BE3 G;  3H1L G;  1NTZ G;  1BGY G;  3L72 G;  1PPJ G;  1SQV G;  3H1I G;  1L0N G;  4U3F G;  3L70 G;  1PP9 G;  3L73 G;  1KYO H;  1SQQ G;  3TGU G;  1NTM G;  2FYU G;  3BCC G;  3L74 G;  3H1K G;  1BCC G;  1NTK G;  1NU1 G;  1SQP G;  3CX5 H;  3L75 G;  3H1H G;  5KLV G;  3L71 G;  1EZV G;  1P84 H;  2IBZ G;  3CXH H;  4D6T G;  1KB9 H;  1SQB G;  1SQX G;  3H1J G;  2A06 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...