1KB9I

Yeast cytochrome bc1 complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
55
structure length
55
Chain Sequence
SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
total genus 16
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1kb9I00
1SQXJ 3CXHI 1P84I 5KLVJ 3BCCJ 1SQBJ 3H1IJ 1NTZJ 4PD4I 3H1LJ 1SQQJ 4U3FJ 1L0LJ 2BCCJ 1NU1J 3L72J 3TGUJ 3L71J 1NTKJ 3H1JJ 1PP9J 3H1HJ 3L70J 3H1KJ 1SQVJ 2IBZI 4D6TJ 1KYOI 1BGYJ 1BCCJ 1KB9I 3CWBJ 1NTMJ 2FYUJ 3L75J 3CX5I 1BE3J 3L73J 1SQPJ 1EZVI 3L74J 1L0NJ
chains in the Genus database with same CATH superfamily
1GMJA 1NTZD 5H2FH 2E42A 2H89C 2AXTH 4IFMA 1S5LX 4EDFA 3V5BA 3JSVC 1EQ7A 5M1BA 1RHZB 2R3SA 3L74J 3BVHA 1JTHB 5APUA 2ZVNB 1ZW0A 2BEQD 4D6TG 3HRNA 3MHVA 3PRJA 3BRVB 2E5YA 1BE3D 2FFDC 1GW4A 1AVOA 1FBMA 3GHGC 1EZVI 2M3BA 3G71P 1GW3A 4TLFA 3C1LA 5CHXA 5AVWB 3CLQA 2JKVA 1SQBK 1FZCA 1OZHA 1QGKB 2HODA 2KZJA 1FDMA 1LTGC 3KYQA 3II6A 3H1KG 3VMXA 3WUVA 3H32A 1J1EB 2YIUB 1VQLP 1YYCA 1NU1K 3U1AA 1NTKK 3CWBJ 5KLVG 5C39A 2K3RA 2E75B 5AW9B 1Q86Q 1RF0A 3H1IJ 3TGUD 1LGHB 4BRYB 4U3FJ 2BCCJ 1QL2A 1JO5A 4C7RA 3D6ZA 2XNDH 2L5GB 3C8VA 2GM4A 1GL2B 1LT9A 1WRGA 2OARA 2P67A 2NPSD 5AVQB 3BCCJ 3AE5C 2N1TA 1PIXA 2KS1B 2WT7A 1VQ9P 1RF1C 1SQXK 1N73B 1DH3A 3L73D 2R5BA 3S4RA 4EIJA 1NO4A 1IJDB 3CXHE 3OW2O 2AXCA 3ZDMA 1SQQD 1PPJD 4NPFX 1SFCD 3WU2H 3IN6A 2PGDA 1G1IA 2H43A 5CJ4A 3M0DC 3B4SA 2I8DA 1P84H 1BSNA 3B5NB 4PD4H 4N78D 4EI2A 3P8MC 1HUCA 1USEA 3L72D 1EDJA 4GOEA 2P1JA 4ZKUA 3L71E 1JMMA 1NU1J 1NTKJ 2RN0A 1HGVA 4D6TD 5APSA 3TF5A 4H0LD 2G3AA 1JMBA 2OYHB 2W6JH 2YXRB 1SQPE 3P8CD 2W90A 3Q2YA 1SFCC 1K9MQ 1KILC 3RK2B 3HE5A 1M1JC 1H8AA 2ZT9B 1YJNP 5AW1B 2L91A 5B5EH 1N7SD 3AEBC 2K37A 5KAIH 5B5EE 2E74B 5KAIE 1GU4A 2QG4A 1HH0A 1KTMA 1YTZT 1SQXJ 3CCVP 5AVXB 3E7KA 1ZRTE 1IK9A 3L71J 2K1AA 2QJPC 2HPCB 1SQVE 2FXMA 1CSBA 1RH5B 2M5AB 2W8ZA 2YO2A 1VQPP 5AVRB 1A02F 2A45H 1QEXA 2KNCB 2WSFH 1JUNA 1N2DC 3H1JE 2OYIC 4LGDE 1LWUB 1JOCA 3V2QA 1KYOH 2O01J 1JY2P 1KYOE 2CPBA 1VQMP 3L74D 1L0NE 2HG5D 3LW5J 1VL2A 1R5SA 3MP7B 2K9JA 1NAFA 4C7NB 2Y9YA 3JCUH 1Q81Q 3O6QA 1DIPA 2P10A 3AE1C 2R3CA 2W6AA 1G1JA 1SQVJ 1HJBA 1J1DC 2QJYC 2R5DA 3SWYA 1LP1A 4RO0A 2M8RA 1ZP0C 3CCQP 1L4AA 3Q3DA 1FZEA 1ZR2A 1S9KD 3L70J 1G2CA 1W2BO 1YTZI 1MFZA 4AQRD 4BWNA 5BU5A 1A02J 2WVRA 3L71G 3HUSA 5KLIB 3VYIA 3HE4B 1T3UA 5AW4B 3KHUA 4H44C 2IBZI 3CWBD 1S2EA 1SQPG 1S72P 2KB7P 2FYNC 3H25A 1HWTC 5AW2B 3H1ID 1LTTC 4U3FD 3G4SP 2FXOA 1N7LA 2BCCD 1W2EA 1EC5A 1T8ZA 5APVA 2JR8A 2OTLP 4I7ZC 1VQ8P 3VTPC 1JEKA 3VN0A 1RE4C 3L75J 2AEMA 4I1LA 1LTJA 3BCCD 1FZCB 1NYHA 4YXDC 1KQSO 3PLNA 3AEEC 2HODB 4ZNCA 2OQQA 2IZ0A 1SQVG 4K3AA 1X0TA 1X79B 5CCGD 5AW7B 3H32B 1NTME 5BU8B 2OTKE 3CD6P 3KXDA 4EYYQ 4UB8H 2KOGA 4L73A 3H1JG 1SQBD 2YNYA 4H13C 4UB8E 3I55P 3M06A 3OAKA 1NOHA 3VP9A 1KILE 2OTJP 4OVNF 3V6IA 4DJGA 1L0NG 1IC2A 1QX8A 3Q5RA 2FFDA 5GTIE 1PGJA 4W80A 1R5LA 1LT9B 1N86A 3BATA 1NU1D 1NTKD 2WPRA 2XDJA 3M9HA 5KLVK 2N1TB 2E75D 2KI7B 2WT7B 1M57D 1LT1A 2XU6A 2Z4EA 4EOTA 3R2PA 1VQ5P 1K05A 3C9IA 3MUDC 2Y0EA 2N9YB 2D2CD 1GL2D 1SP4A 2KSEA 4I6MC 1EZVE 1OFCX 1JCDA 1SQXD 2JWAA 1KD1Q 4MN4C 2ITAA 2Q3IA 3VMAA 2KLVA 1J1EC 3AECC 2V7QH 1Y47A 2JP3A 2ZAEB 4M3LA 2WSSH 2HFED 2Q9IA 4PV1D 1PV3A 3GF3A 2WSEH 4BXLA 4I2LC 2D2CC 1GL2C 3N7NA 1GDTA 1PP9E 3R4YA 1GK6A 3B5ND 1NKZB 3W67A 3HE5B 1BGYE 3GMAA 5KKZB 3TNUB 3CC2P 3FXDA 2A06D 2MKVA 3RK3B 5KLVJ 2YKOA 2GUSA 1JB0J 2ZYDA 2JEEA 1X22A 4PV1C 5H2FE 2AXTE 2QRXA 3M0DA 5B66H 3CCEP 1X9VA 1OW8A 3S9OA 1Z56A 1YI2P 3HD7C 1YHQP 1EXIA 2ZT9D 4OGQB 3V2RA 1KC8Q 2FYZA 4Y99B 3B5NC 4GOFA 3L70D 2E74D 3PTZA 2RKLA 3RK3E 1VF5D 1EDLA 1SFCA 1FZBA 3CPWO 2ZJSE 2IYOA 1KILA 1NHLA 4L74A 2K9JB 4HKZH 3O6QB 4WY4D 2FYUE 2K88A 1NWQA 4HJGH 1FJPA 4IOIH 5KJ7A 2LR2A 3NTNA 4PJ0H 1LP1B 3NMDA 3K5BA 2HR3A 3IR9A 2KSJA 1EZVG 5AVUB 1L4AB 5CBOA 1AJYA 3L75D 1VF5C 2O01N 1ZR4A 2I1KA 1G2CB 1NAYA 1FZFA 2YMKA 5CBNA 2WTYA 3H1HE 5CCHD 1HGZA 4JF7A 2OYIA 1VPCA 2FBWC 5AVZB 4WY4C 1T3JA 3CX5D 3ITKA 1XTCC 1JY3N 2VRSA 1PP9G 4ZMDA 1BGYG 2SPZA 2KIKA 3SFEC 3A0HH 1WMKA 1BCCE 2H88C 3GW6A 5APYA 2I1JA 1OX3A 5CCHC 1LTJB 3EFFK 4DCKA 1SQPK 3H1HJ 3WU2E 3IF4A 1FAVA 1OMIA 1M7LA 1P84E 2NPSC 1VQ6P 4PD4E 3RBXA 3H1LE 3LIDA 1IO4A 1OW7A 2UWJE 1USDA 2QIWA 2WPQA 2RH0A 1BCCJ 1CZQA 2NZ2A 1U7JA 1LNQA 4KHXA 1SQVK 3AE7C 2FFDB 1VQOP 1PGOA 3IFMA 1FE6A 2FYUG 3CCMP 1EDKA 1N8RQ 1H89A 2C0WA 4GDOA 1RE4A 2FXPA 3I5CA 4GKGA 2HLOA 3P32A 1L0LE 5AVYB 1X8YA 3H1LJ 1NH4A 1L0NK 2IBZE 3H1KD 1IFDA 5AW3B 4H0LC 2O1KA 3FWLA 3EQ2A 2WWWA 1E5WA 1SQPJ 5KLVD 2Q7CA 1NTZE 1OXZA 3G3ZA 3H1HG 4HB1A 5TISH 1QLED 3CCJP 4CPGA 2BASA 4AUWA 1RQVA 3TK1A 3A2AA 3KQGA 2WMMA 1N7SC 2E43A 3B8EB 1JTHA 1VDFA 1YBKA 1URQD 2Z5IA 3WUTA 3IAOA 2P2UA 2GUVA 1EDIA 3JCUE 1BCCG 3E1IA 1KB9D 2JO1A 1XTGB 1BE3E 1ZLLA 2IPPA 4JBZA 1DD3A 1SVFA 3MUDA 2LXBA 3H1JJ 1AA0A 2PRRA 4YTPC 2WSFJ 2JDIH 2QA4P 2Q5UA 1URQC 5EFWB 2XZRA 3H1LG 1ZN5A 1L0NJ 2QJKB 3EFGA 2R32A 1UIIA 3A5TA 2E76D 1U57A 1KN7A 2CPSA 3CMEP 3P7KA 4N3YB 2POHA 2B87A 4IFDK 2ZXXA 3TGUE 1GL2A 4KT0J 1NTMK 2KUBA 5AW6B 1H88A 4IL6H 3CX5H 2Z5HA 4IL6E 1KILB 1SLQA 1YJWP 5AVVB 3PHLA 2W27A 2KS1A 3G9RA 1L0LG 2E76C 1RE3C 3AEGC 2IBZG 1IZNB 3TSIA 5KKZC 4AYCA 2PFXA 3V2PA 3M9QA 1GTWA 2FKWB 2QJPB 3KDPB 2XV5A 3L73E 1NTZG 1K04A 4UB6H 1YQ4C 3HD7A 2A45G 1Y8AA 3FX0A 2RMZA 1PPJE 3M91A 2V4HA 3B5NA 5TJHA 2OYIB 4IFFA 1JCCA 3AE9C 4N78E 1KZUB 2YXQB 4NPDA 3GHGA 1Y9BA 3L72E 4B86A 1CI6A 1SS1A 2OYOA 1IFNA 3PP5A 1ZXGA 2B89A 4D6TE 1BE3G 1M1KQ 5CCGC 3M9BA 5CJ0A 1H0TA 1K8AQ 5GTHH 3KZIH 3CXHD 1NTMJ 3L73J 3FXEA 3P8CE 1HTLC 2ZYGA 2WPVB 4ASWA 1J1DB 2QJYB 5AVTB 3D70A 3CCUP 1OVUA 1HBWA 5APWA 1JY3P 1PGQA 2W6BA 1M8OB 1AQTA 2WSCH 3VP8A 5DJTB 4IL6X 1P84D 3CX5I 2G8YA 4Z1MH 3Q1MA 1KFNA 1MZ9A 2P58A 1UIXA 1YQ3C 2YIUC 2FY8A 1T2KD 3L71D 2E75C 1T6AA 4WY4A 2B88A 3NXSA 1SQPD 2J58A 1S3JA 4H44B 3TGUG 2FYNB 1DEBA 2IDBA 3U1CA 3OJAB 1RF1A 3BASA 1KQGB 1KFMA 3RL0B 3SWFA 3L74E 1W5CE 3O8ZA 1T2KC 4RJTA 1ZRTD 1FDOA 5CCHA 1N73C 1OWAA 1KB9H 5E79H 2IYPA 3CC4P 1SQVD 2V7QJ 3SFDC 1NTMG 1CW5A 3L73G 3D6YA 1E79H 3USSA 5B66E 1FDIA 1PPJG 2IFNA 3RK2D 2NPSA 4JPZB 4A7PA 2AEFA 3AE4C 3H1JD 1KQFB 3Q5SA 2FYUK 2WSEJ 3CCSP 4C46A 2GA1A 4WWIA 1PP9J 1S9KE 4H13B 4HYTB 3S1KA 2MJZA 1M90Q 1BGYJ 1KYOD 3E1RA 3L37A 4DT0A 2IZ1A 3HE4A 1L0ND 3L72G 4RKUJ 3L35A 5BVZA 2OYHC 1M1JA 2NRGA 2OGUA 3ABVC 3TYYA 4GT1A 3CWBE 4W7ZA 5AVSB 3MIWA 3AE8C 2Y0DA 1HJ0A 5AW8B 3RK2C 3L36A 1WT6A 3HTKA 2ZT9C 3H1IE 1Q90D 4U3FE 2BCCE 4L76A 4PJ0E 3GG2A 2E74C 1IK7A 3V4WA 3M0AA 2QVAA 1Q82Q 1OIPA 5APTA 2H7HA 3CC7P 3B71A 3G6EP 2DW3A 3BCCE 2QM7A 1FC2C 5KAFH 1MV8A 3AEFC 5KAFE 1KMIZ 3HUSB 4Y28J 1R8EA 1N7SA 1KB9I 3CCLP 2FYUJ 2XNXA 3AEDC 3D71A 1LWUC 2YO3A 1S1CX 4LC1A 1JY3O 1SQBE 1VQ4P 1VQ7P 2XKMA 2B87B 1PFIA 2IFMA 2J59M 2D2CB 1AV1A 3L74G 2IX7C 1MUUA 3A0HE 3QH9A 1DD4A 2O3JA 3AE2C 3V4QA 1NU1E 1NTKE 3MZWB 1MFTA 2O1JA 1JM0A 1IFMA 2KP8A 2KYVA 1OVVA 1RQUA 3RBZA 1M56D 3CXHH 1DEEG 1YJ9P 1NTMD 1URQA 4PV1B 1YIJP 3TDKA 3H6PA 1YITP 1SQBJ 3A7OA 1KILD 2QEXP 5CMZA 3HD7B 2C9LY 2QJKC 5K5GB 1ZOYC 3PJSK 1L0LK 5KLIC 2Y9ZA 4DZOA 1SQXE 5KJ7D 1HVVA 2ZXEB 2WZ7A 3A0BH 2AEJA 3GHGB 3NFQA 1PZQA 3CWBG 3A0BE 4XE5B 2YMYA 1NTZK 2CK3H 1CI6B 3N4XA 4JYBA 3WUUA 3H1IG 4U3FG 2BCCG 4GIFA 3SWKA 3T97A 1RE3A 1H0TB 1LJ2A 4DOJA 4K35A 4KJMA 4TT3H 2WITA 4ASVA 2O01H 3TNUA 1VQNP 1KORA 4YXWH 1FZCC 4YPCA 4L75A 3LW5H 1AVYA 1EZVD 3BCCG 2KXPB 5KJ7C 2A06E 1VF5B 1TU3F 3W68A 2ZYAA 2BEZF 2J5UA 2N1TD 5TISE 3F5HA 2B9BA 2C9NY 2H8PD 2M0BA 4WBAA 1AQ5A 5APQA 1SQBG 1NKNA 2ZFCA 4WY4B 1RF0C 3CXHI 3AEAC 4WB4A 1PP9D 1L0LJ 3L70E 1NVOA 2P7JA 3I56P 1IFJA 1BGYD 4HH2A 3A3YB 5CCGA 1LT9C 3KPEA 1RF1B 2KLUA 1NU1G 3RL0g 1NTKG 1P84I 2N1TC 4PD4I 1NTZJ 1GK4A 4W7YA 2ZVOB 1LTIC 3MD0A 1D7MA 1IFIA 2PAJA 1S4XA 4H44D 3WMM0 5APXA 3AE3C 2YKPA 3MTUE 4R4LA 2NPSB 1BDCA 3RL0D 4NPEA 3QWOC 4JYCA 4WVZA 4XA4A 1SQXG 5L8RJ 1OW6A 3L75E 2R44A 3JC22 3RK3D 4BRYA 2KK7A 1BE3J 2QSIA 2JJLA 1GZLA 4XFJA 5DJUB 1QVGO 1Q7YQ 1SFCB 3CCRP 2LKMA 1IFPA 3FWNA 1SQQK 3OA7A 3CX5E 4ZKPA 1PL5A 2FYUD 1M1JB 1AFOA 1LTBC 4OGQD 3CL3D 1NGMB 3F89A 2K9YA 2HYNA 4H13D 3HTKB 1ZV8A 4N6JA 3RL0C 1N73A 2A45I 4OWFA 1EXJA 2W83C 2Y0CA 1GU5A 2A06G 3RK3C 3V2NA 3U59A 3VMZA 1BSHA 4H0LB 1KYOI 4OH8B 1SQQE 4UB6E 4JQ0D 4GODA 1U7MA 3H1HD 3TGUJ 3PH0A 3VOPA 2PP6A 4OGQC 2Q1KA 4QMAA 4Y99C 1GD2E 1N7SB 1KQLA 5KTBA 1FZAA 3L70G 1QVFO 1FU1A 2WPSA 2OYHA 1L4AD 5AW5B 2N9BA 1FOSF 1BCCD 2KZIA 2Q6QA 1JNMA 5GTIH 5AW0B 2M3EA 1PGPA 1HF9A 1MKMA 1LTAC 3SSUA 5GTHE 3KZIE 1S5LH 2E5TA 1S5LE 1SQQJ 3Q5PA 1L2PA 1FOSE 3AE6C 2LXCB 3UIAA 2C0XA 2YKQA 3VMYA 2QM8A 4PD4D 4LLHA 2HPCA 1URQB 3H1LD 1BDDA 1FS0E 1JY2N 1JY2O 1FJKA 1L4AC 1KV4A 3L72J 3MGNA 3FGAD 2M5AA 3H1KE 3CI9A 3L75G 1K73Q 1VQKP 4D6TJ 1J2JB 2KNCA 2JWDA 3GF7A 4U7JA 1LWUA 3LIEA 5KLVE 3HUSC 1NJIQ 3L4FA 4O9BA 3BRTB 1ZMEC 1LTSC 3GLMA 2Q3EA 2QE7H 3RGUA 3EWKA 2WQYC 4C7NA 1Q2NA 2WSCJ 4R4MA 1OVRA 4I7ZB 3HD7D 1L0LD 1FZGA 3CMAP 2E76B 1RY3A 3T97B 2IBZD 3H1KJ 1KB9E 5E79E 1QL1A 1LTJC 1DX7A 1SQQG 4RESB
chains in the Genus database with same CATH topology
1SQXJ 3CXHI 1P84I 5KLVJ 3BCCJ 1SQBJ 3H1IJ 1NTZJ 4PD4I 3H1LJ 1SQQJ 4U3FJ 1L0LJ 2BCCJ 1NU1J 3L72J 3TGUJ 3L71J 1NTKJ 3H1JJ 1PP9J 3H1HJ 3L70J 3H1KJ 1SQVJ 2IBZI 4D6TJ 1KYOI 1BGYJ 1BCCJ 1KB9I 3CWBJ 1NTMJ 2FYUJ 3L75J 3CX5I 1BE3J 3L73J 1SQPJ 1EZVI 3L74J 1L0NJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQX J;  3CXH I;  1P84 I;  5KLV J;  3BCC J;  1SQB J;  3H1I J;  1NTZ J;  4PD4 I;  3H1L J;  1SQQ J;  4U3F J;  1L0L J;  2BCC J;  1NU1 J;  3L72 J;  3TGU J;  3L71 J;  1NTK J;  3H1J J;  1PP9 J;  3H1H J;  3L70 J;  3H1K J;  1SQV J;  2IBZ I;  4D6T J;  1KYO I;  1BGY J;  1BCC J;  1KB9 I;  3CWB J;  1NTM J;  2FYU J;  3L75 J;  3CX5 I;  1BE3 J;  3L73 J;  1SQP J;  1EZV I;  3L74 J;  1L0N J; 
#chains in the Genus database with same CATH topology
 1GMJ A;  1NTZ D;  5H2F H;  2E42 A;  2H89 C;  2AXT H;  4IFM A;  1S5L X;  4EDF A;  3V5B A;  3JSV C;  1EQ7 A;  5M1B A;  1RHZ B;  2R3S A;  3L74 J;  3BVH A;  1JTH B;  5APU A;  2ZVN B;  1ZW0 A;  2BEQ D;  4D6T G;  3HRN A;  3MHV A;  3PRJ A;  3BRV B;  2E5Y A;  1BE3 D;  2FFD C;  1GW4 A;  1AVO A;  1FBM A;  3GHG C;  1EZV I;  2M3B A;  3G71 P;  1GW3 A;  4TLF A;  3C1L A;  5CHX A;  5AVW B;  3CLQ A;  2JKV A;  1SQB K;  1FZC A;  1OZH A;  1QGK B;  2HOD A;  2KZJ A;  1FDM A;  1LTG C;  3KYQ A;  3II6 A;  3H1K G;  3VMX A;  3WUV A;  3H32 A;  1J1E B;  2YIU B;  1VQL P;  1YYC A;  1NU1 K;  3U1A A;  1NTK K;  3CWB J;  5KLV G;  5C39 A;  2K3R A;  2E75 B;  5AW9 B;  1Q86 Q;  1RF0 A;  3H1I J;  3TGU D;  1LGH B;  4BRY B;  4U3F J;  2BCC J;  1QL2 A;  1JO5 A;  4C7R A;  3D6Z A;  2XND H;  2L5G B;  3C8V A;  2GM4 A;  1GL2 B;  1LT9 A;  1WRG A;  2OAR A;  2P67 A;  2NPS D;  5AVQ B;  3BCC J;  3AE5 C;  2N1T A;  1PIX A;  2KS1 B;  2WT7 A;  1VQ9 P;  1RF1 C;  1SQX K;  1N73 B;  1DH3 A;  3L73 D;  2R5B A;  3S4R A;  4EIJ A;  1NO4 A;  1IJD B;  3CXH E;  3OW2 O;  2AXC A;  3ZDM A;  1SQQ D;  1PPJ D;  4NPF X;  1SFC D;  3WU2 H;  3IN6 A;  2PGD A;  1G1I A;  2H43 A;  5CJ4 A;  3M0D C;  3B4S A;  2I8D A;  1P84 H;  1BSN A;  3B5N B;  4PD4 H;  4N78 D;  4EI2 A;  3P8M C;  1HUC A;  1USE A;  3L72 D;  1EDJ A;  4GOE A;  2P1J A;  4ZKU A;  3L71 E;  1JMM A;  1NU1 J;  1NTK J;  2RN0 A;  1HGV A;  4D6T D;  5APS A;  3TF5 A;  4H0L D;  2G3A A;  1JMB A;  2OYH B;  2W6J H;  2YXR B;  1SQP E;  3P8C D;  2W90 A;  3Q2Y A;  1SFC C;  1K9M Q;  1KIL C;  3RK2 B;  3HE5 A;  1M1J C;  1H8A A;  2ZT9 B;  1YJN P;  5AW1 B;  2L91 A;  5B5E H;  1N7S D;  3AEB C;  2K37 A;  5KAI H;  5B5E E;  2E74 B;  5KAI E;  1GU4 A;  2QG4 A;  1HH0 A;  1KTM A;  1YTZ T;  1SQX J;  3CCV P;  5AVX B;  3E7K A;  1ZRT E;  1IK9 A;  3L71 J;  2K1A A;  2QJP C;  2HPC B;  1SQV E;  2FXM A;  1CSB A;  1RH5 B;  2M5A B;  2W8Z A;  2YO2 A;  1VQP P;  5AVR B;  1A02 F;  2A45 H;  1QEX A;  2KNC B;  2WSF H;  1JUN A;  1N2D C;  3H1J E;  2OYI C;  4LGD E;  1LWU B;  1JOC A;  3V2Q A;  1KYO H;  2O01 J;  1JY2 P;  1KYO E;  2CPB A;  1VQM P;  3L74 D;  1L0N E;  2HG5 D;  3LW5 J;  1VL2 A;  1R5S A;  3MP7 B;  2K9J A;  1NAF A;  4C7N B;  2Y9Y A;  3JCU H;  1Q81 Q;  3O6Q A;  1DIP A;  2P10 A;  3AE1 C;  2R3C A;  2W6A A;  1G1J A;  1SQV J;  1HJB A;  1J1D C;  2QJY C;  2R5D A;  3SWY A;  1LP1 A;  4RO0 A;  2M8R A;  1ZP0 C;  3CCQ P;  1L4A A;  3Q3D A;  1FZE A;  1ZR2 A;  1S9K D;  3L70 J;  1G2C A;  1W2B O;  1YTZ I;  1MFZ A;  4AQR D;  4BWN A;  5BU5 A;  1A02 J;  2WVR A;  3L71 G;  3HUS A;  5KLI B;  3VYI A;  3HE4 B;  1T3U A;  5AW4 B;  3KHU A;  4H44 C;  2IBZ I;  3CWB D;  1S2E A;  1SQP G;  1S72 P;  2KB7 P;  2FYN C;  3H25 A;  1HWT C;  5AW2 B;  3H1I D;  1LTT C;  4U3F D;  3G4S P;  2FXO A;  1N7L A;  2BCC D;  1W2E A;  1EC5 A;  1T8Z A;  5APV A;  2JR8 A;  2OTL P;  4I7Z C;  1VQ8 P;  3VTP C;  1JEK A;  3VN0 A;  1RE4 C;  3L75 J;  2AEM A;  4I1L A;  1LTJ A;  3BCC D;  1FZC B;  1NYH A;  4YXD C;  1KQS O;  3PLN A;  3AEE C;  2HOD B;  4ZNC A;  2OQQ A;  2IZ0 A;  1SQV G;  4K3A A;  1X0T A;  1X79 B;  5CCG D;  5AW7 B;  3H32 B;  1NTM E;  5BU8 B;  2OTK E;  3CD6 P;  3KXD A;  4EYY Q;  4UB8 H;  2KOG A;  4L73 A;  3H1J G;  1SQB D;  2YNY A;  4H13 C;  4UB8 E;  3I55 P;  3M06 A;  3OAK A;  1NOH A;  3VP9 A;  1KIL E;  2OTJ P;  4OVN F;  3V6I A;  4DJG A;  1L0N G;  1IC2 A;  1QX8 A;  3Q5R A;  2FFD A;  5GTI E;  1PGJ A;  4W80 A;  1R5L A;  1LT9 B;  1N86 A;  3BAT A;  1NU1 D;  1NTK D;  2WPR A;  2XDJ A;  3M9H A;  5KLV K;  2N1T B;  2E75 D;  2KI7 B;  2WT7 B;  1M57 D;  1LT1 A;  2XU6 A;  2Z4E A;  4EOT A;  3R2P A;  1VQ5 P;  1K05 A;  3C9I A;  3MUD C;  2Y0E A;  2N9Y B;  2D2C D;  1GL2 D;  1SP4 A;  2KSE A;  4I6M C;  1EZV E;  1OFC X;  1JCD A;  1SQX D;  2JWA A;  1KD1 Q;  4MN4 C;  2ITA A;  2Q3I A;  3VMA A;  2KLV A;  1J1E C;  3AEC C;  2V7Q H;  1Y47 A;  2JP3 A;  2ZAE B;  4M3L A;  2WSS H;  2HFE D;  2Q9I A;  4PV1 D;  1PV3 A;  3GF3 A;  2WSE H;  4BXL A;  4I2L C;  2D2C C;  1GL2 C;  3N7N A;  1GDT A;  1PP9 E;  3R4Y A;  1GK6 A;  3B5N D;  1NKZ B;  3W67 A;  3HE5 B;  1BGY E;  3GMA A;  5KKZ B;  3TNU B;  3CC2 P;  3FXD A;  2A06 D;  2MKV A;  3RK3 B;  5KLV J;  2YKO A;  2GUS A;  1JB0 J;  2ZYD A;  2JEE A;  1X22 A;  4PV1 C;  5H2F E;  2AXT E;  2QRX A;  3M0D A;  5B66 H;  3CCE P;  1X9V A;  1OW8 A;  3S9O A;  1Z56 A;  1YI2 P;  3HD7 C;  1YHQ P;  1EXI A;  2ZT9 D;  4OGQ B;  3V2R A;  1KC8 Q;  2FYZ A;  4Y99 B;  3B5N C;  4GOF A;  3L70 D;  2E74 D;  3PTZ A;  2RKL A;  3RK3 E;  1VF5 D;  1EDL A;  1SFC A;  1FZB A;  3CPW O;  2ZJS E;  2IYO A;  1KIL A;  1NHL A;  4L74 A;  2K9J B;  4HKZ H;  3O6Q B;  4WY4 D;  2FYU E;  2K88 A;  1NWQ A;  4HJG H;  1FJP A;  4IOI H;  5KJ7 A;  2LR2 A;  3NTN A;  4PJ0 H;  1LP1 B;  3NMD A;  3K5B A;  2HR3 A;  3IR9 A;  2KSJ A;  1EZV G;  5AVU B;  1L4A B;  5CBO A;  1AJY A;  3L75 D;  1VF5 C;  2O01 N;  1ZR4 A;  2I1K A;  1G2C B;  1NAY A;  1FZF A;  2YMK A;  5CBN A;  2WTY A;  3H1H E;  5CCH D;  1HGZ A;  4JF7 A;  2OYI A;  1VPC A;  2FBW C;  5AVZ B;  4WY4 C;  1T3J A;  3CX5 D;  3ITK A;  1XTC C;  1JY3 N;  2VRS A;  1PP9 G;  4ZMD A;  1BGY G;  2SPZ A;  2KIK A;  3SFE C;  3A0H H;  1WMK A;  1BCC E;  2H88 C;  3GW6 A;  5APY A;  2I1J A;  1OX3 A;  5CCH C;  1LTJ B;  3EFF K;  4DCK A;  1SQP K;  3H1H J;  3WU2 E;  3IF4 A;  1FAV A;  1OMI A;  1M7L A;  1P84 E;  2NPS C;  1VQ6 P;  4PD4 E;  3RBX A;  3H1L E;  3LID A;  1IO4 A;  1OW7 A;  2UWJ E;  1USD A;  2QIW A;  2WPQ A;  2RH0 A;  1BCC J;  1CZQ A;  2NZ2 A;  1U7J A;  1LNQ A;  4KHX A;  1SQV K;  3AE7 C;  2FFD B;  1VQO P;  1PGO A;  3IFM A;  1FE6 A;  2FYU G;  3CCM P;  1EDK A;  1N8R Q;  1H89 A;  2C0W A;  4GDO A;  1RE4 A;  2FXP A;  3I5C A;  4GKG A;  2HLO A;  3P32 A;  1L0L E;  5AVY B;  1X8Y A;  3H1L J;  1NH4 A;  1L0N K;  2IBZ E;  3H1K D;  1IFD A;  5AW3 B;  4H0L C;  2O1K A;  3FWL A;  3EQ2 A;  2WWW A;  1E5W A;  1SQP J;  5KLV D;  2Q7C A;  1NTZ E;  1OXZ A;  3G3Z A;  3H1H G;  4HB1 A;  5TIS H;  1QLE D;  3CCJ P;  4CPG A;  2BAS A;  4AUW A;  1RQV A;  3TK1 A;  3A2A A;  3KQG A;  2WMM A;  1N7S C;  2E43 A;  3B8E B;  1JTH A;  1VDF A;  1YBK A;  1URQ D;  2Z5I A;  3WUT A;  3IAO A;  2P2U A;  2GUV A;  1EDI A;  3JCU E;  1BCC G;  3E1I A;  1KB9 D;  2JO1 A;  1XTG B;  1BE3 E;  1ZLL A;  2IPP A;  4JBZ A;  1DD3 A;  1SVF A;  3MUD A;  2LXB A;  3H1J J;  1AA0 A;  2PRR A;  4YTP C;  2WSF J;  2JDI H;  2QA4 P;  2Q5U A;  1URQ C;  5EFW B;  2XZR A;  3H1L G;  1ZN5 A;  1L0N J;  2QJK B;  3EFG A;  2R32 A;  1UII A;  3A5T A;  2E76 D;  1U57 A;  1KN7 A;  2CPS A;  3CME P;  3P7K A;  4N3Y B;  2POH A;  2B87 A;  4IFD K;  2ZXX A;  3TGU E;  1GL2 A;  4KT0 J;  1NTM K;  2KUB A;  5AW6 B;  1H88 A;  4IL6 H;  3CX5 H;  2Z5H A;  4IL6 E;  1KIL B;  1SLQ A;  1YJW P;  5AVV B;  3PHL A;  2W27 A;  2KS1 A;  3G9R A;  1L0L G;  2E76 C;  1RE3 C;  3AEG C;  2IBZ G;  1IZN B;  3TSI A;  5KKZ C;  4AYC A;  2PFX A;  3V2P A;  3M9Q A;  1GTW A;  2FKW B;  2QJP B;  3KDP B;  2XV5 A;  3L73 E;  1NTZ G;  1K04 A;  4UB6 H;  1YQ4 C;  3HD7 A;  2A45 G;  1Y8A A;  3FX0 A;  2RMZ A;  1PPJ E;  3M91 A;  2V4H A;  3B5N A;  5TJH A;  2OYI B;  4IFF A;  1JCC A;  3AE9 C;  4N78 E;  1KZU B;  2YXQ B;  4NPD A;  3GHG A;  1Y9B A;  3L72 E;  4B86 A;  1CI6 A;  1SS1 A;  2OYO A;  1IFN A;  3PP5 A;  1ZXG A;  2B89 A;  4D6T E;  1BE3 G;  1M1K Q;  5CCG C;  3M9B A;  5CJ0 A;  1H0T A;  1K8A Q;  5GTH H;  3KZI H;  3CXH D;  1NTM J;  3L73 J;  3FXE A;  3P8C E;  1HTL C;  2ZYG A;  2WPV B;  4ASW A;  1J1D B;  2QJY B;  5AVT B;  3D70 A;  3CCU P;  1OVU A;  1HBW A;  5APW A;  1JY3 P;  1PGQ A;  2W6B A;  1M8O B;  1AQT A;  2WSC H;  3VP8 A;  5DJT B;  4IL6 X;  1P84 D;  3CX5 I;  2G8Y A;  4Z1M H;  3Q1M A;  1KFN A;  1MZ9 A;  2P58 A;  1UIX A;  1YQ3 C;  2YIU C;  2FY8 A;  1T2K D;  3L71 D;  2E75 C;  1T6A A;  4WY4 A;  2B88 A;  3NXS A;  1SQP D;  2J58 A;  1S3J A;  4H44 B;  3TGU G;  2FYN B;  1DEB A;  2IDB A;  3U1C A;  3OJA B;  1RF1 A;  3BAS A;  1KQG B;  1KFM A;  3RL0 B;  3SWF A;  3L74 E;  1W5C E;  3O8Z A;  1T2K C;  4RJT A;  1ZRT D;  1FDO A;  5CCH A;  1N73 C;  1OWA A;  1KB9 H;  5E79 H;  2IYP A;  3CC4 P;  1SQV D;  2V7Q J;  3SFD C;  1NTM G;  1CW5 A;  3L73 G;  3D6Y A;  1E79 H;  3USS A;  5B66 E;  1FDI A;  1PPJ G;  2IFN A;  3RK2 D;  2NPS A;  4JPZ B;  4A7P A;  2AEF A;  3AE4 C;  3H1J D;  1KQF B;  3Q5S A;  2FYU K;  2WSE J;  3CCS P;  4C46 A;  2GA1 A;  4WWI A;  1PP9 J;  1S9K E;  4H13 B;  4HYT B;  3S1K A;  2MJZ A;  1M90 Q;  1BGY J;  1KYO D;  3E1R A;  3L37 A;  4DT0 A;  2IZ1 A;  3HE4 A;  1L0N D;  3L72 G;  4RKU J;  3L35 A;  5BVZ A;  2OYH C;  1M1J A;  2NRG A;  2OGU A;  3ABV C;  3TYY A;  4GT1 A;  3CWB E;  4W7Z A;  5AVS B;  3MIW A;  3AE8 C;  2Y0D A;  1HJ0 A;  5AW8 B;  3RK2 C;  3L36 A;  1WT6 A;  3HTK A;  2ZT9 C;  3H1I E;  1Q90 D;  4U3F E;  2BCC E;  4L76 A;  4PJ0 E;  3GG2 A;  2E74 C;  1IK7 A;  3V4W A;  3M0A A;  2QVA A;  1Q82 Q;  1OIP A;  5APT A;  2H7H A;  3CC7 P;  3B71 A;  3G6E P;  2DW3 A;  3BCC E;  2QM7 A;  1FC2 C;  5KAF H;  1MV8 A;  3AEF C;  5KAF E;  1KMI Z;  3HUS B;  4Y28 J;  1R8E A;  1N7S A;  1KB9 I;  3CCL P;  2FYU J;  2XNX A;  3AED C;  3D71 A;  1LWU C;  2YO3 A;  1S1C X;  4LC1 A;  1JY3 O;  1SQB E;  1VQ4 P;  1VQ7 P;  2XKM A;  2B87 B;  1PFI A;  2IFM A;  2J59 M;  2D2C B;  1AV1 A;  3L74 G;  2IX7 C;  1MUU A;  3A0H E;  3QH9 A;  1DD4 A;  2O3J A;  3AE2 C;  3V4Q A;  1NU1 E;  1NTK E;  3MZW B;  1MFT A;  2O1J A;  1JM0 A;  1IFM A;  2KP8 A;  2KYV A;  1OVV A;  1RQU A;  3RBZ A;  1M56 D;  3CXH H;  1DEE G;  1YJ9 P;  1NTM D;  1URQ A;  4PV1 B;  1YIJ P;  3TDK A;  3H6P A;  1YIT P;  1SQB J;  3A7O A;  1KIL D;  2QEX P;  5CMZ A;  3HD7 B;  2C9L Y;  2QJK C;  5K5G B;  1ZOY C;  3PJS K;  1L0L K;  5KLI C;  2Y9Z A;  4DZO A;  1SQX E;  5KJ7 D;  1HVV A;  2ZXE B;  2WZ7 A;  3A0B H;  2AEJ A;  3GHG B;  3NFQ A;  1PZQ A;  3CWB G;  3A0B E;  4XE5 B;  2YMY A;  1NTZ K;  2CK3 H;  1CI6 B;  3N4X A;  4JYB A;  3WUU A;  3H1I G;  4U3F G;  2BCC G;  4GIF A;  3SWK A;  3T97 A;  1RE3 A;  1H0T B;  1LJ2 A;  4DOJ A;  4K35 A;  4KJM A;  4TT3 H;  2WIT A;  4ASV A;  2O01 H;  3TNU A;  1VQN P;  1KOR A;  4YXW H;  1FZC C;  4YPC A;  4L75 A;  3LW5 H;  1AVY A;  1EZV D;  3BCC G;  2KXP B;  5KJ7 C;  2A06 E;  1VF5 B;  1TU3 F;  3W68 A;  2ZYA A;  2BEZ F;  2J5U A;  2N1T D;  5TIS E;  3F5H A;  2B9B A;  2C9N Y;  2H8P D;  2M0B A;  4WBA A;  1AQ5 A;  5APQ A;  1SQB G;  1NKN A;  2ZFC A;  4WY4 B;  1RF0 C;  3CXH I;  3AEA C;  4WB4 A;  1PP9 D;  1L0L J;  3L70 E;  1NVO A;  2P7J A;  3I56 P;  1IFJ A;  1BGY D;  4HH2 A;  3A3Y B;  5CCG A;  1LT9 C;  3KPE A;  1RF1 B;  2KLU A;  1NU1 G;  3RL0 g;  1NTK G;  1P84 I;  2N1T C;  4PD4 I;  1NTZ J;  1GK4 A;  4W7Y A;  2ZVO B;  1LTI C;  3MD0 A;  1D7M A;  1IFI A;  2PAJ A;  1S4X A;  4H44 D;  3WMM 0;  5APX A;  3AE3 C;  2YKP A;  3MTU E;  4R4L A;  2NPS B;  1BDC A;  3RL0 D;  4NPE A;  3QWO C;  4JYC A;  4WVZ A;  4XA4 A;  1SQX G;  5L8R J;  1OW6 A;  3L75 E;  2R44 A;  3JC2 2;  3RK3 D;  4BRY A;  2KK7 A;  1BE3 J;  2QSI A;  2JJL A;  1GZL A;  4XFJ A;  5DJU B;  1QVG O;  1Q7Y Q;  1SFC B;  3CCR P;  2LKM A;  1IFP A;  3FWN A;  1SQQ K;  3OA7 A;  3CX5 E;  4ZKP A;  1PL5 A;  2FYU D;  1M1J B;  1AFO A;  1LTB C;  4OGQ D;  3CL3 D;  1NGM B;  3F89 A;  2K9Y A;  2HYN A;  4H13 D;  3HTK B;  1ZV8 A;  4N6J A;  3RL0 C;  1N73 A;  2A45 I;  4OWF A;  1EXJ A;  2W83 C;  2Y0C A;  1GU5 A;  2A06 G;  3RK3 C;  3V2N A;  3U59 A;  3VMZ A;  1BSH A;  4H0L B;  1KYO I;  4OH8 B;  1SQQ E;  4UB6 E;  4JQ0 D;  4GOD A;  1U7M A;  3H1H D;  3TGU J;  3PH0 A;  3VOP A;  2PP6 A;  4OGQ C;  2Q1K A;  4QMA A;  4Y99 C;  1GD2 E;  1N7S B;  1KQL A;  5KTB A;  1FZA A;  3L70 G;  1QVF O;  1FU1 A;  2WPS A;  2OYH A;  1L4A D;  5AW5 B;  2N9B A;  1FOS F;  1BCC D;  2KZI A;  2Q6Q A;  1JNM A;  5GTI H;  5AW0 B;  2M3E A;  1PGP A;  1HF9 A;  1MKM A;  1LTA C;  3SSU A;  5GTH E;  3KZI E;  1S5L H;  2E5T A;  1S5L E;  1SQQ J;  3Q5P A;  1L2P A;  1FOS E;  3AE6 C;  2LXC B;  3UIA A;  2C0X A;  2YKQ A;  3VMY A;  2QM8 A;  4PD4 D;  4LLH A;  2HPC A;  1URQ B;  3H1L D;  1BDD A;  1FS0 E;  1JY2 N;  1JY2 O;  1FJK A;  1L4A C;  1KV4 A;  3L72 J;  3MGN A;  3FGA D;  2M5A A;  3H1K E;  3CI9 A;  3L75 G;  1K73 Q;  1VQK P;  4D6T J;  1J2J B;  2KNC A;  2JWD A;  3GF7 A;  4U7J A;  1LWU A;  3LIE A;  5KLV E;  3HUS C;  1NJI Q;  3L4F A;  4O9B A;  3BRT B;  1ZME C;  1LTS C;  3GLM A;  2Q3E A;  2QE7 H;  3RGU A;  3EWK A;  2WQY C;  4C7N A;  1Q2N A;  2WSC J;  4R4M A;  1OVR A;  4I7Z B;  3HD7 D;  1L0L D;  1FZG A;  3CMA P;  2E76 B;  1RY3 A;  3T97 B;  2IBZ D;  3H1K J;  1KB9 E;  5E79 E;  1QL1 A;  1LTJ C;  1DX7 A;  1SQQ G;  4RES B; 
#chains in the Genus database with same CATH homology
 1SQX J;  3CXH I;  1P84 I;  5KLV J;  3BCC J;  1SQB J;  3H1I J;  1NTZ J;  4PD4 I;  3H1L J;  1SQQ J;  4U3F J;  1L0L J;  2BCC J;  1NU1 J;  3L72 J;  3TGU J;  3L71 J;  1NTK J;  3H1J J;  1PP9 J;  3H1H J;  3L70 J;  3H1K J;  1SQV J;  2IBZ I;  4D6T J;  1KYO I;  1BGY J;  1BCC J;  1KB9 I;  3CWB J;  1NTM J;  2FYU J;  3L75 J;  3CX5 I;  1BE3 J;  3L73 J;  1SQP J;  1EZV I;  3L74 J;  1L0N J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...