1KB9I

Yeast cytochrome bc1 complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
55
structure length
55
Chain Sequence
SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 16
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1kb9I00
1P84I 3L73J 1SQBJ 1NU1J 3H1IJ 1BGYJ 1SQVJ 1SQPJ 1EZVI 3L74J 3CX5I 3CWBJ 1NTKJ 1BE3J 3L72J 1KB9I 2BCCJ 1KYOI 4D6TJ 4PD4I 5KLVJ 1BCCJ 1SQXJ 4U3FJ 3CXHI 3BCCJ 2FYUJ 3L70J 3L71J 1L0LJ 3H1HJ 1L0NJ 1NTZJ 3H1KJ 3H1JJ 1SQQJ 1NTMJ 3TGUJ 3H1LJ 3L75J 2IBZI 1PP9J
chains in the Genus database with same CATH superfamily
3C9IA 3V6IA 3AE3C 1FZFA 1OIPA 1NU1G 1YYCA 2G8YA 2AEFA 2I1JA 3LW5J 4I7ZB 5AVXB 3VMZA 3VTPC 1KD1Q 1ZV8A 3WUTA 1LWUC 3P8CE 5KLIB 1NTZK 2A06G 4RKUJ 1SLQA 5KLIC 1AFOA 2E43A 1ZN5A 2YIUC 4D6TJ 1RF1B 1KQFB 5BU5A 3TGUG 1NGMB 5B66E 3V2NA 1HUCA 1SQBK 2YXRB 3AEAC 4U3FE 2K37A 2A45G 4U3FJ 2N9BA 2OYHA 1LTBC 1LWUA 3H1JG 4OGQB 2JWDA 1L4AD 4GOFA 3AEGC 1LT9C 3B5NC 4H0LC 3SWYA 1L0LD 1NU1K 2FYUG 1HH0A 1SQXD 2IBZG 2O1KA 2FBWC 2BEZF 3MP7B 1FDIA 2V7QH 1BCCG 4BRYB 2OQQA 3D71A 1PGJA 3PJSK 4Y99C 3SFDC 3L36A 2KZJA 1KYOI 1XTGB 3GW6A 1N73B 5CCHA 1GW3A 1ZRTE 5CJ4A 1OW7A 1L0NE 3GF7A 3M9BA 5KJ7A 2E75D 1OX3A 1LT1A 2QVAA 3G9RA 3G4SP 1PFIA 1PP9D 3KDPB 1OVVA 1GW4A 2KP8A 4CPGA 3IFMA 2FYZA 3A0HH 3KPEA 4N6JA 5KJ7D 2WPVB 2YKPA 1FOSE 2K3RA 2OYOA 3HD7B 3BCCJ 3QWOC 4RO0A 3WMM0 2LXCB 2FYUJ 1N7SB 3L73E 1OWAA 2R5DA 2HPCB 5KKZB 5APSA 2QJKC 1BGYG 3MD0A 3NMDA 3OA7A 2OARA 3L75G 2JO1A 1WRGA 2KNCB 4BRYA 4DZOA 1A02F 1A02J 1IK7A 1MFTA 4D6TE 2FFDC 3CCLP 1M1JA 3M91A 3N7NA 1YTZI 1IFPA 4NPFX 1KQSO 3ZDMA 2HLOA 3B8EB 5CHXA 2CPBA 2SPZA 1Y8AA 2Q3EA 1L0NG 3LW5H 2WSSH 3H1HG 3L70E 5AVTB 1VQNP 2P67A 3H1JE 1YJWP 2R32A 2K9YA 5APTA 3CD6P 2PRRA 3C8VA 2CK3H 3EWKA 1BE3E 3WU2H 1G1IA 1BE3J 2XNDH 1YBKA 3L72J 1X79B 3L72E 3RL0C 3RL0D 3VP9A 3IF4A 1QLED 2B87B 2P1JA 4MN4C 1KC8Q 2ZYGA 3VMYA 2P2UA 3VOPA 2I8DA 2HG5D 2KLUA 2M0BA 5AVYB 1BGYE 3CX5H 3BVHA 1KB9D 1Q2NA 3KYQA 4K3AA 1YJ9P 4PV1C 3CCMP 1KMIZ 2LR2A 4PV1B 2NPSD 3PRJA 3CXHH 5KLVD 3TGUJ 1LTJA 4D6TG 1M57D 1KYOD 1DEBA 3USSA 1RQUA 3L71D 2QJYB 3G71P 5APQA 1JCDA 1SFCA 1PP9E 2MKVA 2RH0A 3HD7D 5AW5B 2Y0EA 1AQTA 3L37A 2YKQA 4L75A 1VQMP 4C46A 5CJ0A 1U57A 1ZXGA 2E42A 5H2FE 3L74J 2WMMA 2R5BA 3TDKA 5KJ7C 1WMKA 2L91A 1TU3F 3TSIA 4EYYQ 4Z1MH 5B5EE 2ZJSE 1SQVK 4EOTA 4IFDK 3UIAA 1KILB 3L74D 3TF5A 3HTKB 2E75C 1E5WA 2E76D 2C9NY 4BWNA 3M9HA 1RF0A 5APUA 4IL6X 4ZNCA 3L70J 2PGDA 5KLVK 2QEXP 3H1HJ 5CCGD 1SQXK 1L0NJ 1AA0A 4WY4C 3GG2A 3JSVC 4IL6H 2K9JB 1SFCC 1FZAA 2BEQD 1PIXA 1R5LA 1SQPK 2O01N 4QMAA 3KQGA 1R5SA 4GT1A 2Q6QA 1S9KE 1LTAC 3HUSB 3AE8C 1JY3O 1KZUB 1OVUA 4H0LD 1VQ4P 3B5ND 2IFNA 1L4AC 3MHVA 3CX5E 3CCRP 1FJPA 1BE3D 5TJHA 2FYUE 2FXPA 5KAIH 3D70A 2GA1A 1SQPJ 4XA4A 1LGHB 2ZXEB 1FOSF 1M56D 1SQXG 4HJGH 3PLNA 2WTYA 3FWNA 3HUSC 1L0LG 1FAVA 1MV8A 3TGUE 1AVOA 3E1RA 2A45I 1P84E 1K05A 2DW3A 2E5YA 3B5NB 3MIWA 4IFMA 1NTZD 1EZVE 4IOIH 2OYIB 2QSIA 1LTSC 1KFNA 3AEFC 2Q7CA 3WU2E 1BE3G 3V5BA 2OTKE 1G1JA 4H44D 1R8EA 2K88A 1NTZJ 2Z5HA 3E1IA 1FZEA 2YNYA 1DD4A 1X22A 3FX0A 4LLHA 3BCCG 4OGQD 4YTPC 5KAFE 2N1TC 1NH4A 1SQBG 2RKLA 3AE6C 3BRVB 2NPSB 2YO3A 1VPCA 3U1CA 1DD3A 4RESB 1RH5B 2P7JA 2Y0CA 1SQPD 3AE9C 5KAFH 1PPJD 2AXCA 1NTKD 4A7PA 5AW4B 2O3JA 1P84I 2XDJA 3D6ZA 3CXHE 1PGOA 1PL5A 4YXDC 2YKOA 2Q5UA 3CLQA 1WT6A 1MZ9A 1SQVG 2B88A 3CWBJ 1FZBA 3MUDC 3H1KG 1Q90D 2C0XA 3JCUE 3RK3E 3I55P 1SS1A 5GTIE 2BCCE 2FFDA 3AE1C 5B66H 3WUVA 4H0LB 4PD4H 2WSEJ 4PD4I 1LTJB 2ZYDA 5AVWB 5GTIH 1KB9H 1LTJC 3R4YA 1NAFA 1IFIA 4C7NA 1GL2C 1OFCX 3CC4P 3P32A 1KILA 4JPZB 2ZT9C 3L71G 4L74A 1SQQJ 2WPQA 3B5NA 4N3YB 1M90Q 1FZCC 1NHLA 1VL2A 5E79E 2QJKB 5AVZB 3CMEP 1G2CA 1HTLC 1FDMA 1K04A 2WSCH 1N7SC 1YJNP 1J1EC 1QX8A 4KHXA 1QL1A 2NRGA 1T3JA 2K9JA 2PFXA 1LJ2A 3IAOA 5AVUB 1X9VA 2QIWA 1L2PA 5CMZA 5CCHC 1HWTC 3BRTB 1OZHA 1FC2C 1NTZE 4WB4A 1HJBA 1AVYA 4DCKA 2A06D 2Y9YA 3GHGB 5EFWB 3Q1MA 3U1AA 1JEKA 2ZXXA 2KSEA 1DIPA 2W6AA 3QH9A 3EFFK 5KLVJ 2YXQB 3PHLA 2ZAEB 5BVZA 3HUSA 1CZQA 1SQXE 1URQC 2JP3A 4R4LA 4Y99B 2ZVNB 1MKMA 3C1LA 2E74D 2POHA 5AW9B 1NU1E 5H2FH 3VMAA 4Y28J 1SQPE 4HKZH 3NFQA 3SSUA 1RQVA 3CWBE 4UB8H 4B86A 1FZGA 1HBWA 3V2PA 2KK7A 4BXLA 1EZVG 2O01J 2W6JH 1GZLA 5AW6B 2KS1B 3NXSA 2H7HA 2IYOA 2VRSA 3R2PA 4UB6E 3H32A 3OW2O 2H43A 1D7MA 4N78D 3SWFA 3CCQP 1W5CE 1VQPP 3O8ZA 1DH3A 2WQYC 3RK3D 1FDOA 2XZRA 1NO4A 1ZLLA 1NTZG 2FKWB 4JBZA 3CCVP 2QA4P 1NJIQ 3AEEC 3A7OA 3H1LD 1S5LE 1SQQG 4OVNF 5APYA 1RF0C 3MZWB 1NAYA 5GTHE 3A0HE 1QL2A 5DJUB 1H0TA 1KB9I 4JYBA 1NKZB 1HGVA 2LXBA 3S4RA 1KILD 1VF5B 2XNXA 5GTHH 5CBNA 2E74B 1NTKK 1RF1C 4JYCA 1Q86Q 2Q9IA 2V7QJ 2KSJA 3AE2C 3P8MC 1K9MQ 2QG4A 2C9LY 2AXTE 3EQ2A 1M8OB 3H1KJ 1RY3A 3CWBG 3M0AA 2O01H 3HE4A 3VP8A 1KTMA 2WSEH 2B89A 1S1CX 3VN0A 1SQQK 3GHGC 1IFDA 1RE4A 3CI9A 3IN6A 2WWWA 3O6QA 4C7NB 2Y9ZA 1Q7YQ 1H89A 3Q2YA 2QJPC 3I56P 1GK4A 3FXEA 1Q81Q 1GU5A 1M1KQ 1LTGC 1NTKG 2KNCA 1VF5C 1EC5A 2W90A 1SQPG 2QJYC 1SQBJ 2YMKA 3L73J 1FS0E 1NOHA 1GTWA 1BGYJ 1M1JB 4EI2A 1YI2P 3Q5SA 3CX5I 3AEDC 1SQBD 1S2EA 4DT0A 1OMIA 3ABVC 1W2EA 2QRXA 3KHUA 1BGYD 2PP6A 3H1ID 2XKMA 2QM7A 3K5BA 3LIDA 3PH0A 2Z5IA 2K1AA 3A0BH 2D2CD 2W8ZA 1GL2B 3U59A 1IC2A 2ZVOB 5AW8B 4AYCA 4N78E 1T2KD 1AJYA 1HGZA 2YMYA 2WZ7A 3H1JJ 3CCEP 1CSBA 3OJAB 1LP1B 4U3FG 1J2JB 1KORA 1PZQA 1NTME 3BCCD 1M7LA 3JC22 4ASVA 2N9YB 4H13D 1X0TA 5AW0B 1IFNA 1ZP0C 2M3EA 2RN0A 2BASA 1VQ6P 1VF5D 1ZW0A 1IFJA 3L72D 1YHQP 3GHGA 3L75E 4UB8E 3RK2C 1FU1A 3Q5PA 5APVA 1GK6A 2O1JA 1NU1J 3H1KE 1KILE 3T97B 2KB7P 1SQVE 4ASWA 5E79H 4RJTA 3A2AA 1CI6A 1ZMEC 1X8YA 1SFCB 4HYTB 3W68A 1P84H 1KB9E 1S72P 2KXPB 5KKZC 3CX5D 3OAKA 5AVRB 1RF1A 1VQ7P 2KS1A 3SFEC 5KLVE 1JCCA 3HE5A 3H32B 2FXOA 2H88C 3KZIE 3CXHI 4OWFA 4HB1A 4XE5B 2KZIA 3L71E 1JO5A 3N4XA 2OYIC 2E75B 2ZYAA 2LKMA 1OXZA 3HTKA 3TGUD 1KYOH 4H13B 1U7JA 4IFFA 1YQ3C 4NPDA 1CW5A 2R3SA 3A5TA 4PD4D 1EDKA 1QGKB 3A3YB 1S4XA 3FGAD 1EZVD 1JTHB 1NVOA 1KV4A 4O9BA 3SWKA 3RBXA 3RK3C 2FYUK 1H0TB 2N1TA 4HH2A 1JY3N 1L0LE 1LP1A 3FWLA 3H1IE 1JMMA 1E79H 1L4AB 1SQVJ 1EZVI 1EDIA 1N8RQ 3M9QA 2YIUB 1PP9G 1RHZB 1S3JA 2NZ2A 2HYNA 4JQ0D 1NTKJ 1NTKE 2BCCJ 3AE7C 3HE4B 3V2RA 1OW6A 1IO4A 2QM8A 3P7KA 4KT0J 1YITP 1W2BO 2Z4EA 2IBZE 3NTNA 5C39A 1URQD 3O6QB 2RMZA 1SQXJ 1FZCA 1JY3P 2FYNC 1NTMD 3BCCE 2KOGA 3BASA 3P8CD 3L72G 2E76B 1EXIA 2R3CA 3KXDA 1CI6B 1PV3A 1BCCD 2FY8A 2W27A 1GMJA 4L73A 1S5LH 1JNMA 1K73Q 1URQA 1Y9BA 2FYUD 3AECC 3AEBC 4U3FD 5AVQB 2UWJE 1RE3A 1N73A 1GL2A 2OYIA 2ZFCA 4OH8B 4ZKPA 3H1KD 5CCHD 1MFZA 1SQVD 4LGDE 3GLMA 3L73D 4R4MA 1NKNA 5AW3B 2JEEA 2HFED 4U7JA 3RK3B 4GIFA 1ZR4A 2AXTH 1KQLA 2QJPB 3H1IG 4YPCA 2M3BA 1JTHA 4GDOA 1JY2O 1QEXA 3HD7A 1L0NK 2GUSA 2ZT9D 2N1TB 3G3ZA 1U7MA 1ZRTD 4TLFA 3CCJP 1EDJA 3V4WA 1L0ND 3T97A 1AV1A 4XFJA 2J58A 3L35A 2W6BA 1LTIC 1QVGO 2OTJP 1PPJE 1L0LJ 2FYNB 2KUBA 3RK2D 3H25A 2FFDB 5M1BA 1EQ7A 5TISH 1VQKP 4W7YA 4AUWA 1ZOYC 5KTBA 3HE5B 4H13C 1NTMJ 3M06A 2HODB 3HRNA 4UB6H 3CMAP 1FZCB 1LTTC 4TT3H 2WPSA 4NPEA 1UIIA 1YQ4C 1J1DB 1RE3C 2KYVA 2R44A 1N73C 1IZNB 2ITAA 3VMXA 1T2KC 2B9BA 1URQB 1G2CB 5AVVB 2D2CC 1LT9A 2HR3A 5K5GB 2W83C 1N86A 4D6TD 2B87A 3II6A 1JY2P 2IDBA 2JWAA 3V2QA 3B4SA 2N1TD 1USEA 4I2LC 1GU4A 1K8AQ 2OYHC 3CC7P 1BSHA 1KFMA 2IFMA 1L4AA 3H1JD 2Q1KA 1ZR2A 1JY2N 2D2CB 3MGNA 2XU6A 1VQOP 4KJMA 3TNUA 1KN7A 4WBAA 1J1DC 2WITA 2JKVA 2KIKA 1DX7A 5KAIE 2JJLA 3L74G 3L70D 1H88A 1JM0A 2GUVA 2V4HA 3M0DA 4LC1A 1M1JC 3BATA 2H89C 3H1HD 3H1LE 2ZT9B 1FBMA 2A06E 2IBZI 2WSFH 1N2DC 1JMBA 2IX7C 3L4FA 2IPPA 3L75J 5APXA 1Y47A 1RE4C 4ZKUA 2WT7A 1YIJP 3D6YA 1PGQA 2OGUA 1Q82Q 3GF3A 1J1EB 2AEMA 1GDTA 1PPJG 1BDDA 1KYOE 1LNQA 3VYIA 1NWQA 1KILC 1SFCD 1XTCC 2J59M 2Q3IA 3F89A 3S1KA 3CWBD 3KZIH 4WY4D 5CCGC 2L5GB 1OVRA 3RBZA 3F5HA 4I1LA 1LT9B 4H44B 2G3AA 2J5UA 4EDFA 2E76C 2Y0DA 1PGPA 1SQBE 2H8PD 3L71J 4JF7A 3L73G 4WY4A 3L74E 3MUDA 1OW8A 2XV5A 1SQQE 4C7RA 4YXWH 1P84D 1SVFA 5AW2B 1USDA 2IZ0A 2YO2A 2I1KA 3Q3DA 1IJDB 1S5LX 3H1LG 1FJKA 4WVZA 1VQ5P 3H1LJ 1DEEG 3H6PA 3TNUB 3HD7C 3I5CA 3RL0g 3M0DC 3CPWO 4I7ZC 4ZMDA 1BDCA 1SP4A 4K35A 4AQRD 4DOJA 2E74C 1VQ8P 1N7LA 1NTMG 5DJTB 3H1IJ 1MUUA 3TK1A 5CBOA 3EFGA 4PJ0E 1JOCA 1T3UA 2NPSC 2AEJA 1FE6A 3PTZA 4PV1D 3RL0B 3S9OA 1YTZT 3B71A 2OYHB 3L75D 1QVFO 2E5TA 2KLVA 5BU8B 3A0BE 1S9KD 1BCCJ 2HODA 5AW1B 1NYHA 1VQLP 2NPSA 2JDIH 2KI7B 1KQGB 2M5AA 1Z56A 3E7KA 3G6EP 2FXMA 3H1HE 2WPRA 1NTMK 4L76A 5APWA 3W67A 2OTLP 3WUUA 1N7SD 1HVVA 2IYPA 3L70G 1HF9A 4W7ZA 2WSCJ 2M8RA 3CL3D 2WSFJ 2A45H 3CCUP 2GM4A 4WY4B 2JR8A 1N7SA 3LIEA 2P58A 4GKGA 2BCCG 2IZ1A 1EDLA 1GL2D 1PP9J 3TYYA 1UIXA 3CCSP 2QE7H 1JUNA 4M3LA 3FXDA 1JB0J 3RK2B 5TISE 3V4QA 1H8AA 4I6MC 4W80A 1LWUB 1T6AA 5KLVG 1HJ0A 3AE4C 5AVSB 3RGUA 2WT7B 5L8RJ 1VQ9P 4DJGA 3GMAA 4EIJA 2HPCA 3JCUH 3CXHD 5CCGA 1SQQD 2P10A 4GODA 2PAJA 4GOEA 5B5EH 1EXJA 4PD4E 4PJ0H 3IR9A 1IK9A 5AW7B 3PP5A 3AE5C 3CC2P 1IFMA 2MJZA 3MTUE 2C0WA 1AQ5A 2CPSA 2IBZD 2WVRA 1GD2E 3ITKA 1BSNA 1T8ZA 4WWIA 3Q5RA 4IL6E 1VDFA 1L0LK 1NU1D 2M5AB 1BCCE 4OGQC 2BCCD 4H44C
chains in the Genus database with same CATH topology
1P84I 3L73J 1SQBJ 1NU1J 3H1IJ 1BGYJ 1SQVJ 1SQPJ 1EZVI 3L74J 3CX5I 3CWBJ 1NTKJ 1BE3J 3L72J 1KB9I 2BCCJ 1KYOI 4D6TJ 4PD4I 5KLVJ 1BCCJ 1SQXJ 4U3FJ 3CXHI 3BCCJ 2FYUJ 3L70J 3L71J 1L0LJ 3H1HJ 1L0NJ 1NTZJ 3H1KJ 3H1JJ 1SQQJ 1NTMJ 3TGUJ 3H1LJ 3L75J 2IBZI 1PP9J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P84 I;  3L73 J;  1SQB J;  1NU1 J;  3H1I J;  1BGY J;  1SQV J;  1SQP J;  1EZV I;  3L74 J;  3CX5 I;  3CWB J;  1NTK J;  1BE3 J;  3L72 J;  1KB9 I;  2BCC J;  1KYO I;  4D6T J;  4PD4 I;  5KLV J;  1BCC J;  1SQX J;  4U3F J;  3CXH I;  3BCC J;  2FYU J;  3L70 J;  3L71 J;  1L0L J;  3H1H J;  1L0N J;  1NTZ J;  3H1K J;  3H1J J;  1SQQ J;  1NTM J;  3TGU J;  3H1L J;  3L75 J;  2IBZ I;  1PP9 J; 
#chains in the Genus database with same CATH topology
 3C9I A;  3V6I A;  3AE3 C;  1FZF A;  1OIP A;  1NU1 G;  1YYC A;  2G8Y A;  2AEF A;  2I1J A;  3LW5 J;  4I7Z B;  5AVX B;  3VMZ A;  3VTP C;  1KD1 Q;  1ZV8 A;  3WUT A;  1LWU C;  3P8C E;  5KLI B;  1NTZ K;  2A06 G;  4RKU J;  1SLQ A;  5KLI C;  1AFO A;  2E43 A;  1ZN5 A;  2YIU C;  4D6T J;  1RF1 B;  1KQF B;  5BU5 A;  3TGU G;  1NGM B;  5B66 E;  3V2N A;  1HUC A;  1SQB K;  2YXR B;  3AEA C;  4U3F E;  2K37 A;  2A45 G;  4U3F J;  2N9B A;  2OYH A;  1LTB C;  1LWU A;  3H1J G;  4OGQ B;  2JWD A;  1L4A D;  4GOF A;  3AEG C;  1LT9 C;  3B5N C;  4H0L C;  3SWY A;  1L0L D;  1NU1 K;  2FYU G;  1HH0 A;  1SQX D;  2IBZ G;  2O1K A;  2FBW C;  2BEZ F;  3MP7 B;  1FDI A;  2V7Q H;  1BCC G;  4BRY B;  2OQQ A;  3D71 A;  1PGJ A;  3PJS K;  4Y99 C;  3SFD C;  3L36 A;  2KZJ A;  1KYO I;  1XTG B;  3GW6 A;  1N73 B;  5CCH A;  1GW3 A;  1ZRT E;  5CJ4 A;  1OW7 A;  1L0N E;  3GF7 A;  3M9B A;  5KJ7 A;  2E75 D;  1OX3 A;  1LT1 A;  2QVA A;  3G9R A;  3G4S P;  1PFI A;  1PP9 D;  3KDP B;  1OVV A;  1GW4 A;  2KP8 A;  4CPG A;  3IFM A;  2FYZ A;  3A0H H;  3KPE A;  4N6J A;  5KJ7 D;  2WPV B;  2YKP A;  1FOS E;  2K3R A;  2OYO A;  3HD7 B;  3BCC J;  3QWO C;  4RO0 A;  3WMM 0;  2LXC B;  2FYU J;  1N7S B;  3L73 E;  1OWA A;  2R5D A;  2HPC B;  5KKZ B;  5APS A;  2QJK C;  1BGY G;  3MD0 A;  3NMD A;  3OA7 A;  2OAR A;  3L75 G;  2JO1 A;  1WRG A;  2KNC B;  4BRY A;  4DZO A;  1A02 F;  1A02 J;  1IK7 A;  1MFT A;  4D6T E;  2FFD C;  3CCL P;  1M1J A;  3M91 A;  3N7N A;  1YTZ I;  1IFP A;  4NPF X;  1KQS O;  3ZDM A;  2HLO A;  3B8E B;  5CHX A;  2CPB A;  2SPZ A;  1Y8A A;  2Q3E A;  1L0N G;  3LW5 H;  2WSS H;  3H1H G;  3L70 E;  5AVT B;  1VQN P;  2P67 A;  3H1J E;  1YJW P;  2R32 A;  2K9Y A;  5APT A;  3CD6 P;  2PRR A;  3C8V A;  2CK3 H;  3EWK A;  1BE3 E;  3WU2 H;  1G1I A;  1BE3 J;  2XND H;  1YBK A;  3L72 J;  1X79 B;  3L72 E;  3RL0 C;  3RL0 D;  3VP9 A;  3IF4 A;  1QLE D;  2B87 B;  2P1J A;  4MN4 C;  1KC8 Q;  2ZYG A;  3VMY A;  2P2U A;  3VOP A;  2I8D A;  2HG5 D;  2KLU A;  2M0B A;  5AVY B;  1BGY E;  3CX5 H;  3BVH A;  1KB9 D;  1Q2N A;  3KYQ A;  4K3A A;  1YJ9 P;  4PV1 C;  3CCM P;  1KMI Z;  2LR2 A;  4PV1 B;  2NPS D;  3PRJ A;  3CXH H;  5KLV D;  3TGU J;  1LTJ A;  4D6T G;  1M57 D;  1KYO D;  1DEB A;  3USS A;  1RQU A;  3L71 D;  2QJY B;  3G71 P;  5APQ A;  1JCD A;  1SFC A;  1PP9 E;  2MKV A;  2RH0 A;  3HD7 D;  5AW5 B;  2Y0E A;  1AQT A;  3L37 A;  2YKQ A;  4L75 A;  1VQM P;  4C46 A;  5CJ0 A;  1U57 A;  1ZXG A;  2E42 A;  5H2F E;  3L74 J;  2WMM A;  2R5B A;  3TDK A;  5KJ7 C;  1WMK A;  2L91 A;  1TU3 F;  3TSI A;  4EYY Q;  4Z1M H;  5B5E E;  2ZJS E;  1SQV K;  4EOT A;  4IFD K;  3UIA A;  1KIL B;  3L74 D;  3TF5 A;  3HTK B;  2E75 C;  1E5W A;  2E76 D;  2C9N Y;  4BWN A;  3M9H A;  1RF0 A;  5APU A;  4IL6 X;  4ZNC A;  3L70 J;  2PGD A;  5KLV K;  2QEX P;  3H1H J;  5CCG D;  1SQX K;  1L0N J;  1AA0 A;  4WY4 C;  3GG2 A;  3JSV C;  4IL6 H;  2K9J B;  1SFC C;  1FZA A;  2BEQ D;  1PIX A;  1R5L A;  1SQP K;  2O01 N;  4QMA A;  3KQG A;  1R5S A;  4GT1 A;  2Q6Q A;  1S9K E;  1LTA C;  3HUS B;  3AE8 C;  1JY3 O;  1KZU B;  1OVU A;  4H0L D;  1VQ4 P;  3B5N D;  2IFN A;  1L4A C;  3MHV A;  3CX5 E;  3CCR P;  1FJP A;  1BE3 D;  5TJH A;  2FYU E;  2FXP A;  5KAI H;  3D70 A;  2GA1 A;  1SQP J;  4XA4 A;  1LGH B;  2ZXE B;  1FOS F;  1M56 D;  1SQX G;  4HJG H;  3PLN A;  2WTY A;  3FWN A;  3HUS C;  1L0L G;  1FAV A;  1MV8 A;  3TGU E;  1AVO A;  3E1R A;  2A45 I;  1P84 E;  1K05 A;  2DW3 A;  2E5Y A;  3B5N B;  3MIW A;  4IFM A;  1NTZ D;  1EZV E;  4IOI H;  2OYI B;  2QSI A;  1LTS C;  1KFN A;  3AEF C;  2Q7C A;  3WU2 E;  1BE3 G;  3V5B A;  2OTK E;  1G1J A;  4H44 D;  1R8E A;  2K88 A;  1NTZ J;  2Z5H A;  3E1I A;  1FZE A;  2YNY A;  1DD4 A;  1X22 A;  3FX0 A;  4LLH A;  3BCC G;  4OGQ D;  4YTP C;  5KAF E;  2N1T C;  1NH4 A;  1SQB G;  2RKL A;  3AE6 C;  3BRV B;  2NPS B;  2YO3 A;  1VPC A;  3U1C A;  1DD3 A;  4RES B;  1RH5 B;  2P7J A;  2Y0C A;  1SQP D;  3AE9 C;  5KAF H;  1PPJ D;  2AXC A;  1NTK D;  4A7P A;  5AW4 B;  2O3J A;  1P84 I;  2XDJ A;  3D6Z A;  3CXH E;  1PGO A;  1PL5 A;  4YXD C;  2YKO A;  2Q5U A;  3CLQ A;  1WT6 A;  1MZ9 A;  1SQV G;  2B88 A;  3CWB J;  1FZB A;  3MUD C;  3H1K G;  1Q90 D;  2C0X A;  3JCU E;  3RK3 E;  3I55 P;  1SS1 A;  5GTI E;  2BCC E;  2FFD A;  3AE1 C;  5B66 H;  3WUV A;  4H0L B;  4PD4 H;  2WSE J;  4PD4 I;  1LTJ B;  2ZYD A;  5AVW B;  5GTI H;  1KB9 H;  1LTJ C;  3R4Y A;  1NAF A;  1IFI A;  4C7N A;  1GL2 C;  1OFC X;  3CC4 P;  3P32 A;  1KIL A;  4JPZ B;  2ZT9 C;  3L71 G;  4L74 A;  1SQQ J;  2WPQ A;  3B5N A;  4N3Y B;  1M90 Q;  1FZC C;  1NHL A;  1VL2 A;  5E79 E;  2QJK B;  5AVZ B;  3CME P;  1G2C A;  1HTL C;  1FDM A;  1K04 A;  2WSC H;  1N7S C;  1YJN P;  1J1E C;  1QX8 A;  4KHX A;  1QL1 A;  2NRG A;  1T3J A;  2K9J A;  2PFX A;  1LJ2 A;  3IAO A;  5AVU B;  1X9V A;  2QIW A;  1L2P A;  5CMZ A;  5CCH C;  1HWT C;  3BRT B;  1OZH A;  1FC2 C;  1NTZ E;  4WB4 A;  1HJB A;  1AVY A;  4DCK A;  2A06 D;  2Y9Y A;  3GHG B;  5EFW B;  3Q1M A;  3U1A A;  1JEK A;  2ZXX A;  2KSE A;  1DIP A;  2W6A A;  3QH9 A;  3EFF K;  5KLV J;  2YXQ B;  3PHL A;  2ZAE B;  5BVZ A;  3HUS A;  1CZQ A;  1SQX E;  1URQ C;  2JP3 A;  4R4L A;  4Y99 B;  2ZVN B;  1MKM A;  3C1L A;  2E74 D;  2POH A;  5AW9 B;  1NU1 E;  5H2F H;  3VMA A;  4Y28 J;  1SQP E;  4HKZ H;  3NFQ A;  3SSU A;  1RQV A;  3CWB E;  4UB8 H;  4B86 A;  1FZG A;  1HBW A;  3V2P A;  2KK7 A;  4BXL A;  1EZV G;  2O01 J;  2W6J H;  1GZL A;  5AW6 B;  2KS1 B;  3NXS A;  2H7H A;  2IYO A;  2VRS A;  3R2P A;  4UB6 E;  3H32 A;  3OW2 O;  2H43 A;  1D7M A;  4N78 D;  3SWF A;  3CCQ P;  1W5C E;  1VQP P;  3O8Z A;  1DH3 A;  2WQY C;  3RK3 D;  1FDO A;  2XZR A;  1NO4 A;  1ZLL A;  1NTZ G;  2FKW B;  4JBZ A;  3CCV P;  2QA4 P;  1NJI Q;  3AEE C;  3A7O A;  3H1L D;  1S5L E;  1SQQ G;  4OVN F;  5APY A;  1RF0 C;  3MZW B;  1NAY A;  5GTH E;  3A0H E;  1QL2 A;  5DJU B;  1H0T A;  1KB9 I;  4JYB A;  1NKZ B;  1HGV A;  2LXB A;  3S4R A;  1KIL D;  1VF5 B;  2XNX A;  5GTH H;  5CBN A;  2E74 B;  1NTK K;  1RF1 C;  4JYC A;  1Q86 Q;  2Q9I A;  2V7Q J;  2KSJ A;  3AE2 C;  3P8M C;  1K9M Q;  2QG4 A;  2C9L Y;  2AXT E;  3EQ2 A;  1M8O B;  3H1K J;  1RY3 A;  3CWB G;  3M0A A;  2O01 H;  3HE4 A;  3VP8 A;  1KTM A;  2WSE H;  2B89 A;  1S1C X;  3VN0 A;  1SQQ K;  3GHG C;  1IFD A;  1RE4 A;  3CI9 A;  3IN6 A;  2WWW A;  3O6Q A;  4C7N B;  2Y9Z A;  1Q7Y Q;  1H89 A;  3Q2Y A;  2QJP C;  3I56 P;  1GK4 A;  3FXE A;  1Q81 Q;  1GU5 A;  1M1K Q;  1LTG C;  1NTK G;  2KNC A;  1VF5 C;  1EC5 A;  2W90 A;  1SQP G;  2QJY C;  1SQB J;  2YMK A;  3L73 J;  1FS0 E;  1NOH A;  1GTW A;  1BGY J;  1M1J B;  4EI2 A;  1YI2 P;  3Q5S A;  3CX5 I;  3AED C;  1SQB D;  1S2E A;  4DT0 A;  1OMI A;  3ABV C;  1W2E A;  2QRX A;  3KHU A;  1BGY D;  2PP6 A;  3H1I D;  2XKM A;  2QM7 A;  3K5B A;  3LID A;  3PH0 A;  2Z5I A;  2K1A A;  3A0B H;  2D2C D;  2W8Z A;  1GL2 B;  3U59 A;  1IC2 A;  2ZVO B;  5AW8 B;  4AYC A;  4N78 E;  1T2K D;  1AJY A;  1HGZ A;  2YMY A;  2WZ7 A;  3H1J J;  3CCE P;  1CSB A;  3OJA B;  1LP1 B;  4U3F G;  1J2J B;  1KOR A;  1PZQ A;  1NTM E;  3BCC D;  1M7L A;  3JC2 2;  4ASV A;  2N9Y B;  4H13 D;  1X0T A;  5AW0 B;  1IFN A;  1ZP0 C;  2M3E A;  2RN0 A;  2BAS A;  1VQ6 P;  1VF5 D;  1ZW0 A;  1IFJ A;  3L72 D;  1YHQ P;  3GHG A;  3L75 E;  4UB8 E;  3RK2 C;  1FU1 A;  3Q5P A;  5APV A;  1GK6 A;  2O1J A;  1NU1 J;  3H1K E;  1KIL E;  3T97 B;  2KB7 P;  1SQV E;  4ASW A;  5E79 H;  4RJT A;  3A2A A;  1CI6 A;  1ZME C;  1X8Y A;  1SFC B;  4HYT B;  3W68 A;  1P84 H;  1KB9 E;  1S72 P;  2KXP B;  5KKZ C;  3CX5 D;  3OAK A;  5AVR B;  1RF1 A;  1VQ7 P;  2KS1 A;  3SFE C;  5KLV E;  1JCC A;  3HE5 A;  3H32 B;  2FXO A;  2H88 C;  3KZI E;  3CXH I;  4OWF A;  4HB1 A;  4XE5 B;  2KZI A;  3L71 E;  1JO5 A;  3N4X A;  2OYI C;  2E75 B;  2ZYA A;  2LKM A;  1OXZ A;  3HTK A;  3TGU D;  1KYO H;  4H13 B;  1U7J A;  4IFF A;  1YQ3 C;  4NPD A;  1CW5 A;  2R3S A;  3A5T A;  4PD4 D;  1EDK A;  1QGK B;  3A3Y B;  1S4X A;  3FGA D;  1EZV D;  1JTH B;  1NVO A;  1KV4 A;  4O9B A;  3SWK A;  3RBX A;  3RK3 C;  2FYU K;  1H0T B;  2N1T A;  4HH2 A;  1JY3 N;  1L0L E;  1LP1 A;  3FWL A;  3H1I E;  1JMM A;  1E79 H;  1L4A B;  1SQV J;  1EZV I;  1EDI A;  1N8R Q;  3M9Q A;  2YIU B;  1PP9 G;  1RHZ B;  1S3J A;  2NZ2 A;  2HYN A;  4JQ0 D;  1NTK J;  1NTK E;  2BCC J;  3AE7 C;  3HE4 B;  3V2R A;  1OW6 A;  1IO4 A;  2QM8 A;  3P7K A;  4KT0 J;  1YIT P;  1W2B O;  2Z4E A;  2IBZ E;  3NTN A;  5C39 A;  1URQ D;  3O6Q B;  2RMZ A;  1SQX J;  1FZC A;  1JY3 P;  2FYN C;  1NTM D;  3BCC E;  2KOG A;  3BAS A;  3P8C D;  3L72 G;  2E76 B;  1EXI A;  2R3C A;  3KXD A;  1CI6 B;  1PV3 A;  1BCC D;  2FY8 A;  2W27 A;  1GMJ A;  4L73 A;  1S5L H;  1JNM A;  1K73 Q;  1URQ A;  1Y9B A;  2FYU D;  3AEC C;  3AEB C;  4U3F D;  5AVQ B;  2UWJ E;  1RE3 A;  1N73 A;  1GL2 A;  2OYI A;  2ZFC A;  4OH8 B;  4ZKP A;  3H1K D;  5CCH D;  1MFZ A;  1SQV D;  4LGD E;  3GLM A;  3L73 D;  4R4M A;  1NKN A;  5AW3 B;  2JEE A;  2HFE D;  4U7J A;  3RK3 B;  4GIF A;  1ZR4 A;  2AXT H;  1KQL A;  2QJP B;  3H1I G;  4YPC A;  2M3B A;  1JTH A;  4GDO A;  1JY2 O;  1QEX A;  3HD7 A;  1L0N K;  2GUS A;  2ZT9 D;  2N1T B;  3G3Z A;  1U7M A;  1ZRT D;  4TLF A;  3CCJ P;  1EDJ A;  3V4W A;  1L0N D;  3T97 A;  1AV1 A;  4XFJ A;  2J58 A;  3L35 A;  2W6B A;  1LTI C;  1QVG O;  2OTJ P;  1PPJ E;  1L0L J;  2FYN B;  2KUB A;  3RK2 D;  3H25 A;  2FFD B;  5M1B A;  1EQ7 A;  5TIS H;  1VQK P;  4W7Y A;  4AUW A;  1ZOY C;  5KTB A;  3HE5 B;  4H13 C;  1NTM J;  3M06 A;  2HOD B;  3HRN A;  4UB6 H;  3CMA P;  1FZC B;  1LTT C;  4TT3 H;  2WPS A;  4NPE A;  1UII A;  1YQ4 C;  1J1D B;  1RE3 C;  2KYV A;  2R44 A;  1N73 C;  1IZN B;  2ITA A;  3VMX A;  1T2K C;  2B9B A;  1URQ B;  1G2C B;  5AVV B;  2D2C C;  1LT9 A;  2HR3 A;  5K5G B;  2W83 C;  1N86 A;  4D6T D;  2B87 A;  3II6 A;  1JY2 P;  2IDB A;  2JWA A;  3V2Q A;  3B4S A;  2N1T D;  1USE A;  4I2L C;  1GU4 A;  1K8A Q;  2OYH C;  3CC7 P;  1BSH A;  1KFM A;  2IFM A;  1L4A A;  3H1J D;  2Q1K A;  1ZR2 A;  1JY2 N;  2D2C B;  3MGN A;  2XU6 A;  1VQO P;  4KJM A;  3TNU A;  1KN7 A;  4WBA A;  1J1D C;  2WIT A;  2JKV A;  2KIK A;  1DX7 A;  5KAI E;  2JJL A;  3L74 G;  3L70 D;  1H88 A;  1JM0 A;  2GUV A;  2V4H A;  3M0D A;  4LC1 A;  1M1J C;  3BAT A;  2H89 C;  3H1H D;  3H1L E;  2ZT9 B;  1FBM A;  2A06 E;  2IBZ I;  2WSF H;  1N2D C;  1JMB A;  2IX7 C;  3L4F A;  2IPP A;  3L75 J;  5APX A;  1Y47 A;  1RE4 C;  4ZKU A;  2WT7 A;  1YIJ P;  3D6Y A;  1PGQ A;  2OGU A;  1Q82 Q;  3GF3 A;  1J1E B;  2AEM A;  1GDT A;  1PPJ G;  1BDD A;  1KYO E;  1LNQ A;  3VYI A;  1NWQ A;  1KIL C;  1SFC D;  1XTC C;  2J59 M;  2Q3I A;  3F89 A;  3S1K A;  3CWB D;  3KZI H;  4WY4 D;  5CCG C;  2L5G B;  1OVR A;  3RBZ A;  3F5H A;  4I1L A;  1LT9 B;  4H44 B;  2G3A A;  2J5U A;  4EDF A;  2E76 C;  2Y0D A;  1PGP A;  1SQB E;  2H8P D;  3L71 J;  4JF7 A;  3L73 G;  4WY4 A;  3L74 E;  3MUD A;  1OW8 A;  2XV5 A;  1SQQ E;  4C7R A;  4YXW H;  1P84 D;  1SVF A;  5AW2 B;  1USD A;  2IZ0 A;  2YO2 A;  2I1K A;  3Q3D A;  1IJD B;  1S5L X;  3H1L G;  1FJK A;  4WVZ A;  1VQ5 P;  3H1L J;  1DEE G;  3H6P A;  3TNU B;  3HD7 C;  3I5C A;  3RL0 g;  3M0D C;  3CPW O;  4I7Z C;  4ZMD A;  1BDC A;  1SP4 A;  4K35 A;  4AQR D;  4DOJ A;  2E74 C;  1VQ8 P;  1N7L A;  1NTM G;  5DJT B;  3H1I J;  1MUU A;  3TK1 A;  5CBO A;  3EFG A;  4PJ0 E;  1JOC A;  1T3U A;  2NPS C;  2AEJ A;  1FE6 A;  3PTZ A;  4PV1 D;  3RL0 B;  3S9O A;  1YTZ T;  3B71 A;  2OYH B;  3L75 D;  1QVF O;  2E5T A;  2KLV A;  5BU8 B;  3A0B E;  1S9K D;  1BCC J;  2HOD A;  5AW1 B;  1NYH A;  1VQL P;  2NPS A;  2JDI H;  2KI7 B;  1KQG B;  2M5A A;  1Z56 A;  3E7K A;  3G6E P;  2FXM A;  3H1H E;  2WPR A;  1NTM K;  4L76 A;  5APW A;  3W67 A;  2OTL P;  3WUU A;  1N7S D;  1HVV A;  2IYP A;  3L70 G;  1HF9 A;  4W7Z A;  2WSC J;  2M8R A;  3CL3 D;  2WSF J;  2A45 H;  3CCU P;  2GM4 A;  4WY4 B;  2JR8 A;  1N7S A;  3LIE A;  2P58 A;  4GKG A;  2BCC G;  2IZ1 A;  1EDL A;  1GL2 D;  1PP9 J;  3TYY A;  1UIX A;  3CCS P;  2QE7 H;  1JUN A;  4M3L A;  3FXD A;  1JB0 J;  3RK2 B;  5TIS E;  3V4Q A;  1H8A A;  4I6M C;  4W80 A;  1LWU B;  1T6A A;  5KLV G;  1HJ0 A;  3AE4 C;  5AVS B;  3RGU A;  2WT7 B;  5L8R J;  1VQ9 P;  4DJG A;  3GMA A;  4EIJ A;  2HPC A;  3JCU H;  3CXH D;  5CCG A;  1SQQ D;  2P10 A;  4GOD A;  2PAJ A;  4GOE A;  5B5E H;  1EXJ A;  4PD4 E;  4PJ0 H;  3IR9 A;  1IK9 A;  5AW7 B;  3PP5 A;  3AE5 C;  3CC2 P;  1IFM A;  2MJZ A;  3MTU E;  2C0W A;  1AQ5 A;  2CPS A;  2IBZ D;  2WVR A;  1GD2 E;  3ITK A;  1BSN A;  1T8Z A;  4WWI A;  3Q5R A;  4IL6 E;  1VDF A;  1L0L K;  1NU1 D;  2M5A B;  1BCC E;  4OGQ C;  2BCC D;  4H44 C; 
#chains in the Genus database with same CATH homology
 1P84 I;  3L73 J;  1SQB J;  1NU1 J;  3H1I J;  1BGY J;  1SQV J;  1SQP J;  1EZV I;  3L74 J;  3CX5 I;  3CWB J;  1NTK J;  1BE3 J;  3L72 J;  1KB9 I;  2BCC J;  1KYO I;  4D6T J;  4PD4 I;  5KLV J;  1BCC J;  1SQX J;  4U3F J;  3CXH I;  3BCC J;  2FYU J;  3L70 J;  3L71 J;  1L0L J;  3H1H J;  1L0N J;  1NTZ J;  3H1K J;  3H1J J;  1SQQ J;  1NTM J;  3TGU J;  3H1L J;  3L75 J;  2IBZ I;  1PP9 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...