1KB9I

Yeast cytochrome bc1 complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
55
structure length
55
Chain Sequence
b'SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
molecule tags Oxidoreductase/electron transport
source organism Saccharomyces cerevisiae
publication title SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
pubmed doi rcsb
total genus 16
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1kb9I00
3CXHI 2FYUJ 2IBZI 3H1HJ 1NTZJ 1P84I 1SQPJ 3L75J 3L72J 3L71J 3H1IJ 1SQXJ 1BE3J 1L0NJ 4U3FJ 2BCCJ 3L73J 1SQQJ 1NTMJ 1NU1J 3TGUJ 3CX5I 1L0LJ 1KB9I 1KYOI 3CWBJ 3L74J 3H1KJ 3BCCJ 1NTKJ 3H1LJ 4PD4I 3L70J 4D6TJ 1SQBJ 3H1JJ 1EZVI 1BGYJ 1PP9J 5KLVJ 1BCCJ 1SQVJ
chains in the Genus database with same CATH superfamily
3RGUA 2N1TD 3GW6A 1YJNP 1NVOA 3HE5B 5DJUB 1BCCD 1NWQA 2O3JA 5B66E 4UB6E 1S9KE 2UWJE 4XA4A 4GDOA 2WT7B 2HPCB 3T97B 3PH0A 3M9BA 2BCCG 1KC8Q 3CCLP 5M1BA 3SSUA 4Y99B 5AW6B 1J2JB 1FC2C 2KSEA 3K5BA 2QJYC 2N9BA 4KJMA 1N7LA 3S9OA 1N73A 1QGKB 2D2CB 1VF5D 4H13B 1YITP 1DX7A 4RESB 1IFPA 3LW5H 3R4YA 2FYNC 2PAJA 3N7NA 1S9KD 5AW1B 3JCUH 2YKOA 4D6TD 1Q7YQ 3B5ND 1HJ0A 4PD4H 2WSCJ 1LTIC 1W2EA 4OGQB 1FZFA 4N6JA 2A45H 2ITAA 2IDBA 4BXLA 2H7HA 1X79B 2K9YA 5KKZB 4W7ZA 2Q3EA 1AFOA 2YNYA 4IL6H 5APXA 3H32A 3II6A 3MD0A 3RK3E 2K9JA 1PP9G 2Q9IA 3O6QA 1HTLC 1NYHA 4NPEA 2FY8A 2YO2A 2RN0A 3TYYA 3VTPC 4YXWH 3OW2O 1GTWA 4AUWA 1NH4A 3CCSP 4Z1MH 1SQQJ 3VYIA 3UIAA 4TLFA 3OA7A 2E74C 2K1AA 2NZ2A 2W6AA 3Q2YA 1IJDB 4DT0A 1S5LE 3B5NA 3H1HD 3QH9A 1VQOP 2K9JB 2QA4P 3KHUA 2YKPA 3O6QB 3PHLA 3AE6C 2OTJP 2PGDA 1OVVA 2IBZD 3W68A 1ZR2A 2WMMA 1BSHA 3D6YA 3MUDC 3TGUG 3P8CD 2XNDH 4C7RA 1NTKJ 4RO0A 4HB1A 2GM4A 2D2CC 2FXOA 3AEEC 1L0LE 3R2PA 2E76C 4ZNCA 3TDKA 1GMJA 3VMYA 1EXIA 3CCUP 1M1JB 5CCHA 1BE3E 1IFDA 1URQC 4PV1D 2KIKA 1FAVA 2FYUG 1H0TB 2KS1B 1GL2A 5APWA 3HE4B 3AE2C 3E1RA 4GIFA 2N1TB 2R5BA 3SFDC 3PLNA 5CMZA 1SQBG 5TISE 4EDFA 3PTZA 1OWAA 1FDOA 1SQVD 4U3FJ 5AVVB 1RF1C 3CCRP 3C9IA 2YKQA 3AE8C 5KAIH 5KAFH 1BDDA 2AXTH 4GODA 4B86A 3FWLA 4XFJA 3RK3B 1G1IA 3HTKA 2OYHB 1GW3A 1K04A 5KLVG 5AVTB 3RBXA 2R32A 1OXZA 3GMAA 3H1JG 1SQBD 4EI2A 1M90Q 1H8AA 1FOSF 2JWDA 2OYHC 4PD4I 2A45G 2JJLA 1W2BO 1JCCA 1GL2D 1VQ9P 3H1HE 1URQB 1OX3A 1SQXD 2LKMA 4U3FG 3L72E 3SWFA 1TU3F 2O1JA 4HJGH 1N2DC 4JF7A 3Q5SA 5C39A 5CCHC 1PGOA 1KFNA 1NTZE 3BRVB 3GHGA 3JC22 4WB4A 1NO4A 4OGQD 1KILA 1AQTA 4PD4D 5AW8B 3CCVP 2FKWB 2ZT9C 1KQSO 1P84I 1WT6A 3AE9C 3AEAC 5L8RJ 1NTMD 1KN7A 3AE4C 1ZR4A 3V2QA 1D7MA 3S4RA 1SQQD 2BCCJ 4IOIH 1PFIA 4QMAA 2A06G 5APVA 4H44B 2C9NY 1QX8A 2LXCB 3B5NC 1KILB 2QJPB 3TGUJ 2KSJA 2ZYDA 1ZW0A 3H6PA 4BRYB 1X0TA 5BU8B 1JO5A 1IC2A 2HLOA 3RK2C 1S3JA 4N78D 5CCGC 1JY3N 2Q7CA 2XNXA 1S4XA 1NU1E 3T97A 2BEZF 1ZP0C 4WVZA 2YIUC 2A06D 5BVZA 5AW4B 2ZFCA 1SQQG 2YMKA 3FX0A 5KTBA 2NRGA 2QRXA 3BRTB 3CC7P 2LR2A 5DJTB 2W83C 2E5TA 3AEBC 1G2CA 1GDTA 1LWUA 3HD7D 1BSNA 1YQ4C 4JQ0D 3SWKA 2FYUD 4HYTB 3Q5PA 1RY3A 2NPSC 4MN4C 1PIXA 1NTZK 1T6AA 1E5WA 1E79H 4PV1B 4IFDK 3A0BH 4I2LC 3FXDA 3WUTA 2KLUA 1JOCA 3H1IJ 5B5EH 1NU1D 1SP4A 3MZWB 4R4MA 5E79E 4LGDE 4ASVA 1NTKK 1JB0J 1ZRTE 3WUUA 2OYIA 5APUA 1GK4A 1G2CB 3CMAP 3IR9A 1A02F 2OTLP 1AQ5A 1IFIA 1GU5A 1SVFA 1EZVE 5BU5A 2IFMA 2O01H 3I56P 4HKZH 1M56D 3AEFC 1KB9I 1Y9BA 1FJKA 2YIUB 1JY3P 2PP6A 1J1EB 3TGUE 4M3LA 3VMXA 1VPCA 2DW3A 3GHGC 2E75C 3BCCJ 3D70A 2IBZG 1YYCA 1NTKD 2OYIB 3G3ZA 2R3SA 2WITA 1L2PA 2QVAA 1K73Q 2O01J 4O9BA 3E1IA 3KZIH 3ZDMA 1NTZD 3V5BA 1ZV8A 1SQQE 2M3BA 1N7SA 1M1KQ 1JY2N 2E42A 1NAYA 1LTSC 1VQ5P 1KILE 1Z56A 2E76D 1NU1G 1MV8A 1P84H 2QJKB 3MHVA 1KQFB 2K37A 1GW4A 1H89A 2KK7A 2WPSA 3L75J 1PP9E 2XV5A 1SQXJ 1GL2C 2MKVA 1XTCC 2W90A 3L71G 3A7OA 1DD4A 1DH3A 1RF0C 5E79H 3G4SP 3L70D 2FFDB 3CWBE 3H1LG 1N7SB 2KS1A 1Y8AA 2RKLA 2A06E 1HBWA 2LXBA 2I8DA 3HE4A 1L0LJ 5AW3B 1UIXA 4C7NB 2Z5HA 4N78E 5CCGA 5APTA 1H0TA 1BDCA 3OAKA 3L74J 5KLIB 1LT9B 2V7QJ 1SQQK 4GKGA 3BASA 2QJPC 5CJ4A 2H89C 3MTUE 1NTMK 1OVUA 4R4LA 3HTKB 2W6BA 1S2EA 2JDIH 3HUSC 1NAFA 2I1KA 1L0LK 1IFJA 3KZIE 3L4FA 3L72G 3BATA 3ITKA 1SQVE 2QG4A 1AV1A 2IBZI 3KYQA 4H0LD 4ZMDA 3A5TA 1L0LD 2VRSA 2WSEH 2WSCH 2YO3A 2ZXEB 3H1JE 3KXDA 4PD4E 2OYIC 1M57D 1VQ6P 3L35A 4ZKPA 1SQXK 2KXPB 1PGQA 1LT1A 2M3EA 2W6JH 2HR3A 2N9YB 3JSVC 3L73J 2KP8A 1KQGB 4D6TG 1NTMJ 4HH2A 4PJ0E 4YXDC 2W27A 5TISH 1SQBK 1M1JC 1VF5B 2D2CD 3EQ2A 3L75D 4H13D 3V6IA 1SQPG 2G3AA 4KT0J 2B87B 5H2FH 4JYCA 1FBMA 1KB9H 2RH0A 3EFGA 2KUBA 3L70E 3CWBJ 1OFCX 2Q6QA 1QVGO 2H43A 1ZN5A 2XU6A 1IO4A 1JM0A 3H1JD 3VMZA 1PP9D 1LTAC 1JY3O 1CZQA 2E74D 2HG5D 1SQVK 1Q82Q 1GD2E 3IF4A 4JYBA 1L0NG 1BE3G 3LIDA 5AVUB 2GUSA 2IZ0A 1FOSE 2L5GB 2IZ1A 2J58A 5AVSB 3TNUA 1FZCB 1U7JA 1PV3A 2GUVA 3CX5H 1SFCC 2G8YA 3VOPA 1N73B 2KZIA 3L71E 2WZ7A 2J59M 3IN6A 1K05A 3V2NA 4IFFA 1YJ9P 1NGMB 2KLVA 3L36A 1RH5B 1IK7A 5AVZB 3S1KA 1SFCD 4DCKA 1LTTC 2POHA 1HJBA 4U3FD 1AA0A 1QVFO 1GZLA 3TNUB 2ZVNB 3H1ID 1YHQP 3RK3C 5KJ7D 1VQKP 4XE5B 3CX5I 1LP1A 1NHLA 1UIIA 1NOHA 3CCMP 2IBZE 1ZRTD 3NFQA 4WWIA 3CC2P 1EQ7A 2HFED 3L70J 3TK1A 3IAOA 3M91A 1FZGA 3PP5A 1NU1K 1PPJG 1BGYJ 3C1LA 1X22A 3HUSA 1BCCJ 2GA1A 5CHXA 1KB9E 1L4AD 4H0LC 2CPBA 3AECC 2FYUK 3KQGA 1JY2P 3C8VA 1NTKE 3PRJA 1DIPA 1Q86Q 1Q2NA 1SS1A 1NTZJ 1QL1A 2FYNB 1BGYG 2NPSA 4JPZB 1NKZB 2P10A 5APQA 4YPCA 3RL0g 2YXQB 1NKNA 3L70G 2I1JA 2BCCD 2OARA 3RBZA 1T3JA 4I7ZB 1M1JA 1YTZI 2KYVA 2QJYB 1VQ7P 1FDMA 3CXHE 4D6TE 5GTIH 2V7QH 3P8MC 1T2KC 2E75B 1J1DC 1OVRA 5AW7B 2C9LY 1LTGC 1LNQA 1GL2B 2HYNA 5KJ7A 1R5LA 2N1TA 3WMM0 1ZMEC 2K3RA 1KTMA 1SQVG 3FWNA 3Q5RA 2MJZA 4IFMA 1DEEG 2NPSD 1Y47A 1Q81Q 4K3AA 1KB9D 2AEFA 1FZBA 1MFZA 1RQUA 2E74B 1SFCA 2WPRA 5GTHH 4C7NA 5KKZC 1S1CX 1VL2A 3PJSK 4KHXA 4OGQC 3L73E 1YIJP 1GU4A 3A2AA 2AXTE 1HWTC 3U1CA 1LT9A 2BEQD 4RJTA 1BCCE 2N1TC 3AE3C 5H2FE 1QL2A 1MFTA 1M7LA 4U3FE 3W67A 1PL5A 1RE4C 2P67A 3NTNA 5CCGD 2XKMA 2XDJA 2QM7A 2AXCA 4L73A 1SFCB 1MUUA 3AE5C 1NTZG 4YTPC 1RF0A 3CWBG 3H1LE 5AVXB 2WQYC 1FDIA 3L74D 4LC1A 2JWAA 3A0BE 3AE7C 3CXHH 2FYZA 1K9MQ 3H1HG 1LT9C 4TT3H 3RK2D 5AVWB 1VQNP 1ZOYC 3WU2H 1EDLA 1HF9A 3I5CA 1EXJA 3P32A 3CPWO 1FZAA 1MZ9A 4WY4D 2WTYA 4EYYQ 3SWYA 2IYOA 3JCUE 3L71D 3AEGC 4NPDA 3CCQP 2O1KA 2B89A 2J5UA 4WBAA 1H88A 3CXHI 1RQVA 3GG2A 2Y0CA 5AW2B 1KV4A 2P58A 4I7ZC 1EDIA 2M0BA 3H1HJ 3QWOC 3RL0D 4DJGA 5AW0B 3VMAA 1SQBE 2E43A 1U7MA 3NMDA 3U59A 4EOTA 1A02J 1VQPP 2W8ZA 1EZVG 3L74G 1MKMA 1JMBA 3L72D 1FZCA 2KNCB 2Q1KA 2P2UA 1W5CE 3CX5D 1K8AQ 3H1KG 3OJAB 1N86A 3H32B 1L0LG 4PJ0H 1NJIQ 3CMEP 1OMIA 1FS0E 1J1EC 3MGNA 5KJ7C 3HRNA 2WWWA 3F5HA 1HGZA 1LTBC 2Z5IA 2ZAEB 3H1KJ 2V4HA 2ZVOB 4OWFA 3V4QA 1SQXG 2KNCA 1KD1Q 1OZHA 2JP3A 3RK3D 1JY2O 4L74A 5KAFE 3H1KD 1SQVJ 1CI6A 1ZLLA 1DD3A 3H1LD 1HGVA 3B5NB 3EWKA 5TJHA 1OW8A 1RE4A 5GTHE 1LTJC 3P7KA 2QM8A 1USEA 3L37A 3I55P 3AE1C 2K88A 4A7PA 4U7JA 5APSA 2YXRB 3M9HA 3M0DC 1URQD 1T3UA 1OW7A 1NTMG 1L4AC 1GK6A 2L91A 3A3YB 3CL3D 4PV1C 1VDFA 1JCDA 1SLQA 3FGAD 3FXEA 1BE3D 3NXSA 4UB8H 1WMKA 1N7SD 2H8PD 3HUSB 3L73D 3F89A 1J1DB 1FE6A 1KILC 1L0NK 1LGHB 2WSEJ 1FU1A 3M06A 1N73C 3CWBD 1YTZT 4L76A 5AW9B 3B8EB 1T2KD 3P8CE 2B9BA 1ZXGA 1AVOA 4DZOA 3CI9A 2ZYGA 1HVVA 3E7KA 3V2RA 4AQRD 5APYA 1OIPA 2ZT9B 3RK2B 1VQLP 4Y28J 3CCEP 4C46A 4OVNF 1SQPK 5KLVD 1FZEA 1KILD 1LJ2A 2Y9ZA 2R3CA 2FFDA 1HH0A 1N7SC 1VQ4P 1EDKA 4CPGA 1S5LX 2OYHA 1CW5A 3A0HH 3B71A 2R44A 1S72P 2BCCE 1OW6A 2PFXA 2M5AB 3LW5J 2WPQA 3MIWA 3MUDA 1KYOH 2Z4EA 2WVRA 2QJKC 2FBWC 2WSSH 3G9RA 1G1JA 4ZKUA 5KLVE 2E5YA 1X9VA 2AEMA 3L71J 3CLQA 2R5DA 3RL0B 2OTKE 2RMZA 1LTJB 2CK3H 4BWNA 1VQMP 1FZCC 1LWUC 3HD7B 3LIEA 3CC4P 2XZRA 3KPEA 1VF5C 1NU1J 1URQA 3B4SA 4AYCA 1JEKA 1EC5A 3U1AA 1XTGB 5CBNA 3VP8A 2QIWA 3GHGB 4IL6E 1KYOI 1PZQA 2KB7P 5KAIE 1KMIZ 1LTJA 4H13C 1KZUB 1R8EA 2FYUE 3BCCG 3MP7B 4GOEA 2WT7A 1KORA 2HPCA 4BRYA 3USSA 4W7YA 3H1IE 3TSIA 1JMMA 1R5SA 1WRGA 1S5LH 1JNMA 3M0DA 2B87A 3H25A 2JEEA 3M9QA 4NPFX 2OYOA 3CCJP 1SQPJ 3VN0A 4EIJA 1N8RQ 1BCCG 2WPVB 2Q5UA 4UB8E 5B5EE 3BCCD 3L73G 1SQPD 5KLVK 1Q90D 2E76B 1QEXA 1PPJD 2Y0EA 3GF7A 3V2PA 2FFDC 2WSFJ 4UB6H 5AVYB 3CD6P 2IFNA 1YBKA 4H44D 1X8YA 2ZXXA 2Y9YA 2ZJSE 1LWUB 2O01N 3AEDC 3EFFK 1NTME 1U57A 3G6EP 1L0ND 1JTHA 3Q3DA 2ZT9D 1T8ZA 2JO1A 1SQBJ 2KOGA 2QSIA 3D71A 2P1JA 3L75E 2AEJA 3CX5E 5EFWB 4N3YB 2B88A 1FJPA 2FYUJ 1SQXE 3HD7C 1IZNB 1LP1B 4OH8B 1RHZB 1JTHB 4I6MC 3VP9A 1KYOE 4IL6X 3KDPB 5B66H 5CBOA 1BGYE 2JKVA 5CCHD 2FXPA 3GLMA 5AVQB 1NTKG 1CI6B 1BE3J 1L0NJ 2YMYA 2IYPA 4WY4C 2P7JA 3M0AA 3WUVA 4GOFA 3H1KE 4LLHA 4H0LB 3O8ZA 5CJ0A 3BVHA 1CSBA 2E75D 5GTIE 1VQ8P 3L75G 1YQ3C 3ABVC 2C0WA 2M8RA 1PPJE 3L74E 1P84E 4H44C 5AW5B 2OQQA 1IFMA 2HODB 4GT1A 1BGYD 3A0HE 5KLIC 1DEBA 4JBZA 1KYOD 1P84D 2KZJA 2NPSB 4D6TJ 3GF3A 1KQLA 3H1JJ 1PP9J 5KLVJ 4WY4A 3WU2E 1RF1B 2WSFH 2A45I 1IFNA 1KFMA 2SPZA 2HODA 3RL0C 1USDA 4W80A 1IK9A 1M8OB 2C0XA 2H88C 2KI7B 3N4XA 3G71P 1QLED 2QEXP 1RE3A 2PRRA 3L72J 1RF1A 1EDJA 1L4AA 2ZYAA 4ASWA 2Q3IA 2JR8A 3V4WA 4RKUJ 1JUNA 4DOJA 3H1IG 4I1LA 3SFEC 1HUCA 2M5AA 3TF5A 1L0NE 1YJWP 4Y99C 3IFMA 3BCCE 3D6ZA 2BASA 1AJYA 4WY4B 1RE3C 3HE5A 2CPSA 1L4AB 1YI2P 4L75A 3TGUD 5K5GB 3HD7A 3Q1MA 2FXMA 1AVYA 3H1LJ 2OGUA 2IX7C 1EZVD 2Y0DA 4K35A 2QE7H 1PGPA 1EZVI 2IPPA 1SQPE 3CXHD 5AVRB 1PGJA
chains in the Genus database with same CATH topology
3CXHI 2FYUJ 2IBZI 3H1HJ 1NTZJ 1P84I 1SQPJ 3L75J 3L72J 3L71J 3H1IJ 1SQXJ 1BE3J 1L0NJ 4U3FJ 2BCCJ 3L73J 1SQQJ 1NTMJ 1NU1J 3TGUJ 3CX5I 1L0LJ 1KB9I 1KYOI 3CWBJ 3L74J 3H1KJ 3BCCJ 1NTKJ 3H1LJ 4PD4I 3L70J 4D6TJ 1SQBJ 3H1JJ 1EZVI 1BGYJ 1PP9J 5KLVJ 1BCCJ 1SQVJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CXH I;  2FYU J;  2IBZ I;  3H1H J;  1NTZ J;  1P84 I;  1SQP J;  3L75 J;  3L72 J;  3L71 J;  3H1I J;  1SQX J;  1BE3 J;  1L0N J;  4U3F J;  2BCC J;  3L73 J;  1SQQ J;  1NTM J;  1NU1 J;  3TGU J;  3CX5 I;  1L0L J;  1KB9 I;  1KYO I;  3CWB J;  3L74 J;  3H1K J;  3BCC J;  1NTK J;  3H1L J;  4PD4 I;  3L70 J;  4D6T J;  1SQB J;  3H1J J;  1EZV I;  1BGY J;  1PP9 J;  5KLV J;  1BCC J;  1SQV J; 
#chains in the Genus database with same CATH topology
 3RGU A;  2N1T D;  3GW6 A;  1YJN P;  1NVO A;  3HE5 B;  5DJU B;  1BCC D;  1NWQ A;  2O3J A;  5B66 E;  4UB6 E;  1S9K E;  2UWJ E;  4XA4 A;  4GDO A;  2WT7 B;  2HPC B;  3T97 B;  3PH0 A;  3M9B A;  2BCC G;  1KC8 Q;  3CCL P;  5M1B A;  3SSU A;  4Y99 B;  5AW6 B;  1J2J B;  1FC2 C;  2KSE A;  3K5B A;  2QJY C;  2N9B A;  4KJM A;  1N7L A;  3S9O A;  1N73 A;  1QGK B;  2D2C B;  1VF5 D;  4H13 B;  1YIT P;  1DX7 A;  4RES B;  1IFP A;  3LW5 H;  3R4Y A;  2FYN C;  2PAJ A;  3N7N A;  1S9K D;  5AW1 B;  3JCU H;  2YKO A;  4D6T D;  1Q7Y Q;  3B5N D;  1HJ0 A;  4PD4 H;  2WSC J;  1LTI C;  1W2E A;  4OGQ B;  1FZF A;  4N6J A;  2A45 H;  2ITA A;  2IDB A;  4BXL A;  2H7H A;  1X79 B;  2K9Y A;  5KKZ B;  4W7Z A;  2Q3E A;  1AFO A;  2YNY A;  4IL6 H;  5APX A;  3H32 A;  3II6 A;  3MD0 A;  3RK3 E;  2K9J A;  1PP9 G;  2Q9I A;  3O6Q A;  1HTL C;  1NYH A;  4NPE A;  2FY8 A;  2YO2 A;  2RN0 A;  3TYY A;  3VTP C;  4YXW H;  3OW2 O;  1GTW A;  4AUW A;  1NH4 A;  3CCS P;  4Z1M H;  1SQQ J;  3VYI A;  3UIA A;  4TLF A;  3OA7 A;  2E74 C;  2K1A A;  2NZ2 A;  2W6A A;  3Q2Y A;  1IJD B;  4DT0 A;  1S5L E;  3B5N A;  3H1H D;  3QH9 A;  1VQO P;  2K9J B;  2QA4 P;  3KHU A;  2YKP A;  3O6Q B;  3PHL A;  3AE6 C;  2OTJ P;  2PGD A;  1OVV A;  2IBZ D;  3W68 A;  1ZR2 A;  2WMM A;  1BSH A;  3D6Y A;  3MUD C;  3TGU G;  3P8C D;  2XND H;  4C7R A;  1NTK J;  4RO0 A;  4HB1 A;  2GM4 A;  2D2C C;  2FXO A;  3AEE C;  1L0L E;  3R2P A;  2E76 C;  4ZNC A;  3TDK A;  1GMJ A;  3VMY A;  1EXI A;  3CCU P;  1M1J B;  5CCH A;  1BE3 E;  1IFD A;  1URQ C;  4PV1 D;  2KIK A;  1FAV A;  2FYU G;  1H0T B;  2KS1 B;  1GL2 A;  5APW A;  3HE4 B;  3AE2 C;  3E1R A;  4GIF A;  2N1T B;  2R5B A;  3SFD C;  3PLN A;  5CMZ A;  1SQB G;  5TIS E;  4EDF A;  3PTZ A;  1OWA A;  1FDO A;  1SQV D;  4U3F J;  5AVV B;  1RF1 C;  3CCR P;  3C9I A;  2YKQ A;  3AE8 C;  5KAI H;  5KAF H;  1BDD A;  2AXT H;  4GOD A;  4B86 A;  3FWL A;  4XFJ A;  3RK3 B;  1G1I A;  3HTK A;  2OYH B;  1GW3 A;  1K04 A;  5KLV G;  5AVT B;  3RBX A;  2R32 A;  1OXZ A;  3GMA A;  3H1J G;  1SQB D;  4EI2 A;  1M90 Q;  1H8A A;  1FOS F;  2JWD A;  2OYH C;  4PD4 I;  2A45 G;  2JJL A;  1W2B O;  1JCC A;  1GL2 D;  1VQ9 P;  3H1H E;  1URQ B;  1OX3 A;  1SQX D;  2LKM A;  4U3F G;  3L72 E;  3SWF A;  1TU3 F;  2O1J A;  4HJG H;  1N2D C;  4JF7 A;  3Q5S A;  5C39 A;  5CCH C;  1PGO A;  1KFN A;  1NTZ E;  3BRV B;  3GHG A;  3JC2 2;  4WB4 A;  1NO4 A;  4OGQ D;  1KIL A;  1AQT A;  4PD4 D;  5AW8 B;  3CCV P;  2FKW B;  2ZT9 C;  1KQS O;  1P84 I;  1WT6 A;  3AE9 C;  3AEA C;  5L8R J;  1NTM D;  1KN7 A;  3AE4 C;  1ZR4 A;  3V2Q A;  1D7M A;  3S4R A;  1SQQ D;  2BCC J;  4IOI H;  1PFI A;  4QMA A;  2A06 G;  5APV A;  4H44 B;  2C9N Y;  1QX8 A;  2LXC B;  3B5N C;  1KIL B;  2QJP B;  3TGU J;  2KSJ A;  2ZYD A;  1ZW0 A;  3H6P A;  4BRY B;  1X0T A;  5BU8 B;  1JO5 A;  1IC2 A;  2HLO A;  3RK2 C;  1S3J A;  4N78 D;  5CCG C;  1JY3 N;  2Q7C A;  2XNX A;  1S4X A;  1NU1 E;  3T97 A;  2BEZ F;  1ZP0 C;  4WVZ A;  2YIU C;  2A06 D;  5BVZ A;  5AW4 B;  2ZFC A;  1SQQ G;  2YMK A;  3FX0 A;  5KTB A;  2NRG A;  2QRX A;  3BRT B;  3CC7 P;  2LR2 A;  5DJT B;  2W83 C;  2E5T A;  3AEB C;  1G2C A;  1GDT A;  1LWU A;  3HD7 D;  1BSN A;  1YQ4 C;  4JQ0 D;  3SWK A;  2FYU D;  4HYT B;  3Q5P A;  1RY3 A;  2NPS C;  4MN4 C;  1PIX A;  1NTZ K;  1T6A A;  1E5W A;  1E79 H;  4PV1 B;  4IFD K;  3A0B H;  4I2L C;  3FXD A;  3WUT A;  2KLU A;  1JOC A;  3H1I J;  5B5E H;  1NU1 D;  1SP4 A;  3MZW B;  4R4M A;  5E79 E;  4LGD E;  4ASV A;  1NTK K;  1JB0 J;  1ZRT E;  3WUU A;  2OYI A;  5APU A;  1GK4 A;  1G2C B;  3CMA P;  3IR9 A;  1A02 F;  2OTL P;  1AQ5 A;  1IFI A;  1GU5 A;  1SVF A;  1EZV E;  5BU5 A;  2IFM A;  2O01 H;  3I56 P;  4HKZ H;  1M56 D;  3AEF C;  1KB9 I;  1Y9B A;  1FJK A;  2YIU B;  1JY3 P;  2PP6 A;  1J1E B;  3TGU E;  4M3L A;  3VMX A;  1VPC A;  2DW3 A;  3GHG C;  2E75 C;  3BCC J;  3D70 A;  2IBZ G;  1YYC A;  1NTK D;  2OYI B;  3G3Z A;  2R3S A;  2WIT A;  1L2P A;  2QVA A;  1K73 Q;  2O01 J;  4O9B A;  3E1I A;  3KZI H;  3ZDM A;  1NTZ D;  3V5B A;  1ZV8 A;  1SQQ E;  2M3B A;  1N7S A;  1M1K Q;  1JY2 N;  2E42 A;  1NAY A;  1LTS C;  1VQ5 P;  1KIL E;  1Z56 A;  2E76 D;  1NU1 G;  1MV8 A;  1P84 H;  2QJK B;  3MHV A;  1KQF B;  2K37 A;  1GW4 A;  1H89 A;  2KK7 A;  2WPS A;  3L75 J;  1PP9 E;  2XV5 A;  1SQX J;  1GL2 C;  2MKV A;  1XTC C;  2W90 A;  3L71 G;  3A7O A;  1DD4 A;  1DH3 A;  1RF0 C;  5E79 H;  3G4S P;  3L70 D;  2FFD B;  3CWB E;  3H1L G;  1N7S B;  2KS1 A;  1Y8A A;  2RKL A;  2A06 E;  1HBW A;  2LXB A;  2I8D A;  3HE4 A;  1L0L J;  5AW3 B;  1UIX A;  4C7N B;  2Z5H A;  4N78 E;  5CCG A;  5APT A;  1H0T A;  1BDC A;  3OAK A;  3L74 J;  5KLI B;  1LT9 B;  2V7Q J;  1SQQ K;  4GKG A;  3BAS A;  2QJP C;  5CJ4 A;  2H89 C;  3MTU E;  1NTM K;  1OVU A;  4R4L A;  3HTK B;  2W6B A;  1S2E A;  2JDI H;  3HUS C;  1NAF A;  2I1K A;  1L0L K;  1IFJ A;  3KZI E;  3L4F A;  3L72 G;  3BAT A;  3ITK A;  1SQV E;  2QG4 A;  1AV1 A;  2IBZ I;  3KYQ A;  4H0L D;  4ZMD A;  3A5T A;  1L0L D;  2VRS A;  2WSE H;  2WSC H;  2YO3 A;  2ZXE B;  3H1J E;  3KXD A;  4PD4 E;  2OYI C;  1M57 D;  1VQ6 P;  3L35 A;  4ZKP A;  1SQX K;  2KXP B;  1PGQ A;  1LT1 A;  2M3E A;  2W6J H;  2HR3 A;  2N9Y B;  3JSV C;  3L73 J;  2KP8 A;  1KQG B;  4D6T G;  1NTM J;  4HH2 A;  4PJ0 E;  4YXD C;  2W27 A;  5TIS H;  1SQB K;  1M1J C;  1VF5 B;  2D2C D;  3EQ2 A;  3L75 D;  4H13 D;  3V6I A;  1SQP G;  2G3A A;  4KT0 J;  2B87 B;  5H2F H;  4JYC A;  1FBM A;  1KB9 H;  2RH0 A;  3EFG A;  2KUB A;  3L70 E;  3CWB J;  1OFC X;  2Q6Q A;  1QVG O;  2H43 A;  1ZN5 A;  2XU6 A;  1IO4 A;  1JM0 A;  3H1J D;  3VMZ A;  1PP9 D;  1LTA C;  1JY3 O;  1CZQ A;  2E74 D;  2HG5 D;  1SQV K;  1Q82 Q;  1GD2 E;  3IF4 A;  4JYB A;  1L0N G;  1BE3 G;  3LID A;  5AVU B;  2GUS A;  2IZ0 A;  1FOS E;  2L5G B;  2IZ1 A;  2J58 A;  5AVS B;  3TNU A;  1FZC B;  1U7J A;  1PV3 A;  2GUV A;  3CX5 H;  1SFC C;  2G8Y A;  3VOP A;  1N73 B;  2KZI A;  3L71 E;  2WZ7 A;  2J59 M;  3IN6 A;  1K05 A;  3V2N A;  4IFF A;  1YJ9 P;  1NGM B;  2KLV A;  3L36 A;  1RH5 B;  1IK7 A;  5AVZ B;  3S1K A;  1SFC D;  4DCK A;  1LTT C;  2POH A;  1HJB A;  4U3F D;  1AA0 A;  1QVF O;  1GZL A;  3TNU B;  2ZVN B;  3H1I D;  1YHQ P;  3RK3 C;  5KJ7 D;  1VQK P;  4XE5 B;  3CX5 I;  1LP1 A;  1NHL A;  1UII A;  1NOH A;  3CCM P;  2IBZ E;  1ZRT D;  3NFQ A;  4WWI A;  3CC2 P;  1EQ7 A;  2HFE D;  3L70 J;  3TK1 A;  3IAO A;  3M91 A;  1FZG A;  3PP5 A;  1NU1 K;  1PPJ G;  1BGY J;  3C1L A;  1X22 A;  3HUS A;  1BCC J;  2GA1 A;  5CHX A;  1KB9 E;  1L4A D;  4H0L C;  2CPB A;  3AEC C;  2FYU K;  3KQG A;  1JY2 P;  3C8V A;  1NTK E;  3PRJ A;  1DIP A;  1Q86 Q;  1Q2N A;  1SS1 A;  1NTZ J;  1QL1 A;  2FYN B;  1BGY G;  2NPS A;  4JPZ B;  1NKZ B;  2P10 A;  5APQ A;  4YPC A;  3RL0 g;  2YXQ B;  1NKN A;  3L70 G;  2I1J A;  2BCC D;  2OAR A;  3RBZ A;  1T3J A;  4I7Z B;  1M1J A;  1YTZ I;  2KYV A;  2QJY B;  1VQ7 P;  1FDM A;  3CXH E;  4D6T E;  5GTI H;  2V7Q H;  3P8M C;  1T2K C;  2E75 B;  1J1D C;  1OVR A;  5AW7 B;  2C9L Y;  1LTG C;  1LNQ A;  1GL2 B;  2HYN A;  5KJ7 A;  1R5L A;  2N1T A;  3WMM 0;  1ZME C;  2K3R A;  1KTM A;  1SQV G;  3FWN A;  3Q5R A;  2MJZ A;  4IFM A;  1DEE G;  2NPS D;  1Y47 A;  1Q81 Q;  4K3A A;  1KB9 D;  2AEF A;  1FZB A;  1MFZ A;  1RQU A;  2E74 B;  1SFC A;  2WPR A;  5GTH H;  4C7N A;  5KKZ C;  1S1C X;  1VL2 A;  3PJS K;  4KHX A;  4OGQ C;  3L73 E;  1YIJ P;  1GU4 A;  3A2A A;  2AXT E;  1HWT C;  3U1C A;  1LT9 A;  2BEQ D;  4RJT A;  1BCC E;  2N1T C;  3AE3 C;  5H2F E;  1QL2 A;  1MFT A;  1M7L A;  4U3F E;  3W67 A;  1PL5 A;  1RE4 C;  2P67 A;  3NTN A;  5CCG D;  2XKM A;  2XDJ A;  2QM7 A;  2AXC A;  4L73 A;  1SFC B;  1MUU A;  3AE5 C;  1NTZ G;  4YTP C;  1RF0 A;  3CWB G;  3H1L E;  5AVX B;  2WQY C;  1FDI A;  3L74 D;  4LC1 A;  2JWA A;  3A0B E;  3AE7 C;  3CXH H;  2FYZ A;  1K9M Q;  3H1H G;  1LT9 C;  4TT3 H;  3RK2 D;  5AVW B;  1VQN P;  1ZOY C;  3WU2 H;  1EDL A;  1HF9 A;  3I5C A;  1EXJ A;  3P32 A;  3CPW O;  1FZA A;  1MZ9 A;  4WY4 D;  2WTY A;  4EYY Q;  3SWY A;  2IYO A;  3JCU E;  3L71 D;  3AEG C;  4NPD A;  3CCQ P;  2O1K A;  2B89 A;  2J5U A;  4WBA A;  1H88 A;  3CXH I;  1RQV A;  3GG2 A;  2Y0C A;  5AW2 B;  1KV4 A;  2P58 A;  4I7Z C;  1EDI A;  2M0B A;  3H1H J;  3QWO C;  3RL0 D;  4DJG A;  5AW0 B;  3VMA A;  1SQB E;  2E43 A;  1U7M A;  3NMD A;  3U59 A;  4EOT A;  1A02 J;  1VQP P;  2W8Z A;  1EZV G;  3L74 G;  1MKM A;  1JMB A;  3L72 D;  1FZC A;  2KNC B;  2Q1K A;  2P2U A;  1W5C E;  3CX5 D;  1K8A Q;  3H1K G;  3OJA B;  1N86 A;  3H32 B;  1L0L G;  4PJ0 H;  1NJI Q;  3CME P;  1OMI A;  1FS0 E;  1J1E C;  3MGN A;  5KJ7 C;  3HRN A;  2WWW A;  3F5H A;  1HGZ A;  1LTB C;  2Z5I A;  2ZAE B;  3H1K J;  2V4H A;  2ZVO B;  4OWF A;  3V4Q A;  1SQX G;  2KNC A;  1KD1 Q;  1OZH A;  2JP3 A;  3RK3 D;  1JY2 O;  4L74 A;  5KAF E;  3H1K D;  1SQV J;  1CI6 A;  1ZLL A;  1DD3 A;  3H1L D;  1HGV A;  3B5N B;  3EWK A;  5TJH A;  1OW8 A;  1RE4 A;  5GTH E;  1LTJ C;  3P7K A;  2QM8 A;  1USE A;  3L37 A;  3I55 P;  3AE1 C;  2K88 A;  4A7P A;  4U7J A;  5APS A;  2YXR B;  3M9H A;  3M0D C;  1URQ D;  1T3U A;  1OW7 A;  1NTM G;  1L4A C;  1GK6 A;  2L91 A;  3A3Y B;  3CL3 D;  4PV1 C;  1VDF A;  1JCD A;  1SLQ A;  3FGA D;  3FXE A;  1BE3 D;  3NXS A;  4UB8 H;  1WMK A;  1N7S D;  2H8P D;  3HUS B;  3L73 D;  3F89 A;  1J1D B;  1FE6 A;  1KIL C;  1L0N K;  1LGH B;  2WSE J;  1FU1 A;  3M06 A;  1N73 C;  3CWB D;  1YTZ T;  4L76 A;  5AW9 B;  3B8E B;  1T2K D;  3P8C E;  2B9B A;  1ZXG A;  1AVO A;  4DZO A;  3CI9 A;  2ZYG A;  1HVV A;  3E7K A;  3V2R A;  4AQR D;  5APY A;  1OIP A;  2ZT9 B;  3RK2 B;  1VQL P;  4Y28 J;  3CCE P;  4C46 A;  4OVN F;  1SQP K;  5KLV D;  1FZE A;  1KIL D;  1LJ2 A;  2Y9Z A;  2R3C A;  2FFD A;  1HH0 A;  1N7S C;  1VQ4 P;  1EDK A;  4CPG A;  1S5L X;  2OYH A;  1CW5 A;  3A0H H;  3B71 A;  2R44 A;  1S72 P;  2BCC E;  1OW6 A;  2PFX A;  2M5A B;  3LW5 J;  2WPQ A;  3MIW A;  3MUD A;  1KYO H;  2Z4E A;  2WVR A;  2QJK C;  2FBW C;  2WSS H;  3G9R A;  1G1J A;  4ZKU A;  5KLV E;  2E5Y A;  1X9V A;  2AEM A;  3L71 J;  3CLQ A;  2R5D A;  3RL0 B;  2OTK E;  2RMZ A;  1LTJ B;  2CK3 H;  4BWN A;  1VQM P;  1FZC C;  1LWU C;  3HD7 B;  3LIE A;  3CC4 P;  2XZR A;  3KPE A;  1VF5 C;  1NU1 J;  1URQ A;  3B4S A;  4AYC A;  1JEK A;  1EC5 A;  3U1A A;  1XTG B;  5CBN A;  3VP8 A;  2QIW A;  3GHG B;  4IL6 E;  1KYO I;  1PZQ A;  2KB7 P;  5KAI E;  1KMI Z;  1LTJ A;  4H13 C;  1KZU B;  1R8E A;  2FYU E;  3BCC G;  3MP7 B;  4GOE A;  2WT7 A;  1KOR A;  2HPC A;  4BRY A;  3USS A;  4W7Y A;  3H1I E;  3TSI A;  1JMM A;  1R5S A;  1WRG A;  1S5L H;  1JNM A;  3M0D A;  2B87 A;  3H25 A;  2JEE A;  3M9Q A;  4NPF X;  2OYO A;  3CCJ P;  1SQP J;  3VN0 A;  4EIJ A;  1N8R Q;  1BCC G;  2WPV B;  2Q5U A;  4UB8 E;  5B5E E;  3BCC D;  3L73 G;  1SQP D;  5KLV K;  1Q90 D;  2E76 B;  1QEX A;  1PPJ D;  2Y0E A;  3GF7 A;  3V2P A;  2FFD C;  2WSF J;  4UB6 H;  5AVY B;  3CD6 P;  2IFN A;  1YBK A;  4H44 D;  1X8Y A;  2ZXX A;  2Y9Y A;  2ZJS E;  1LWU B;  2O01 N;  3AED C;  3EFF K;  1NTM E;  1U57 A;  3G6E P;  1L0N D;  1JTH A;  3Q3D A;  2ZT9 D;  1T8Z A;  2JO1 A;  1SQB J;  2KOG A;  2QSI A;  3D71 A;  2P1J A;  3L75 E;  2AEJ A;  3CX5 E;  5EFW B;  4N3Y B;  2B88 A;  1FJP A;  2FYU J;  1SQX E;  3HD7 C;  1IZN B;  1LP1 B;  4OH8 B;  1RHZ B;  1JTH B;  4I6M C;  3VP9 A;  1KYO E;  4IL6 X;  3KDP B;  5B66 H;  5CBO A;  1BGY E;  2JKV A;  5CCH D;  2FXP A;  3GLM A;  5AVQ B;  1NTK G;  1CI6 B;  1BE3 J;  1L0N J;  2YMY A;  2IYP A;  4WY4 C;  2P7J A;  3M0A A;  3WUV A;  4GOF A;  3H1K E;  4LLH A;  4H0L B;  3O8Z A;  5CJ0 A;  3BVH A;  1CSB A;  2E75 D;  5GTI E;  1VQ8 P;  3L75 G;  1YQ3 C;  3ABV C;  2C0W A;  2M8R A;  1PPJ E;  3L74 E;  1P84 E;  4H44 C;  5AW5 B;  2OQQ A;  1IFM A;  2HOD B;  4GT1 A;  1BGY D;  3A0H E;  5KLI C;  1DEB A;  4JBZ A;  1KYO D;  1P84 D;  2KZJ A;  2NPS B;  4D6T J;  3GF3 A;  1KQL A;  3H1J J;  1PP9 J;  5KLV J;  4WY4 A;  3WU2 E;  1RF1 B;  2WSF H;  2A45 I;  1IFN A;  1KFM A;  2SPZ A;  2HOD A;  3RL0 C;  1USD A;  4W80 A;  1IK9 A;  1M8O B;  2C0X A;  2H88 C;  2KI7 B;  3N4X A;  3G71 P;  1QLE D;  2QEX P;  1RE3 A;  2PRR A;  3L72 J;  1RF1 A;  1EDJ A;  1L4A A;  2ZYA A;  4ASW A;  2Q3I A;  2JR8 A;  3V4W A;  4RKU J;  1JUN A;  4DOJ A;  3H1I G;  4I1L A;  3SFE C;  1HUC A;  2M5A A;  3TF5 A;  1L0N E;  1YJW P;  4Y99 C;  3IFM A;  3BCC E;  3D6Z A;  2BAS A;  1AJY A;  4WY4 B;  1RE3 C;  3HE5 A;  2CPS A;  1L4A B;  1YI2 P;  4L75 A;  3TGU D;  5K5G B;  3HD7 A;  3Q1M A;  2FXM A;  1AVY A;  3H1L J;  2OGU A;  2IX7 C;  1EZV D;  2Y0D A;  4K35 A;  2QE7 H;  1PGP A;  1EZV I;  2IPP A;  1SQP E;  3CXH D;  5AVR B;  1PGJ A; 
#chains in the Genus database with same CATH homology
 3CXH I;  2FYU J;  2IBZ I;  3H1H J;  1NTZ J;  1P84 I;  1SQP J;  3L75 J;  3L72 J;  3L71 J;  3H1I J;  1SQX J;  1BE3 J;  1L0N J;  4U3F J;  2BCC J;  3L73 J;  1SQQ J;  1NTM J;  1NU1 J;  3TGU J;  3CX5 I;  1L0L J;  1KB9 I;  1KYO I;  3CWB J;  3L74 J;  3H1K J;  3BCC J;  1NTK J;  3H1L J;  4PD4 I;  3L70 J;  4D6T J;  1SQB J;  3H1J J;  1EZV I;  1BGY J;  1PP9 J;  5KLV J;  1BCC J;  1SQV J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...