1KB9I

Yeast cytochrome bc1 complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
55
structure length
55
Chain Sequence
SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
total genus 16
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1kb9I00
3L74J 3L71J 4U3FJ 1BGYJ 1SQQJ 2BCCJ 1BCCJ 1L0LJ 1L0NJ 1KYOI 1SQVJ 1SQBJ 1BE3J 3H1HJ 4D6TJ 1KB9I 5KLVJ 1SQPJ 1P84I 2IBZI 1NTZJ 3H1IJ 4PD4I 3L72J 3H1LJ 3L70J 2FYUJ 1EZVI 1NU1J 3H1KJ 3H1JJ 3TGUJ 3CX5I 3L73J 1SQXJ 3CXHI 1NTMJ 1NTKJ 3BCCJ 3L75J 3CWBJ 1PP9J
chains in the Genus database with same CATH superfamily
1OW8A 3GMAA 3L75G 4U3FD 3L4FA 1U7JA 1VF5D 4C46A 2A45G 3L35A 3CXHI 1JNMA 5APWA 1VQKP 5KJ7A 1HUCA 1J1DC 2E75D 2KB7P 3TGUG 2I1KA 1NTMD 1AQTA 5KLVE 3A3YB 1VQ6P 2YXQB 3CCRP 1DEEG 4Y28J 3BASA 1EDJA 1BE3G 3RK2D 1RQVA 1J1EC 2R5BA 1KV4A 2ZXXA 3FGAD 5APUA 3A5TA 2FKWB 1FZBA 2W6BA 5CCHC 1A02J 1IZNB 3HTKB 2AEMA 3VTPC 1QVFO 2Z5IA 1JOCA 1VQ4P 3Q2YA 3LIEA 2ZT9D 2YNYA 1XTCC 1QL2A 5H2FH 3QH9A 2FYNC 1FS0E 1L4AC 3HE4A 4TT3H 3A2AA 2M5AA 1RH5B 1S5LH 3RGUA 1VDFA 4OH8B 1NTZG 2W27A 1ZR2A 3H25A 1WRGA 3U59A 3H1KD 1SQQJ 5CBNA 3CLQA 3WUVA 1LWUC 2V7QH 2RKLA 2NPSB 3H1HD 3Q3DA 5AVRB 1ZOYC 4WY4C 1K8AQ 4GDOA 4R4LA 4ZNCA 3RL0D 3UIAA 3HD7A 1GZLA 2FXOA 1G2CB 1JY3N 3L73D 1NTKD 1P84I 2BASA 1T3UA 3MD0A 1JY3P 2Q7CA 2KZIA 3MGNA 1SQPD 1IC2A 2WSEH 2R5DA 5E79E 2FYUD 2BCCG 1EZVD 1VPCA 2OGUA 3G71P 5AW2B 2ZAEB 5KLVG 2N9BA 3HUSB 3PLNA 1M90Q 1RE3C 3MHVA 4HYTB 1RF1C 1MZ9A 2HYNA 3L74E 1VQNP 3SWFA 4EOTA 1L0NJ 1HGVA 1SQQK 2LKMA 1L0LD 3I5CA 1DH3A 1KB9E 1X79B 2YIUB 2Y9YA 2WSEJ 1X8YA 2CPBA 1R8EA 2YMKA 3BCCJ 3MTUE 1PP9J 1LNQA 3C1LA 1PGQA 1KYOI 4D6TE 2A06D 1SFCC 3CXHD 4OGQB 4JF7A 4JYBA 2D2CD 3HE5A 1LP1A 2B89A 1MFZA 2H7HA 1BCCJ 4L73A 1H89A 4GOFA 3VMAA 2WMMA 2FXPA 1PV3A 3FWLA 4Y99C 2P10A 2B87B 2KNCA 1YQ4C 1Y8AA 3H1JD 3SFDC 3P8CE 1LT9C 1M8OB 2VRSA 4CPGA 2AXTH 1URQC 4DCKA 5AW3B 2E5TA 2O01N 1GL2C 1UIIA 1KILB 3MZWB 4KJMA 5GTHH 1UIXA 2AEFA 1M57D 4U3FJ 5EFWB 3A0BE 3V4WA 1IFNA 2KI7B 2QJKB 2W8ZA 1BSHA 1FZEA 1VQMP 4N6JA 4N78D 4AYCA 1USEA 3RK3E 2WITA 1NTMJ 1LWUA 1SP4A 5H2FE 3PH0A 3PP5A 2K88A 3L74G 1YHQP 1KILE 1JY2P 4WY4A 4H44B 2XNDH 2IFNA 1OFCX 1IFPA 1N7SC 2A45I 1P84D 3M06A 1EC5A 4EYYQ 3IR9A 3CCMP 1FZFA 2OTLP 3U1CA 1PPJG 1JB0J 2O01J 1IK7A 1K73Q 4JQ0D 3M0AA 4D6TG 2QVAA 2QA4P 1NU1E 2IBZE 3LIDA 2E74C 4WB4A 1NOHA 3CWBD 2K1AA 3MIWA 1LTAC 1RE3A 3IF4A 3EFFK 1RF1A 4OGQD 3G6EP 4R4MA 3MUDA 1ZMEC 2K37A 3O6QA 1RHZB 3B71A 3VMZA 3RL0g 5CCHD 1KORA 1NTMK 3OW2O 3H1HJ 1X9VA 3C8VA 2L5GB 2OYOA 2GA1A 5AVZB 1USDA 5TISH 3C9IA 2KUBA 3NMDA 1BDDA 2POHA 3M9BA 1R5LA 1AJYA 1PGOA 1T6AA 1S2EA 3CX5I 3BRTB 2HODA 1KYOD 3LW5H 1SFCA 1T2KC 3TDKA 3O8ZA 1KN7A 1SQPJ 1L4AD 1M1JA 3GF3A 2QE7H 5APSA 3KYQA 5KKZB 3T97A 1FE6A 3GLMA 1GK4A 1QLED 3V6IA 3CXHH 1OIPA 3V4QA 1HH0A 3K5BA 2MJZA 4WBAA 1L0ND 4K3AA 1PL5A 1KZUB 2WPRA 1LT9A 1L0LJ 3F89A 1URQA 3BCCD 3FXEA 3JCUH 1GL2A 1CI6A 3H1LE 5AW7B 1MV8A 3VP9A 2NPSC 1MKMA 3M0DC 5L8RJ 3GW6A 4W7ZA 1NU1G 2N1TB 2KIKA 3SWYA 2IBZG 3JSVC 1SQXD 1ZN5A 2WSCH 1BDCA 1NTKK 4IL6X 3CCUP 1H8AA 1BCCD 1SQPK 3V2QA 2M0BA 3KDPB 3H1ID 2OYHB 5GTHE 1QL1A 2FYZA 3AE4C 2FYUK 2SPZA 1DD3A 3V2NA 3PJSK 1RY3A 1R5SA 2P7JA 3V2RA 1FZGA 1Q82Q 3CI9A 3L75D 2ZFCA 2FFDB 2JJLA 4QMAA 3L70E 1N7SA 3CL3D 3ABVC 3H1JJ 3HUSC 2QJYB 2RMZA 1GW4A 1T8ZA 2J5UA 1FZCB 2WSCJ 4C7NB 1DD4A 2DW3A 1AVYA 1L0LK 1SFCD 1AA0A 3AE2C 1HWTC 3H1KE 2YIUC 2QRXA 2H43A 1PZQA 1BGYE 2O3JA 1YI2P 2B9BA 3H1HE 4RKUJ 3V2PA 1VQ8P 1PGJA 2IYOA 5B66E 3WUTA 4JYCA 4OGQC 1Y47A 1GD2E 3L73E 2ZXEB 2OQQA 1NTKE 1XTGB 4L74A 2P2UA 2XZRA 2V4HA 1SQBE 1SQVE 2XKMA 1N73A 4UB6H 1K05A 3W67A 3CX5D 1URQD 2YKOA 2FYUE 4TLFA 1HGZA 1GL2D 1NTZD 3BRVB 3H1LG 3HTKA 4L75A 1JY3O 3AEBC 3L71J 1VQ7P 5KTBA 2KS1B 1EXIA 5TISE 4H0LB 1ZXGA 3FXDA 1KILC 1L2PA 4M3LA 3IFMA 1LTBC 3CWBJ 2YXRB 2WQYC 1MUUA 1NJIQ 3VMXA 5AW6B 1KB9I 2QJKC 2YO2A 5CHXA 1VQOP 2W90A 3BATA 1WT6A 3HRNA 1JMBA 3L70G 1N7SD 1N86A 1OVRA 4PV1B 2OTJP 4LC1A 3SFEC 4BXLA 5KLIB 2PFXA 2NPSA 3CXHE 5AVVB 1FAVA 1GK6A 2BCCD 3M0DA 4ASWA 3ZDMA 4YTPC 5CMZA 3HD7B 3P7KA 2WPSA 1K04A 1H0TA 4H44C 2BEZF 5KLVD 2E74D 4GIFA 1G2CA 2J59M 1FDMA 3WUUA 1HBWA 3JCUE 4UB8E 3L36A 4LGDE 4BRYB 1BGYG 1N8RQ 1JEKA 2E42A 3Q5SA 1LTJA 2W6AA 2KXPB 2IX7C 1QGKB 1QEXA 2L91A 1LTIC 1NTKG 2XNXA 1GU4A 3HUSA 5BVZA 2FXMA 1YTZT 1SQVG 1SQBG 1FDIA 1VL2A 1QX8A 2FYUG 3WMM0 3M91A 3VP8A 1FU1A 3D6YA 3I56P 1T2KD 2RH0A 1NKNA 1NAFA 3NFQA 2UWJE 5APYA 2WPQA 1LGHB 2A45H 2CPSA 3L72J 2H89C 5AVUB 3II6A 3H32B 1SQXJ 4W80A 5B5EH 1NKZB 4PJ0H 2KSJA 2HPCB 2YO3A 1DX7A 2MKVA 1LP1B 1RQUA 5M1BA 3H1IJ 2JO1A 4HH2A 3VN0A 2P1JA 2LXCB 5CCHA 3AEEC 5KKZC 3WU2H 4AUWA 3N7NA 3L75J 4H13B 3AE1C 3AE6C 2GUVA 2KNCB 1Q7YQ 3RK3B 1M1KQ 3TSIA 3CD6P 2IBZI 2B87A 1L0NK 2NPSD 1JTHB 4N3YB 1S72P 3TGUJ 4ZMDA 3PHLA 4I1LA 3OJAB 1SQQE 1L4AA 4IL6H 1KQSO 3H6PA 1BE3J 3CX5H 3L74D 4UB6E 3B4SA 2O01H 1PFIA 3KHUA 4I7ZB 3KXDA 1VQ9P 5CJ4A 3CCVP 1KB9D 2N1TC 3CCLP 1SQXK 1ZLLA 1KFNA 1JY2N 4I6MC 3RBZA 4IFMA 5CCGC 1PPJD 5APTA 1HJ0A 1S5LE 4D6TD 2JR8A 1LJ2A 1OW7A 2OYHC 3F5HA 2XDJA 3RBXA 3BVHA 1N7LA 1Y9BA 3B5NB 1NTZJ 4HKZH 3L71D 2YMYA 1EDIA 2FFDC 3KQGA 2YKQA 2QJYC 3SWKA 5AVYB 3TF5A 1FZCC 5AW9B 1L0NE 3Q5RA 1IO4A 3GHGB 3P8CD 1NYHA 1FC2C 4DT0A 2QJPB 1JCDA 3BCCE 3M9HA 3AE3C 1YYCA 1PP9E 3AE8C 4O9BA 3CCJP 2E76B 3I55P 1OW6A 3P8MC 1RF0C 1M7LA 2ZVOB 2HG5D 3KZIH 2C0XA 1E79H 3JC22 4U7JA 1ZP0C 2OYIB 2BCCJ 1YJNP 3AE7C 3CCEP 1BCCE 5KAFH 3SSUA 5KLVJ 4IFDK 2OTKE 2ZVNB 1SQQG 2G3AA 1VF5B 1A02F 3EFGA 1M1JB 1KILD 1IFDA 1FZAA 1PGPA 2QEXP 3TNUA 1FDOA 1HF9A 2E75B 1OVUA 5TJHA 1AFOA 2C9NY 4ZKUA 3AEFC 4PD4I 2WWWA 4HB1A 4EIJA 4H0LC 1HTLC 3RK2B 1M56D 5APXA 1VQ5P 1JM0A 5CJ0A 5B5EE 5AW5B 4PJ0E 3CMEP 1NU1D 3PRJA 4U3FE 2C9LY 2IBZD 1EXJA 2ITAA 1G1JA 4OWFA 4H44D 2QM7A 4W7YA 3L72D 1NTME 2ZT9B 2E5YA 1JO5A 5E79H 4PV1C 4WVZA 1NGMB 5KLIC 3S9OA 2YKPA 3FWNA 4EI2A 3HD7C 2IZ1A 2Y0EA 2AXTE 1L0NG 5KLVK 1CZQA 1KC8Q 2W83C 2N1TA 1SLQA 3CCSP 3V5BA 1QVGO 2R44A 5AVTB 5CCGA 2JKVA 4IL6E 2M3BA 2ZYGA 1FJKA 2K3RA 3Q1MA 1HJBA 3BCCG 1PP9G 2K9JB 3NTNA 1OZHA 2KZJA 2JWAA 1X0TA 2P58A 4GOEA 4KT0J 3TYYA 2J58A 2WT7B 3RL0B 3NXSA 1EQ7A 2FFDA 3TGUD 3CC4P 5AW8B 2E76D 1NO4A 1KFMA 1BCCG 1VQLP 1BE3D 1KQFB 4BWNA 5APQA 3U1AA 1FZCA 1P84H 2P67A 3S4RA 3A7OA 3L74J 3VOPA 4GODA 2PAJA 2QIWA 4NPFX 1J2JB 4YPCA 4MN4C 3H1LD 2BCCE 3ITKA 2R3CA 1U57A 1RF0A 1S9KD 2KP8A 3KPEA 4D6TJ 1SQPE 2I1JA 3CMAP 4U3FG 1KTMA 4YXDC 4JPZB 5KAIH 1N73B 2IFMA 2I8DA 1CW5A 4AQRD 4K35A 5GTIH 3AEAC 1SVFA 4H13C 3R4YA 1EZVE 2Y0DA 3D6ZA 3A0BH 1RE4C 3RK3C 1NTMG 1FOSE 2KYVA 2R32A 2KSEA 3AEGC 1U7MA 2HLOA 3KZIE 1KYOH 1VQPP 3HE4B 4B86A 2M5AB 3L70D 2D2CB 2KS1A 2N1TD 2BEQD 5KAFE 1ZRTD 5BU8B 1L0LE 4PD4D 1S3JA 3S1KA 5CCGD 4A7PA 2WZ7A 4I7ZC 2Z4EA 4GT1A 2QSIA 2A06E 1T3JA 1Q2NA 1YQ3C 1SS1A 2HFED 1BGYD 2WTYA 5AW1B 2KLVA 1FJPA 1KD1Q 2XU6A 1H0TB 3R2PA 2GM4A 1G1IA 2IPPA 3H1KG 3IN6A 1EDLA 3P32A 1D7MA 1OMIA 2K9YA 4KHXA 3B5NC 4ASVA 1WMKA 1AVOA 1SQVD 1SQBD 5AVQB 3H1HG 2JDIH 5AVXB 3H1JE 2H8PD 1NAYA 4LLHA 2Q9IA 1GMJA 2Y9ZA 4BRYA 3GG2A 1LTJB 1JMMA 2ZYDA 2QM8A 3L73G 3GF7A 2XV5A 1LTGC 5KJ7D 3GHGC 2V7QJ 2NRGA 4WWIA 2FBWC 1SQPG 1NU1J 2QJPC 2GUSA 1ZV8A 3L37A 5DJTB 2IDBA 3MUDC 2M3EA 3OA7A 1GDTA 2WSSH 3D70A 2E76C 4N78E 5AVWB 1Q81Q 4NPDA 1EZVG 2HR3A 2PP6A 3A0HH 1BSNA 2WPVB 1YTZI 2Q6QA 2WSFH 1NWQA 1GW3A 2OYIC 1PPJE 3TK1A 2E43A 4YXWH 1J1DB 1EDKA 2AXCA 1YIJP 2FY8A 3HE5B 3H32A 1FBMA 4JBZA 2CK3H 5C39A 1L0LG 1VF5C 1LT1A 4H0LD 3AE9C 1J1EB 1M1JC 1P84E 1PIXA 2HPCA 1JY2O 1H88A 3L71E 2E75C 1TU3F 2Q3IA 1DEBA 2A06G 3IAOA 2QG4A 1YJWP 4XA4A 2N9YB 4Z1MH 3RK2C 1OVVA 2IZ0A 1FOSF 1RE4A 2WSFJ 1NU1K 3CWBE 1OWAA 1S1CX 3AE5C 4GKGA 4PV1D 1JTHA 3AEDC 2FYNB 1ZW0A 3G4SP 1L4AB 3HD7D 1KILA 1N2DC 2LXBA 5KAIE 4OVNF 4I2LC 2LR2A 5GTIE 1GU5A 2B88A 1YBKA 2ZT9C 1NVOA 3H1JG 3E1IA 2Z5HA 2AEJA 1LWUB 1AQ5A 3H1LJ 1KYOE 5AW4B 1S5LX 5DJUB 5K5GB 4PD4H 4WY4B 2O1JA 4RESB 1KQGB 2PGDA 4L76A 5CBOA 4XFJA 1CSBA 1OXZA 3FX0A 1E5WA 1IK9A 2ZYAA 3PTZA 3B5NA 3RL0C 3MP7B 2KK7A 1W2BO 1JCCA 5B66H 3EQ2A 3L70J 2M8RA 2O1KA 1RF1B 3GHGA 5AW0B 2KLUA 1IJDB 1OX3A 3O6QB 5BU5A 3L71G 5KJ7C 3AECC 1SQQD 1NH4A 4C7RA 4EDFA 3L72E 5AVSB 3H1KJ 5APVA 1SQXE 2RN0A 3M9QA 3CC7P 4DZOA 4H13D 1X22A 1LTTC 1BGYJ 3B8EB 3RK3D 2HODB 3CWBG 4DJGA 3H1IE 1SFCB 2PRRA 2JEEA 1N73C 2OYIA 2IYPA 1S4XA 3G9RA 1NTZK 2NZ2A 3L73J 1NTKJ 3L75E 2Q5UA 1SQBJ 1SQVJ 3T97B 3TNUB 1MFTA 3A0HE 2FYUJ 4Y99B 3D71A 3W68A 3TGUE 3CC2P 2D2CC 1W2EA 2OARA 4IFFA 3CCQP 1BE3E 1LT9B 4RJTA 4IOIH 1Z56A 1IFJA 1URQB 1YITP 1GL2B 4DOJA 1CI6B 4WY4D 3LW5J 3WU2E 3N4XA 1JUNA 3OAKA 1W5CE 4UB8H 1PP9D 2WVRA 3B5ND 2JWDA 1K9MQ 3VYIA 1IFMA 2KOGA 4NPEA 1S9KE 4RO0A 2ZJSE 2H88C 3EWKA 4XE5B 2G8YA 1Q90D 2C0WA 3CX5E 3Q5PA 2R3SA 1NTZE 1NHLA 1KMIZ 1SQBK 1SQVK 2OYHA 2Y0CA 3USSA 3VMYA 1EZVI 1HVVA 3G3ZA 3QWOC 1KB9H 3L72G 1N7SB 1YJ9P 1ZR4A 3E7KA 2K9JA 3CPWO 1LTJC 1SQXG 2Q3EA 1KQLA 2W6JH 2Q1KA 3E1RA 1DIPA 4HJGH 2WT7A 1LTSC 1ZRTE 2JP3A 3H1IG 2E74B 4PD4E 1IFIA 1Q86Q 4C7NA 4ZKPA 1GTWA 1AV1A
chains in the Genus database with same CATH topology
3L74J 3L71J 4U3FJ 1BGYJ 1SQQJ 2BCCJ 1BCCJ 1L0LJ 1L0NJ 1KYOI 1SQVJ 1SQBJ 1BE3J 3H1HJ 4D6TJ 1KB9I 5KLVJ 1SQPJ 1P84I 2IBZI 1NTZJ 3H1IJ 4PD4I 3L72J 3H1LJ 3L70J 2FYUJ 1EZVI 1NU1J 3H1KJ 3H1JJ 3TGUJ 3CX5I 3L73J 1SQXJ 3CXHI 1NTMJ 1NTKJ 3BCCJ 3L75J 3CWBJ 1PP9J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L74 J;  3L71 J;  4U3F J;  1BGY J;  1SQQ J;  2BCC J;  1BCC J;  1L0L J;  1L0N J;  1KYO I;  1SQV J;  1SQB J;  1BE3 J;  3H1H J;  4D6T J;  1KB9 I;  5KLV J;  1SQP J;  1P84 I;  2IBZ I;  1NTZ J;  3H1I J;  4PD4 I;  3L72 J;  3H1L J;  3L70 J;  2FYU J;  1EZV I;  1NU1 J;  3H1K J;  3H1J J;  3TGU J;  3CX5 I;  3L73 J;  1SQX J;  3CXH I;  1NTM J;  1NTK J;  3BCC J;  3L75 J;  3CWB J;  1PP9 J; 
#chains in the Genus database with same CATH topology
 1OW8 A;  3GMA A;  3L75 G;  4U3F D;  3L4F A;  1U7J A;  1VF5 D;  4C46 A;  2A45 G;  3L35 A;  3CXH I;  1JNM A;  5APW A;  1VQK P;  5KJ7 A;  1HUC A;  1J1D C;  2E75 D;  2KB7 P;  3TGU G;  2I1K A;  1NTM D;  1AQT A;  5KLV E;  3A3Y B;  1VQ6 P;  2YXQ B;  3CCR P;  1DEE G;  4Y28 J;  3BAS A;  1EDJ A;  1BE3 G;  3RK2 D;  1RQV A;  1J1E C;  2R5B A;  1KV4 A;  2ZXX A;  3FGA D;  5APU A;  3A5T A;  2FKW B;  1FZB A;  2W6B A;  5CCH C;  1A02 J;  1IZN B;  3HTK B;  2AEM A;  3VTP C;  1QVF O;  2Z5I A;  1JOC A;  1VQ4 P;  3Q2Y A;  3LIE A;  2ZT9 D;  2YNY A;  1XTC C;  1QL2 A;  5H2F H;  3QH9 A;  2FYN C;  1FS0 E;  1L4A C;  3HE4 A;  4TT3 H;  3A2A A;  2M5A A;  1RH5 B;  1S5L H;  3RGU A;  1VDF A;  4OH8 B;  1NTZ G;  2W27 A;  1ZR2 A;  3H25 A;  1WRG A;  3U59 A;  3H1K D;  1SQQ J;  5CBN A;  3CLQ A;  3WUV A;  1LWU C;  2V7Q H;  2RKL A;  2NPS B;  3H1H D;  3Q3D A;  5AVR B;  1ZOY C;  4WY4 C;  1K8A Q;  4GDO A;  4R4L A;  4ZNC A;  3RL0 D;  3UIA A;  3HD7 A;  1GZL A;  2FXO A;  1G2C B;  1JY3 N;  3L73 D;  1NTK D;  1P84 I;  2BAS A;  1T3U A;  3MD0 A;  1JY3 P;  2Q7C A;  2KZI A;  3MGN A;  1SQP D;  1IC2 A;  2WSE H;  2R5D A;  5E79 E;  2FYU D;  2BCC G;  1EZV D;  1VPC A;  2OGU A;  3G71 P;  5AW2 B;  2ZAE B;  5KLV G;  2N9B A;  3HUS B;  3PLN A;  1M90 Q;  1RE3 C;  3MHV A;  4HYT B;  1RF1 C;  1MZ9 A;  2HYN A;  3L74 E;  1VQN P;  3SWF A;  4EOT A;  1L0N J;  1HGV A;  1SQQ K;  2LKM A;  1L0L D;  3I5C A;  1DH3 A;  1KB9 E;  1X79 B;  2YIU B;  2Y9Y A;  2WSE J;  1X8Y A;  2CPB A;  1R8E A;  2YMK A;  3BCC J;  3MTU E;  1PP9 J;  1LNQ A;  3C1L A;  1PGQ A;  1KYO I;  4D6T E;  2A06 D;  1SFC C;  3CXH D;  4OGQ B;  4JF7 A;  4JYB A;  2D2C D;  3HE5 A;  1LP1 A;  2B89 A;  1MFZ A;  2H7H A;  1BCC J;  4L73 A;  1H89 A;  4GOF A;  3VMA A;  2WMM A;  2FXP A;  1PV3 A;  3FWL A;  4Y99 C;  2P10 A;  2B87 B;  2KNC A;  1YQ4 C;  1Y8A A;  3H1J D;  3SFD C;  3P8C E;  1LT9 C;  1M8O B;  2VRS A;  4CPG A;  2AXT H;  1URQ C;  4DCK A;  5AW3 B;  2E5T A;  2O01 N;  1GL2 C;  1UII A;  1KIL B;  3MZW B;  4KJM A;  5GTH H;  1UIX A;  2AEF A;  1M57 D;  4U3F J;  5EFW B;  3A0B E;  3V4W A;  1IFN A;  2KI7 B;  2QJK B;  2W8Z A;  1BSH A;  1FZE A;  1VQM P;  4N6J A;  4N78 D;  4AYC A;  1USE A;  3RK3 E;  2WIT A;  1NTM J;  1LWU A;  1SP4 A;  5H2F E;  3PH0 A;  3PP5 A;  2K88 A;  3L74 G;  1YHQ P;  1KIL E;  1JY2 P;  4WY4 A;  4H44 B;  2XND H;  2IFN A;  1OFC X;  1IFP A;  1N7S C;  2A45 I;  1P84 D;  3M06 A;  1EC5 A;  4EYY Q;  3IR9 A;  3CCM P;  1FZF A;  2OTL P;  3U1C A;  1PPJ G;  1JB0 J;  2O01 J;  1IK7 A;  1K73 Q;  4JQ0 D;  3M0A A;  4D6T G;  2QVA A;  2QA4 P;  1NU1 E;  2IBZ E;  3LID A;  2E74 C;  4WB4 A;  1NOH A;  3CWB D;  2K1A A;  3MIW A;  1LTA C;  1RE3 A;  3IF4 A;  3EFF K;  1RF1 A;  4OGQ D;  3G6E P;  4R4M A;  3MUD A;  1ZME C;  2K37 A;  3O6Q A;  1RHZ B;  3B71 A;  3VMZ A;  3RL0 g;  5CCH D;  1KOR A;  1NTM K;  3OW2 O;  3H1H J;  1X9V A;  3C8V A;  2L5G B;  2OYO A;  2GA1 A;  5AVZ B;  1USD A;  5TIS H;  3C9I A;  2KUB A;  3NMD A;  1BDD A;  2POH A;  3M9B A;  1R5L A;  1AJY A;  1PGO A;  1T6A A;  1S2E A;  3CX5 I;  3BRT B;  2HOD A;  1KYO D;  3LW5 H;  1SFC A;  1T2K C;  3TDK A;  3O8Z A;  1KN7 A;  1SQP J;  1L4A D;  1M1J A;  3GF3 A;  2QE7 H;  5APS A;  3KYQ A;  5KKZ B;  3T97 A;  1FE6 A;  3GLM A;  1GK4 A;  1QLE D;  3V6I A;  3CXH H;  1OIP A;  3V4Q A;  1HH0 A;  3K5B A;  2MJZ A;  4WBA A;  1L0N D;  4K3A A;  1PL5 A;  1KZU B;  2WPR A;  1LT9 A;  1L0L J;  3F89 A;  1URQ A;  3BCC D;  3FXE A;  3JCU H;  1GL2 A;  1CI6 A;  3H1L E;  5AW7 B;  1MV8 A;  3VP9 A;  2NPS C;  1MKM A;  3M0D C;  5L8R J;  3GW6 A;  4W7Z A;  1NU1 G;  2N1T B;  2KIK A;  3SWY A;  2IBZ G;  3JSV C;  1SQX D;  1ZN5 A;  2WSC H;  1BDC A;  1NTK K;  4IL6 X;  3CCU P;  1H8A A;  1BCC D;  1SQP K;  3V2Q A;  2M0B A;  3KDP B;  3H1I D;  2OYH B;  5GTH E;  1QL1 A;  2FYZ A;  3AE4 C;  2FYU K;  2SPZ A;  1DD3 A;  3V2N A;  3PJS K;  1RY3 A;  1R5S A;  2P7J A;  3V2R A;  1FZG A;  1Q82 Q;  3CI9 A;  3L75 D;  2ZFC A;  2FFD B;  2JJL A;  4QMA A;  3L70 E;  1N7S A;  3CL3 D;  3ABV C;  3H1J J;  3HUS C;  2QJY B;  2RMZ A;  1GW4 A;  1T8Z A;  2J5U A;  1FZC B;  2WSC J;  4C7N B;  1DD4 A;  2DW3 A;  1AVY A;  1L0L K;  1SFC D;  1AA0 A;  3AE2 C;  1HWT C;  3H1K E;  2YIU C;  2QRX A;  2H43 A;  1PZQ A;  1BGY E;  2O3J A;  1YI2 P;  2B9B A;  3H1H E;  4RKU J;  3V2P A;  1VQ8 P;  1PGJ A;  2IYO A;  5B66 E;  3WUT A;  4JYC A;  4OGQ C;  1Y47 A;  1GD2 E;  3L73 E;  2ZXE B;  2OQQ A;  1NTK E;  1XTG B;  4L74 A;  2P2U A;  2XZR A;  2V4H A;  1SQB E;  1SQV E;  2XKM A;  1N73 A;  4UB6 H;  1K05 A;  3W67 A;  3CX5 D;  1URQ D;  2YKO A;  2FYU E;  4TLF A;  1HGZ A;  1GL2 D;  1NTZ D;  3BRV B;  3H1L G;  3HTK A;  4L75 A;  1JY3 O;  3AEB C;  3L71 J;  1VQ7 P;  5KTB A;  2KS1 B;  1EXI A;  5TIS E;  4H0L B;  1ZXG A;  3FXD A;  1KIL C;  1L2P A;  4M3L A;  3IFM A;  1LTB C;  3CWB J;  2YXR B;  2WQY C;  1MUU A;  1NJI Q;  3VMX A;  5AW6 B;  1KB9 I;  2QJK C;  2YO2 A;  5CHX A;  1VQO P;  2W90 A;  3BAT A;  1WT6 A;  3HRN A;  1JMB A;  3L70 G;  1N7S D;  1N86 A;  1OVR A;  4PV1 B;  2OTJ P;  4LC1 A;  3SFE C;  4BXL A;  5KLI B;  2PFX A;  2NPS A;  3CXH E;  5AVV B;  1FAV A;  1GK6 A;  2BCC D;  3M0D A;  4ASW A;  3ZDM A;  4YTP C;  5CMZ A;  3HD7 B;  3P7K A;  2WPS A;  1K04 A;  1H0T A;  4H44 C;  2BEZ F;  5KLV D;  2E74 D;  4GIF A;  1G2C A;  2J59 M;  1FDM A;  3WUU A;  1HBW A;  3JCU E;  4UB8 E;  3L36 A;  4LGD E;  4BRY B;  1BGY G;  1N8R Q;  1JEK A;  2E42 A;  3Q5S A;  1LTJ A;  2W6A A;  2KXP B;  2IX7 C;  1QGK B;  1QEX A;  2L91 A;  1LTI C;  1NTK G;  2XNX A;  1GU4 A;  3HUS A;  5BVZ A;  2FXM A;  1YTZ T;  1SQV G;  1SQB G;  1FDI A;  1VL2 A;  1QX8 A;  2FYU G;  3WMM 0;  3M91 A;  3VP8 A;  1FU1 A;  3D6Y A;  3I56 P;  1T2K D;  2RH0 A;  1NKN A;  1NAF A;  3NFQ A;  2UWJ E;  5APY A;  2WPQ A;  1LGH B;  2A45 H;  2CPS A;  3L72 J;  2H89 C;  5AVU B;  3II6 A;  3H32 B;  1SQX J;  4W80 A;  5B5E H;  1NKZ B;  4PJ0 H;  2KSJ A;  2HPC B;  2YO3 A;  1DX7 A;  2MKV A;  1LP1 B;  1RQU A;  5M1B A;  3H1I J;  2JO1 A;  4HH2 A;  3VN0 A;  2P1J A;  2LXC B;  5CCH A;  3AEE C;  5KKZ C;  3WU2 H;  4AUW A;  3N7N A;  3L75 J;  4H13 B;  3AE1 C;  3AE6 C;  2GUV A;  2KNC B;  1Q7Y Q;  3RK3 B;  1M1K Q;  3TSI A;  3CD6 P;  2IBZ I;  2B87 A;  1L0N K;  2NPS D;  1JTH B;  4N3Y B;  1S72 P;  3TGU J;  4ZMD A;  3PHL A;  4I1L A;  3OJA B;  1SQQ E;  1L4A A;  4IL6 H;  1KQS O;  3H6P A;  1BE3 J;  3CX5 H;  3L74 D;  4UB6 E;  3B4S A;  2O01 H;  1PFI A;  3KHU A;  4I7Z B;  3KXD A;  1VQ9 P;  5CJ4 A;  3CCV P;  1KB9 D;  2N1T C;  3CCL P;  1SQX K;  1ZLL A;  1KFN A;  1JY2 N;  4I6M C;  3RBZ A;  4IFM A;  5CCG C;  1PPJ D;  5APT A;  1HJ0 A;  1S5L E;  4D6T D;  2JR8 A;  1LJ2 A;  1OW7 A;  2OYH C;  3F5H A;  2XDJ A;  3RBX A;  3BVH A;  1N7L A;  1Y9B A;  3B5N B;  1NTZ J;  4HKZ H;  3L71 D;  2YMY A;  1EDI A;  2FFD C;  3KQG A;  2YKQ A;  2QJY C;  3SWK A;  5AVY B;  3TF5 A;  1FZC C;  5AW9 B;  1L0N E;  3Q5R A;  1IO4 A;  3GHG B;  3P8C D;  1NYH A;  1FC2 C;  4DT0 A;  2QJP B;  1JCD A;  3BCC E;  3M9H A;  3AE3 C;  1YYC A;  1PP9 E;  3AE8 C;  4O9B A;  3CCJ P;  2E76 B;  3I55 P;  1OW6 A;  3P8M C;  1RF0 C;  1M7L A;  2ZVO B;  2HG5 D;  3KZI H;  2C0X A;  1E79 H;  3JC2 2;  4U7J A;  1ZP0 C;  2OYI B;  2BCC J;  1YJN P;  3AE7 C;  3CCE P;  1BCC E;  5KAF H;  3SSU A;  5KLV J;  4IFD K;  2OTK E;  2ZVN B;  1SQQ G;  2G3A A;  1VF5 B;  1A02 F;  3EFG A;  1M1J B;  1KIL D;  1IFD A;  1FZA A;  1PGP A;  2QEX P;  3TNU A;  1FDO A;  1HF9 A;  2E75 B;  1OVU A;  5TJH A;  1AFO A;  2C9N Y;  4ZKU A;  3AEF C;  4PD4 I;  2WWW A;  4HB1 A;  4EIJ A;  4H0L C;  1HTL C;  3RK2 B;  1M56 D;  5APX A;  1VQ5 P;  1JM0 A;  5CJ0 A;  5B5E E;  5AW5 B;  4PJ0 E;  3CME P;  1NU1 D;  3PRJ A;  4U3F E;  2C9L Y;  2IBZ D;  1EXJ A;  2ITA A;  1G1J A;  4OWF A;  4H44 D;  2QM7 A;  4W7Y A;  3L72 D;  1NTM E;  2ZT9 B;  2E5Y A;  1JO5 A;  5E79 H;  4PV1 C;  4WVZ A;  1NGM B;  5KLI C;  3S9O A;  2YKP A;  3FWN A;  4EI2 A;  3HD7 C;  2IZ1 A;  2Y0E A;  2AXT E;  1L0N G;  5KLV K;  1CZQ A;  1KC8 Q;  2W83 C;  2N1T A;  1SLQ A;  3CCS P;  3V5B A;  1QVG O;  2R44 A;  5AVT B;  5CCG A;  2JKV A;  4IL6 E;  2M3B A;  2ZYG A;  1FJK A;  2K3R A;  3Q1M A;  1HJB A;  3BCC G;  1PP9 G;  2K9J B;  3NTN A;  1OZH A;  2KZJ A;  2JWA A;  1X0T A;  2P58 A;  4GOE A;  4KT0 J;  3TYY A;  2J58 A;  2WT7 B;  3RL0 B;  3NXS A;  1EQ7 A;  2FFD A;  3TGU D;  3CC4 P;  5AW8 B;  2E76 D;  1NO4 A;  1KFM A;  1BCC G;  1VQL P;  1BE3 D;  1KQF B;  4BWN A;  5APQ A;  3U1A A;  1FZC A;  1P84 H;  2P67 A;  3S4R A;  3A7O A;  3L74 J;  3VOP A;  4GOD A;  2PAJ A;  2QIW A;  4NPF X;  1J2J B;  4YPC A;  4MN4 C;  3H1L D;  2BCC E;  3ITK A;  2R3C A;  1U57 A;  1RF0 A;  1S9K D;  2KP8 A;  3KPE A;  4D6T J;  1SQP E;  2I1J A;  3CMA P;  4U3F G;  1KTM A;  4YXD C;  4JPZ B;  5KAI H;  1N73 B;  2IFM A;  2I8D A;  1CW5 A;  4AQR D;  4K35 A;  5GTI H;  3AEA C;  1SVF A;  4H13 C;  3R4Y A;  1EZV E;  2Y0D A;  3D6Z A;  3A0B H;  1RE4 C;  3RK3 C;  1NTM G;  1FOS E;  2KYV A;  2R32 A;  2KSE A;  3AEG C;  1U7M A;  2HLO A;  3KZI E;  1KYO H;  1VQP P;  3HE4 B;  4B86 A;  2M5A B;  3L70 D;  2D2C B;  2KS1 A;  2N1T D;  2BEQ D;  5KAF E;  1ZRT D;  5BU8 B;  1L0L E;  4PD4 D;  1S3J A;  3S1K A;  5CCG D;  4A7P A;  2WZ7 A;  4I7Z C;  2Z4E A;  4GT1 A;  2QSI A;  2A06 E;  1T3J A;  1Q2N A;  1YQ3 C;  1SS1 A;  2HFE D;  1BGY D;  2WTY A;  5AW1 B;  2KLV A;  1FJP A;  1KD1 Q;  2XU6 A;  1H0T B;  3R2P A;  2GM4 A;  1G1I A;  2IPP A;  3H1K G;  3IN6 A;  1EDL A;  3P32 A;  1D7M A;  1OMI A;  2K9Y A;  4KHX A;  3B5N C;  4ASV A;  1WMK A;  1AVO A;  1SQV D;  1SQB D;  5AVQ B;  3H1H G;  2JDI H;  5AVX B;  3H1J E;  2H8P D;  1NAY A;  4LLH A;  2Q9I A;  1GMJ A;  2Y9Z A;  4BRY A;  3GG2 A;  1LTJ B;  1JMM A;  2ZYD A;  2QM8 A;  3L73 G;  3GF7 A;  2XV5 A;  1LTG C;  5KJ7 D;  3GHG C;  2V7Q J;  2NRG A;  4WWI A;  2FBW C;  1SQP G;  1NU1 J;  2QJP C;  2GUS A;  1ZV8 A;  3L37 A;  5DJT B;  2IDB A;  3MUD C;  2M3E A;  3OA7 A;  1GDT A;  2WSS H;  3D70 A;  2E76 C;  4N78 E;  5AVW B;  1Q81 Q;  4NPD A;  1EZV G;  2HR3 A;  2PP6 A;  3A0H H;  1BSN A;  2WPV B;  1YTZ I;  2Q6Q A;  2WSF H;  1NWQ A;  1GW3 A;  2OYI C;  1PPJ E;  3TK1 A;  2E43 A;  4YXW H;  1J1D B;  1EDK A;  2AXC A;  1YIJ P;  2FY8 A;  3HE5 B;  3H32 A;  1FBM A;  4JBZ A;  2CK3 H;  5C39 A;  1L0L G;  1VF5 C;  1LT1 A;  4H0L D;  3AE9 C;  1J1E B;  1M1J C;  1P84 E;  1PIX A;  2HPC A;  1JY2 O;  1H88 A;  3L71 E;  2E75 C;  1TU3 F;  2Q3I A;  1DEB A;  2A06 G;  3IAO A;  2QG4 A;  1YJW P;  4XA4 A;  2N9Y B;  4Z1M H;  3RK2 C;  1OVV A;  2IZ0 A;  1FOS F;  1RE4 A;  2WSF J;  1NU1 K;  3CWB E;  1OWA A;  1S1C X;  3AE5 C;  4GKG A;  4PV1 D;  1JTH A;  3AED C;  2FYN B;  1ZW0 A;  3G4S P;  1L4A B;  3HD7 D;  1KIL A;  1N2D C;  2LXB A;  5KAI E;  4OVN F;  4I2L C;  2LR2 A;  5GTI E;  1GU5 A;  2B88 A;  1YBK A;  2ZT9 C;  1NVO A;  3H1J G;  3E1I A;  2Z5H A;  2AEJ A;  1LWU B;  1AQ5 A;  3H1L J;  1KYO E;  5AW4 B;  1S5L X;  5DJU B;  5K5G B;  4PD4 H;  4WY4 B;  2O1J A;  4RES B;  1KQG B;  2PGD A;  4L76 A;  5CBO A;  4XFJ A;  1CSB A;  1OXZ A;  3FX0 A;  1E5W A;  1IK9 A;  2ZYA A;  3PTZ A;  3B5N A;  3RL0 C;  3MP7 B;  2KK7 A;  1W2B O;  1JCC A;  5B66 H;  3EQ2 A;  3L70 J;  2M8R A;  2O1K A;  1RF1 B;  3GHG A;  5AW0 B;  2KLU A;  1IJD B;  1OX3 A;  3O6Q B;  5BU5 A;  3L71 G;  5KJ7 C;  3AEC C;  1SQQ D;  1NH4 A;  4C7R A;  4EDF A;  3L72 E;  5AVS B;  3H1K J;  5APV A;  1SQX E;  2RN0 A;  3M9Q A;  3CC7 P;  4DZO A;  4H13 D;  1X22 A;  1LTT C;  1BGY J;  3B8E B;  3RK3 D;  2HOD B;  3CWB G;  4DJG A;  3H1I E;  1SFC B;  2PRR A;  2JEE A;  1N73 C;  2OYI A;  2IYP A;  1S4X A;  3G9R A;  1NTZ K;  2NZ2 A;  3L73 J;  1NTK J;  3L75 E;  2Q5U A;  1SQB J;  1SQV J;  3T97 B;  3TNU B;  1MFT A;  3A0H E;  2FYU J;  4Y99 B;  3D71 A;  3W68 A;  3TGU E;  3CC2 P;  2D2C C;  1W2E A;  2OAR A;  4IFF A;  3CCQ P;  1BE3 E;  1LT9 B;  4RJT A;  4IOI H;  1Z56 A;  1IFJ A;  1URQ B;  1YIT P;  1GL2 B;  4DOJ A;  1CI6 B;  4WY4 D;  3LW5 J;  3WU2 E;  3N4X A;  1JUN A;  3OAK A;  1W5C E;  4UB8 H;  1PP9 D;  2WVR A;  3B5N D;  2JWD A;  1K9M Q;  3VYI A;  1IFM A;  2KOG A;  4NPE A;  1S9K E;  4RO0 A;  2ZJS E;  2H88 C;  3EWK A;  4XE5 B;  2G8Y A;  1Q90 D;  2C0W A;  3CX5 E;  3Q5P A;  2R3S A;  1NTZ E;  1NHL A;  1KMI Z;  1SQB K;  1SQV K;  2OYH A;  2Y0C A;  3USS A;  3VMY A;  1EZV I;  1HVV A;  3G3Z A;  3QWO C;  1KB9 H;  3L72 G;  1N7S B;  1YJ9 P;  1ZR4 A;  3E7K A;  2K9J A;  3CPW O;  1LTJ C;  1SQX G;  2Q3E A;  1KQL A;  2W6J H;  2Q1K A;  3E1R A;  1DIP A;  4HJG H;  2WT7 A;  1LTS C;  1ZRT E;  2JP3 A;  3H1I G;  2E74 B;  4PD4 E;  1IFI A;  1Q86 Q;  4C7N A;  4ZKP A;  1GTW A;  1AV1 A; 
#chains in the Genus database with same CATH homology
 3L74 J;  3L71 J;  4U3F J;  1BGY J;  1SQQ J;  2BCC J;  1BCC J;  1L0L J;  1L0N J;  1KYO I;  1SQV J;  1SQB J;  1BE3 J;  3H1H J;  4D6T J;  1KB9 I;  5KLV J;  1SQP J;  1P84 I;  2IBZ I;  1NTZ J;  3H1I J;  4PD4 I;  3L72 J;  3H1L J;  3L70 J;  2FYU J;  1EZV I;  1NU1 J;  3H1K J;  3H1J J;  3TGU J;  3CX5 I;  3L73 J;  1SQX J;  3CXH I;  1NTM J;  1NTK J;  3BCC J;  3L75 J;  3CWB J;  1PP9 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...