1KB9I

Yeast cytochrome bc1 complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
55
structure length
55
Chain Sequence
SSLYKTFFKRNAVFVGTIFAGAFVFQTVFDTAITSWYENHNKGKLWKDVKARIAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
total genus 16
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1kb9I00
1NTZJ 5KLVJ 1KB9I 3H1LJ 1SQXJ 3L75J 1NTKJ 1L0LJ 3L71J 3L74J 3H1JJ 4D6TJ 1NU1J 1BE3J 1PP9J 1P84I 1NTMJ 1SQQJ 1KYOI 3H1KJ 2FYUJ 2IBZI 3BCCJ 3L72J 4U3FJ 3CXHI 1BGYJ 3CWBJ 3H1IJ 1SQBJ 3L73J 1BCCJ 3L70J 1EZVI 3TGUJ 3H1HJ 1L0NJ 3CX5I 1SQVJ 4PD4I 1SQPJ 2BCCJ
chains in the Genus database with same CATH superfamily
2G3AA 1SQQD 3VN0A 3Q5PA 2QVAA 2W6AA 1BCCG 2H8PD 2YIUC 4ZNCA 3VOPA 1EDIA 1LP1B 2P1JA 1PL5A 2FXMA 2QJYB 2WPQA 3MUDA 4IFMA 1JY3N 5DJUB 3WU2E 1NH4A 5CCHA 1X79B 3CCMP 1PP9J 1T3UA 4WVZA 2E76B 1KYOD 3AE8C 4RKUJ 3R2PA 3Q5SA 2OYHA 4C7NB 3MUDC 1GL2C 2WITA 3PP5A 1SFCD 5B5EH 1IFMA 1NTZG 1M56D 2LXCB 2P10A 3H1LG 4TT3H 1KQLA 1T8ZA 2E74C 1M57D 2N9BA 3TNUA 1FZFA 4U3FG 4UB6H 2A06E 2R32A 1KILC 2ITAA 2WVRA 3O8ZA 1SQQE 2OTKE 2BEQD 1PPJE 2BCCG 2NPSC 2QRXA 3U1AA 4ASWA 1Q82Q 1QVFO 3I5CA 3TGUG 3SFDC 4CPGA 3TGUD 2Z5HA 5KLVJ 1EXIA 4B86A 4PJ0E 2XZRA 1RE3C 1DD3A 1GTWA 3VMZA 2KZIA 2QEXP 2AXTE 5AVYB 4EI2A 2DW3A 3Q1MA 1T2KC 2IYPA 1BE3J 1VQPP 1R5SA 3FXEA 3HTKA 1LTSC 1FDOA 4BWNA 1SQQJ 5AW6B 3AEGC 4YXDC 1KC8Q 1M1JB 1GD2E 2N9YB 4BRYB 4IOIH 1IFJA 2FYUJ 2K3RA 3H1HD 1NJIQ 3HE5A 1HJ0A 1VQ9P 1VPCA 3KXDA 1LWUC 3MTUE 4U7JA 3VMAA 1OVUA 4D6TG 1N7LA 2KLUA 1NTZK 2ZYGA 1SFCC 3CWBD 5KJ7D 4Z1MH 2FFDB 3GLMA 3OAKA 2KIKA 1NHLA 4R4LA 1L4AC 1Q7YQ 1OWAA 4H44D 3WUTA 5GTHE 1E79H 3L70G 4OGQD 3WU2H 4EIJA 3L72G 1UIIA 3HD7C 5AVVB 1FC2C 3V2PA 1LT9C 2IX7C 3RK2D 1AQ5A 5KAIE 3CX5D 3L36A 4OGQB 1EDJA 1AQTA 1KFNA 3CL3D 4PD4E 1OIPA 2OGUA 3N7NA 1AVOA 1RF0A 3RK3D 5KTBA 1NU1G 1N73C 1U7JA 4KJMA 2OYIB 1N7SD 2ZXEB 1ZMEC 1RE4A 2K9JB 2KLVA 3L74D 2E75B 4H13D 4JYCA 2OYHB 1NU1D 3TDKA 1X8YA 3Q2YA 2Q3EA 2H43A 1KN7A 1QEXA 5AW0B 1D7MA 2YXRB 3JC22 1JMBA 2M0BA 1URQB 1SQBJ 2POHA 3BRVB 5AVUB 4D6TD 2WT7A 1CZQA 3RL0B 3HUSA 1YTZT 2RMZA 3H1HJ 3C9IA 2HFED 1NTZD 5CBNA 1TU3F 1DEEG 3M0DC 3NTNA 3L75D 3H1HG 3CC4P 1IZNB 1OVVA 1OW6A 2W90A 1ZR4A 2ZVNB 3V2NA 1U7MA 3E1IA 4MN4C 4RJTA 5AVXB 2C9LY 2JKVA 2MKVA 2GUVA 4XFJA 4L74A 2Y0EA 3M91A 2Q5UA 3KZIH 2I8DA 4WY4A 3CMAP 2IFNA 3W67A 1URQA 2XKMA 3F5HA 1HVVA 1LTBC 1HUCA 3L73D 2IBZD 1E5WA 3JSVC 3USSA 1K9MQ 3M9BA 5BVZA 3A5TA 3G4SP 3Q5RA 4WBAA 1BE3G 3KDPB 1EXJA 1FBMA 1NU1K 1LTJA 2VRSA 1ZOYC 3AEAC 2PFXA 2WSFJ 3H1IJ 5KLVK 1EZVD 5B66H 1NTKD 3GHGA 3V2QA 2ZFCA 2HODA 3L73E 1PFIA 3G71P 1VQKP 3FX0A 1AA0A 1T3JA 1M1JA 1SVFA 1NTME 2A06G 1ZN5A 3N4XA 4L76A 3TSIA 1PGPA 5C39A 2BEZF 3H6PA 4H0LC 3P32A 3IF4A 3V5BA 3TK1A 1YTZI 3QWOC 2HPCA 4UB6E 1NTZJ 1M1JC 2QA4P 1SQBG 3H1LJ 2ZYDA 3M0AA 1YQ3C 3CPWO 1M1KQ 2FFDA 3MD0A 2WPVB 1LTJC 3LW5J 3GHGB 3M06A 4HYTB 5APXA 5APSA 1N86A 1KB9H 3CXHE 1FDMA 3BCCG 2NRGA 5APUA 3EWKA 1K73Q 1EZVE 3W68A 2N1TB 1VQMP 2M8RA 1J1DC 1JOCA 3D70A 1VQNP 3KHUA 1GW4A 1S9KE 1L4AB 1RH5B 2YIUB 4JBZA 4WY4C 4OWFA 1SQXE 2Q9IA 5CCHC 2RN0A 2OYHC 1PGJA 4IL6H 5KKZB 1RF1A 1NTKG 2IBZE 3A0BE 3MIWA 1KMIZ 1KQFB 4H13B 2HLOA 3TGUJ 4W80A 1BDDA 1J2JB 3T97B 5KLVG 1N73B 3CC7P 1VQ6P 1AJYA 1YQ4C 1MFZA 4AUWA 3IFMA 3L72E 2KB7P 4N3YB 1DX7A 1J1EC 1EQ7A 2B87A 2JWDA 2FYUD 3VMXA 4NPDA 1GU4A 4KT0J 2RH0A 2A45H 1PP9D 2HR3A 4D6TJ 3L75E 1S2EA 3D6ZA 4GKGA 3QH9A 4L73A 2QJYC 1NAFA 1LWUB 2A45G 2B9BA 5M1BA 1KYOI 1L2PA 1OW8A 1XTGB 4GIFA 3NFQA 2QM8A 3H25A 3AE1C 1N73A 1RF0C 3L75G 2O01J 3L72J 1JB0J 4ZKUA 1LTAC 3CXHI 1EDKA 3H1KD 4UB8H 2YNYA 3F89A 3SWKA 1GU5A 2ZJSE 2ZYAA 3ITKA 2PP6A 3L73J 3V6IA 2JP3A 5B5EE 3L70J 2Q7CA 1NU1E 1SQVJ 2QJKB 1SS1A 2JR8A 1GL2A 2R3CA 3MGNA 1AV1A 1ZV8A 4AYCA 1Z56A 2WSEH 2IYOA 1NTKJ 1ZLLA 1VF5B 2WPRA 3L74J 4AQRD 3B8EB 5CCGA 2A06D 4YTPC 1NU1J 5AW3B 4NPEA 2FYUK 3GG2A 1SFCB 3L37A 4GODA 1L4AD 3HRNA 4U3FE 5AVSB 3I56P 2Z4EA 4NPFX 5H2FE 3G9RA 5GTIE 3M0DA 3H1LE 2KYVA 3V4WA 1URQD 1NTZE 1FE6A 1KD1Q 1NO4A 4IL6E 1R5LA 1KORA 1Y9BA 3MHVA 1H89A 3CCLP 3B71A 2YO3A 1R8EA 2JWAA 1LT9B 2R5DA 2Y0DA 3CWBJ 3NMDA 2M5AA 4LGDE 1CI6B 1SQBE 2IZ1A 3FWNA 4U3FD 1JCDA 1GDTA 3CD6P 1Y8AA 1IO4A 2Q3IA 1RE4C 3OW2O 4GT1A 1Q90D 4K3AA 1LJ2A 5AW7B 1S9KD 1NTMD 2XNDH 2QIWA 3BATA 3H1IG 1L0LE 1P84E 3HE5B 2Q6QA 3L71E 3GF3A 1SQVD 5AVZB 3S4RA 4ZMDA 1SQXD 1HF9A 1LT9A 3T97A 2GA1A 3H1IE 1QL1A 2I1JA 2J59M 3A7OA 4PV1B 1CSBA 3P7KA 3RGUA 1M8OB 1L0LK 2FYUG 3WUVA 3CC2P 2B87B 1NKNA 5AW1B 3L74G 5CCGC 2IBZI 1KILD 3ZDMA 2WSCJ 4EOTA 1A02J 3AE4C 1RQUA 5CBOA 1VDFA 1L0ND 3IR9A 1BGYJ 2ZT9D 3MP7B 3GMAA 3OA7A 4PV1C 1J1EB 5CJ0A 1LWUA 2WSSH 2O1JA 1KQSO 3EFFK 1QX8A 2PGDA 2SPZA 3C8VA 3P8MC 2NPSB 3H1LD 2ZT9B 1KILE 2AEFA 2FYZA 3AEFC 1KB9D 2L5GB 5KJ7A 3CCQP 2K9YA 3H1JD 2OTLP 3A0HE 5E79H 1G2CA 1P84H 1FOSF 2E43A 2H89C 2E74B 1EDLA 3BRTB 4YXWH 1SLQA 2KSJA 1HGZA 1ZP0C 3D6YA 2G8YA 1H0TB 3M9HA 2V7QJ 3AE5C 2KOGA 1W2EA 3M9QA 2XV5A 3PRJA 3O6QB 2QJKC 1GL2B 3U59A 1P84I 1JTHA 1SP4A 2OYOA 3HD7D 3HUSB 4I7ZC 5CCHD 5KLVE 4WY4D 2FYNB 2NPSA 1LT1A 1MFTA 1JY2P 2PRRA 3SFEC 3D71A 1L0LD 3L71D 3U1CA 1YI2P 3R4YA 3RK3B 5AVRB 5KJ7C 1G2CB 4RESB 1VQ5P 1OVRA 5BU5A 3LIEA 2BASA 1NOHA 2O1KA 2B89A 2M3BA 3PTZA 1FZCC 3V4QA 1EZVG 1JY2N 1NYHA 3GF7A 3HE4B 3BVHA 1L0NG 2XDJA 2P7JA 2AEJA 3O6QA 3RBXA 3A0BH 1SQBD 1J1DB 1KFMA 3G6EP 1PV3A 2V7QH 1JM0A 2AXTH 1FAVA 2KK7A 3PHLA 1S5LH 2FBWC 2Z5IA 3BASA 1HWTC 3H1JJ 2ZXXA 1LTJB 4RO0A 3SWYA 1Q86Q 5AVWB 3TF5A 2FXOA 2IZ0A 1K05A 1WMKA 2CPBA 1SQPE 3FXDA 3VMYA 4EYYQ 1BDCA 2O01N 3VP8A 1NTMG 2WPSA 2P2UA 2W83C 3ABVC 4IL6X 2FYUE 2YKQA 1RY3A 3FGAD 3GW6A 3V2RA 2KZJA 1IFDA 1VQ4P 4H0LB 5TJHA 1USDA 3B5NA 1SQVK 2K1AA 4IFFA 1BE3E 1YIJP 2KUBA 1P84D 4GOEA 2Y9YA 5KKZC 5AVTB 1QVGO 2V4HA 1SQXG 1Q81Q 1T6AA 4JYBA 2UWJE 2B88A 3H1ID 1BCCD 3GHGC 3CCJP 1SQPJ 4JF7A 1MV8A 4BRYA 2E76D 2J5UA 2OQQA 3JCUH 2NPSD 1KV4A 1U57A 2OTJP 2C0WA 1L4AA 1MZ9A 3CXHD 1ZRTE 1S1CX 2P58A 4H44B 4PJ0H 1YJ9P 2GM4A 3FWLA 1X0TA 1USEA 2W6BA 2K37A 5BU8B 2JEEA 1ZR2A 3A2AA 2E74D 1RF1C 1RF1B 3L72D 1JUNA 5KAFH 4H13C 3H1KJ 2YMYA 2N1TC 4PD4H 2YXQB 1S3JA 2LKMA 3SWFA 1N7SC 1S5LX 1GZLA 1NTMK 2KP8A 4M3LA 5L8RJ 3HD7B 4I6MC 4DOJA 5CHXA 2QM7A 4WY4B 1BCCE 1NAYA 1YBKA 3EFGA 1MKMA 1GW3A 1BSNA 4L75A 3AE2C 5APWA 4Y99B 5AVQB 3RBZA 4BXLA 1EZVI 2E75D 2R3SA 2R5BA 1SQVG 1GK4A 3AE7C 1NTKK 4C7NA 1HJBA 1DH3A 3RK2C 2FFDC 2JO1A 3II6A 1JNMA 1FJKA 1OW7A 1GMJA 1OMIA 2QG4A 3KYQA 1IJDB 5AW5B 3CCSP 2Y9ZA 3G3ZA 3H32A 3IAOA 1BGYG 4PD4D 5APTA 2OYIC 3CCEP 3TNUB 1BSHA 2D2CD 2HODB 2P67A 3HE4A 2WSCH 4Y28J 1W5CE 4HH2A 5APQA 2H88C 1PIXA 1JCCA 1PP9G 3P8CE 1HH0A 3VTPC 4XE5B 5CMZA 3RL0C 2QE7H 3CMEP 3H1JG 1AFOA 1YJWP 1S4XA 1LGHB 4TLFA 5KAIH 4D6TE 1CW5A 3CWBE 3CX5H 1ZRTD 1ZW0A 3A3YB 1IK7A 1NKZB 3H1JE 3H32B 1OFCX 3E1RA 2O01H 1PP9E 4Y99C 1VQOP 4GOFA 2PAJA 1URQC 2JDIH 2YKPA 2QJPB 1FU1A 1T2KD 1H8AA 1EC5A 2IPPA 2N1TA 1GK6A 2D2CC 2ZVOB 3Q3DA 2H7HA 1M7LA 1KZUB 2BCCJ 3AE3C 4N6JA 4PD4I 5APVA 3L70D 1QGKB 3BCCD 2LR2A 1SQXJ 3AEDC 1NTKE 2IBZG 1L0LJ 1PPJD 1X9VA 3L71J 4WB4A 3RK3E 5TISH 2C9NY 2QJPC 1JO5A 4XA4A 1G1JA 3AE9C 4KHXA 4OGQC 2WSEJ 2M5AB 4H44C 2CK3H 3HUSC 3AEBC 1PPJG 4I7ZB 1KB9E 4DZOA 1M90Q 2E5YA 3CCUP 1SQQG 3L70E 1MUUA 3RL0g 2WWWA 3BCCE 3VYIA 1FZAA 3KQGA 1RE3A 3NXSA 1PGOA 4YPCA 5TISE 4R4MA 1PGQA 3L35A 1SQPK 4GDOA 3CCRP 1GL2D 1G1IA 1IK9A 2N1TD 2R44A 2J58A 3AECC 3P8CD 5AW9B 5DJTB 2FY8A 1IFNA 5CCGD 2OYIA 1FZBA 2E42A 4JQ0D 2D2CB 2K9JA 1JY3P 3WUUA 1X22A 3PH0A 4U3FJ 1KQGB 4WWIA 3HD7A 2KNCB 1VQ7P 2BCCD 2FKWB 1DEBA 1FZEA 2WMMA 4K35A 3L74E 2XNXA 1BGYE 3JCUE 3L73G 2HG5D 2XU6A 1YITP 1H88A 3EQ2A 2O3JA 4H0LD 3AE6C 5KAFE 4IFDK 2FXPA 3TYYA 4OH8B 3VP9A 4HB1A 1SQVE 3TGUE 1OXZA 1N8RQ 1L0LG 2E75C 1K04A 1RQVA 2BCCE 3L71G 2E5TA 3S1KA 1SQQK 3MZWB 1JMMA 1FZCA 2WZ7A 1VQLP 4UB8E 4HKZH 4OVNF 2IDBA 1SQPD 1UIXA 1SQPG 1LP1A 1WT6A 1AVYA 1S72P 1K8AQ 1FZGA 2Y0CA 5GTHH 1L0NJ 3CXHH 4DCKA 1ZXGA 3H1HE 3RK2B 4I1LA 2GUSA 1JTHB 2Q1KA 1SQBK 1JEKA 2WTYA 2JJLA 3CLQA 3L75J 3LW5H 1KYOE 3S9OA 2WT7B 1CI6A 1XTCC 1IC2A 1OX3A 2AEMA 5B66E 2YO2A 1L0NE 1N7SB 2WSFH 2E76C 1FZCB 3B5NC 5KLIC 4O9BA 2A45I 5APYA 4HJGH 1IFPA 2IFMA 3KPEA 2QSIA 2I1KA 1NTMJ 3C1LA 1JY2O 3SSUA 2HPCB 4JPZB 3CCVP 2M3EA 1JY3O 2W27A 1OZHA 3BCCJ 5AW4B 3UIAA 2K88A 1YHQP 2FYNC 2WQYC 2YKOA 1FOSE 1VF5C 4LLHA 1FDIA 5KLVD 2YMKA 3CX5E 1KYOH 3L4FA 1Q2NA 2KS1A 2OARA 3LIDA 3RK3C 1RHZB 2RKLA 4DT0A 1W2BO 2L91A 1Y47A 2CPSA 4QMAA 1BCCJ 1NWQA 1FJPA 1N7SA 3IN6A 1QLED 1SFCA 2AXCA 4C7RA 1BGYD 1L0NK 3HTKB 3B5ND 1HBWA 3H1KE 3E7KA 3B4SA 2KSEA 1FS0E 1KB9I 4N78E 3RL0D 3AEEC 5AW2B 4LC1A 4W7YA 4W7ZA 4DJGA 3A0HH 5E79E 5KLIB 3PJSK 3B5NB 3CWBG 1KILB 4EDFA 1NGMB 1KTMA 2KS1B 1NVOA 1LTTC 5AW8B 5H2FH 1VQ8P 1PZQA 1DD4A 2C0XA 1WRGA 1LTGC 2ZT9C 3H1KG 3OJAB 2KNCA 2KXPB 1QL2A 4N78D 1LTIC 1LNQA 1DIPA 4PV1D 1HTLC 2MJZA 1YJNP 3K5BA 3PLNA 2KI7B 5EFWB 1A02F 1S5LE 3I55P 1H0TA 2ZAEB 5K5GB 2W8ZA 1N2DC 5CJ4A 4A7PA 2W6JH 4ASVA 2LXBA 1VL2A 1IFIA 1YYCA 2NZ2A 2HYNA 1KILA 4I2LC 4C46A 3CX5I 4ZKPA 1SQXK 1VF5D 3CI9A 5GTIH 1BE3D 1HGVA 3WMM0 3KZIE
chains in the Genus database with same CATH topology
1NTZJ 5KLVJ 1KB9I 3H1LJ 1SQXJ 3L75J 1NTKJ 1L0LJ 3L71J 3L74J 3H1JJ 4D6TJ 1NU1J 1BE3J 1PP9J 1P84I 1NTMJ 1SQQJ 1KYOI 3H1KJ 2FYUJ 2IBZI 3BCCJ 3L72J 4U3FJ 3CXHI 1BGYJ 3CWBJ 3H1IJ 1SQBJ 3L73J 1BCCJ 3L70J 1EZVI 3TGUJ 3H1HJ 1L0NJ 3CX5I 1SQVJ 4PD4I 1SQPJ 2BCCJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTZ J;  5KLV J;  1KB9 I;  3H1L J;  1SQX J;  3L75 J;  1NTK J;  1L0L J;  3L71 J;  3L74 J;  3H1J J;  4D6T J;  1NU1 J;  1BE3 J;  1PP9 J;  1P84 I;  1NTM J;  1SQQ J;  1KYO I;  3H1K J;  2FYU J;  2IBZ I;  3BCC J;  3L72 J;  4U3F J;  3CXH I;  1BGY J;  3CWB J;  3H1I J;  1SQB J;  3L73 J;  1BCC J;  3L70 J;  1EZV I;  3TGU J;  3H1H J;  1L0N J;  3CX5 I;  1SQV J;  4PD4 I;  1SQP J;  2BCC J; 
#chains in the Genus database with same CATH topology
 2G3A A;  1SQQ D;  3VN0 A;  3Q5P A;  2QVA A;  2W6A A;  1BCC G;  2H8P D;  2YIU C;  4ZNC A;  3VOP A;  1EDI A;  1LP1 B;  2P1J A;  1PL5 A;  2FXM A;  2QJY B;  2WPQ A;  3MUD A;  4IFM A;  1JY3 N;  5DJU B;  3WU2 E;  1NH4 A;  5CCH A;  1X79 B;  3CCM P;  1PP9 J;  1T3U A;  4WVZ A;  2E76 B;  1KYO D;  3AE8 C;  4RKU J;  3R2P A;  3Q5S A;  2OYH A;  4C7N B;  3MUD C;  1GL2 C;  2WIT A;  3PP5 A;  1SFC D;  5B5E H;  1IFM A;  1NTZ G;  1M56 D;  2LXC B;  2P10 A;  3H1L G;  4TT3 H;  1KQL A;  1T8Z A;  2E74 C;  1M57 D;  2N9B A;  3TNU A;  1FZF A;  4U3F G;  4UB6 H;  2A06 E;  2R32 A;  1KIL C;  2ITA A;  2WVR A;  3O8Z A;  1SQQ E;  2OTK E;  2BEQ D;  1PPJ E;  2BCC G;  2NPS C;  2QRX A;  3U1A A;  4ASW A;  1Q82 Q;  1QVF O;  3I5C A;  3TGU G;  3SFD C;  4CPG A;  3TGU D;  2Z5H A;  5KLV J;  1EXI A;  4B86 A;  4PJ0 E;  2XZR A;  1RE3 C;  1DD3 A;  1GTW A;  3VMZ A;  2KZI A;  2QEX P;  2AXT E;  5AVY B;  4EI2 A;  2DW3 A;  3Q1M A;  1T2K C;  2IYP A;  1BE3 J;  1VQP P;  1R5S A;  3FXE A;  3HTK A;  1LTS C;  1FDO A;  4BWN A;  1SQQ J;  5AW6 B;  3AEG C;  4YXD C;  1KC8 Q;  1M1J B;  1GD2 E;  2N9Y B;  4BRY B;  4IOI H;  1IFJ A;  2FYU J;  2K3R A;  3H1H D;  1NJI Q;  3HE5 A;  1HJ0 A;  1VQ9 P;  1VPC A;  3KXD A;  1LWU C;  3MTU E;  4U7J A;  3VMA A;  1OVU A;  4D6T G;  1N7L A;  2KLU A;  1NTZ K;  2ZYG A;  1SFC C;  3CWB D;  5KJ7 D;  4Z1M H;  2FFD B;  3GLM A;  3OAK A;  2KIK A;  1NHL A;  4R4L A;  1L4A C;  1Q7Y Q;  1OWA A;  4H44 D;  3WUT A;  5GTH E;  1E79 H;  3L70 G;  4OGQ D;  3WU2 H;  4EIJ A;  3L72 G;  1UII A;  3HD7 C;  5AVV B;  1FC2 C;  3V2P A;  1LT9 C;  2IX7 C;  3RK2 D;  1AQ5 A;  5KAI E;  3CX5 D;  3L36 A;  4OGQ B;  1EDJ A;  1AQT A;  1KFN A;  3CL3 D;  4PD4 E;  1OIP A;  2OGU A;  3N7N A;  1AVO A;  1RF0 A;  3RK3 D;  5KTB A;  1NU1 G;  1N73 C;  1U7J A;  4KJM A;  2OYI B;  1N7S D;  2ZXE B;  1ZME C;  1RE4 A;  2K9J B;  2KLV A;  3L74 D;  2E75 B;  4H13 D;  4JYC A;  2OYH B;  1NU1 D;  3TDK A;  1X8Y A;  3Q2Y A;  2Q3E A;  2H43 A;  1KN7 A;  1QEX A;  5AW0 B;  1D7M A;  2YXR B;  3JC2 2;  1JMB A;  2M0B A;  1URQ B;  1SQB J;  2POH A;  3BRV B;  5AVU B;  4D6T D;  2WT7 A;  1CZQ A;  3RL0 B;  3HUS A;  1YTZ T;  2RMZ A;  3H1H J;  3C9I A;  2HFE D;  1NTZ D;  5CBN A;  1TU3 F;  1DEE G;  3M0D C;  3NTN A;  3L75 D;  3H1H G;  3CC4 P;  1IZN B;  1OVV A;  1OW6 A;  2W90 A;  1ZR4 A;  2ZVN B;  3V2N A;  1U7M A;  3E1I A;  4MN4 C;  4RJT A;  5AVX B;  2C9L Y;  2JKV A;  2MKV A;  2GUV A;  4XFJ A;  4L74 A;  2Y0E A;  3M91 A;  2Q5U A;  3KZI H;  2I8D A;  4WY4 A;  3CMA P;  2IFN A;  3W67 A;  1URQ A;  2XKM A;  3F5H A;  1HVV A;  1LTB C;  1HUC A;  3L73 D;  2IBZ D;  1E5W A;  3JSV C;  3USS A;  1K9M Q;  3M9B A;  5BVZ A;  3A5T A;  3G4S P;  3Q5R A;  4WBA A;  1BE3 G;  3KDP B;  1EXJ A;  1FBM A;  1NU1 K;  1LTJ A;  2VRS A;  1ZOY C;  3AEA C;  2PFX A;  2WSF J;  3H1I J;  5KLV K;  1EZV D;  5B66 H;  1NTK D;  3GHG A;  3V2Q A;  2ZFC A;  2HOD A;  3L73 E;  1PFI A;  3G71 P;  1VQK P;  3FX0 A;  1AA0 A;  1T3J A;  1M1J A;  1SVF A;  1NTM E;  2A06 G;  1ZN5 A;  3N4X A;  4L76 A;  3TSI A;  1PGP A;  5C39 A;  2BEZ F;  3H6P A;  4H0L C;  3P32 A;  3IF4 A;  3V5B A;  3TK1 A;  1YTZ I;  3QWO C;  2HPC A;  4UB6 E;  1NTZ J;  1M1J C;  2QA4 P;  1SQB G;  3H1L J;  2ZYD A;  3M0A A;  1YQ3 C;  3CPW O;  1M1K Q;  2FFD A;  3MD0 A;  2WPV B;  1LTJ C;  3LW5 J;  3GHG B;  3M06 A;  4HYT B;  5APX A;  5APS A;  1N86 A;  1KB9 H;  3CXH E;  1FDM A;  3BCC G;  2NRG A;  5APU A;  3EWK A;  1K73 Q;  1EZV E;  3W68 A;  2N1T B;  1VQM P;  2M8R A;  1J1D C;  1JOC A;  3D70 A;  1VQN P;  3KHU A;  1GW4 A;  1S9K E;  1L4A B;  1RH5 B;  2YIU B;  4JBZ A;  4WY4 C;  4OWF A;  1SQX E;  2Q9I A;  5CCH C;  2RN0 A;  2OYH C;  1PGJ A;  4IL6 H;  5KKZ B;  1RF1 A;  1NTK G;  2IBZ E;  3A0B E;  3MIW A;  1KMI Z;  1KQF B;  4H13 B;  2HLO A;  3TGU J;  4W80 A;  1BDD A;  1J2J B;  3T97 B;  5KLV G;  1N73 B;  3CC7 P;  1VQ6 P;  1AJY A;  1YQ4 C;  1MFZ A;  4AUW A;  3IFM A;  3L72 E;  2KB7 P;  4N3Y B;  1DX7 A;  1J1E C;  1EQ7 A;  2B87 A;  2JWD A;  2FYU D;  3VMX A;  4NPD A;  1GU4 A;  4KT0 J;  2RH0 A;  2A45 H;  1PP9 D;  2HR3 A;  4D6T J;  3L75 E;  1S2E A;  3D6Z A;  4GKG A;  3QH9 A;  4L73 A;  2QJY C;  1NAF A;  1LWU B;  2A45 G;  2B9B A;  5M1B A;  1KYO I;  1L2P A;  1OW8 A;  1XTG B;  4GIF A;  3NFQ A;  2QM8 A;  3H25 A;  3AE1 C;  1N73 A;  1RF0 C;  3L75 G;  2O01 J;  3L72 J;  1JB0 J;  4ZKU A;  1LTA C;  3CXH I;  1EDK A;  3H1K D;  4UB8 H;  2YNY A;  3F89 A;  3SWK A;  1GU5 A;  2ZJS E;  2ZYA A;  3ITK A;  2PP6 A;  3L73 J;  3V6I A;  2JP3 A;  5B5E E;  3L70 J;  2Q7C A;  1NU1 E;  1SQV J;  2QJK B;  1SS1 A;  2JR8 A;  1GL2 A;  2R3C A;  3MGN A;  1AV1 A;  1ZV8 A;  4AYC A;  1Z56 A;  2WSE H;  2IYO A;  1NTK J;  1ZLL A;  1VF5 B;  2WPR A;  3L74 J;  4AQR D;  3B8E B;  5CCG A;  2A06 D;  4YTP C;  1NU1 J;  5AW3 B;  4NPE A;  2FYU K;  3GG2 A;  1SFC B;  3L37 A;  4GOD A;  1L4A D;  3HRN A;  4U3F E;  5AVS B;  3I56 P;  2Z4E A;  4NPF X;  5H2F E;  3G9R A;  5GTI E;  3M0D A;  3H1L E;  2KYV A;  3V4W A;  1URQ D;  1NTZ E;  1FE6 A;  1KD1 Q;  1NO4 A;  4IL6 E;  1R5L A;  1KOR A;  1Y9B A;  3MHV A;  1H89 A;  3CCL P;  3B71 A;  2YO3 A;  1R8E A;  2JWA A;  1LT9 B;  2R5D A;  2Y0D A;  3CWB J;  3NMD A;  2M5A A;  4LGD E;  1CI6 B;  1SQB E;  2IZ1 A;  3FWN A;  4U3F D;  1JCD A;  1GDT A;  3CD6 P;  1Y8A A;  1IO4 A;  2Q3I A;  1RE4 C;  3OW2 O;  4GT1 A;  1Q90 D;  4K3A A;  1LJ2 A;  5AW7 B;  1S9K D;  1NTM D;  2XND H;  2QIW A;  3BAT A;  3H1I G;  1L0L E;  1P84 E;  3HE5 B;  2Q6Q A;  3L71 E;  3GF3 A;  1SQV D;  5AVZ B;  3S4R A;  4ZMD A;  1SQX D;  1HF9 A;  1LT9 A;  3T97 A;  2GA1 A;  3H1I E;  1QL1 A;  2I1J A;  2J59 M;  3A7O A;  4PV1 B;  1CSB A;  3P7K A;  3RGU A;  1M8O B;  1L0L K;  2FYU G;  3WUV A;  3CC2 P;  2B87 B;  1NKN A;  5AW1 B;  3L74 G;  5CCG C;  2IBZ I;  1KIL D;  3ZDM A;  2WSC J;  4EOT A;  1A02 J;  3AE4 C;  1RQU A;  5CBO A;  1VDF A;  1L0N D;  3IR9 A;  1BGY J;  2ZT9 D;  3MP7 B;  3GMA A;  3OA7 A;  4PV1 C;  1J1E B;  5CJ0 A;  1LWU A;  2WSS H;  2O1J A;  1KQS O;  3EFF K;  1QX8 A;  2PGD A;  2SPZ A;  3C8V A;  3P8M C;  2NPS B;  3H1L D;  2ZT9 B;  1KIL E;  2AEF A;  2FYZ A;  3AEF C;  1KB9 D;  2L5G B;  5KJ7 A;  3CCQ P;  2K9Y A;  3H1J D;  2OTL P;  3A0H E;  5E79 H;  1G2C A;  1P84 H;  1FOS F;  2E43 A;  2H89 C;  2E74 B;  1EDL A;  3BRT B;  4YXW H;  1SLQ A;  2KSJ A;  1HGZ A;  1ZP0 C;  3D6Y A;  2G8Y A;  1H0T B;  3M9H A;  2V7Q J;  3AE5 C;  2KOG A;  1W2E A;  3M9Q A;  2XV5 A;  3PRJ A;  3O6Q B;  2QJK C;  1GL2 B;  3U59 A;  1P84 I;  1JTH A;  1SP4 A;  2OYO A;  3HD7 D;  3HUS B;  4I7Z C;  5CCH D;  5KLV E;  4WY4 D;  2FYN B;  2NPS A;  1LT1 A;  1MFT A;  1JY2 P;  2PRR A;  3SFE C;  3D71 A;  1L0L D;  3L71 D;  3U1C A;  1YI2 P;  3R4Y A;  3RK3 B;  5AVR B;  5KJ7 C;  1G2C B;  4RES B;  1VQ5 P;  1OVR A;  5BU5 A;  3LIE A;  2BAS A;  1NOH A;  2O1K A;  2B89 A;  2M3B A;  3PTZ A;  1FZC C;  3V4Q A;  1EZV G;  1JY2 N;  1NYH A;  3GF7 A;  3HE4 B;  3BVH A;  1L0N G;  2XDJ A;  2P7J A;  2AEJ A;  3O6Q A;  3RBX A;  3A0B H;  1SQB D;  1J1D B;  1KFM A;  3G6E P;  1PV3 A;  2V7Q H;  1JM0 A;  2AXT H;  1FAV A;  2KK7 A;  3PHL A;  1S5L H;  2FBW C;  2Z5I A;  3BAS A;  1HWT C;  3H1J J;  2ZXX A;  1LTJ B;  4RO0 A;  3SWY A;  1Q86 Q;  5AVW B;  3TF5 A;  2FXO A;  2IZ0 A;  1K05 A;  1WMK A;  2CPB A;  1SQP E;  3FXD A;  3VMY A;  4EYY Q;  1BDC A;  2O01 N;  3VP8 A;  1NTM G;  2WPS A;  2P2U A;  2W83 C;  3ABV C;  4IL6 X;  2FYU E;  2YKQ A;  1RY3 A;  3FGA D;  3GW6 A;  3V2R A;  2KZJ A;  1IFD A;  1VQ4 P;  4H0L B;  5TJH A;  1USD A;  3B5N A;  1SQV K;  2K1A A;  4IFF A;  1BE3 E;  1YIJ P;  2KUB A;  1P84 D;  4GOE A;  2Y9Y A;  5KKZ C;  5AVT B;  1QVG O;  2V4H A;  1SQX G;  1Q81 Q;  1T6A A;  4JYB A;  2UWJ E;  2B88 A;  3H1I D;  1BCC D;  3GHG C;  3CCJ P;  1SQP J;  4JF7 A;  1MV8 A;  4BRY A;  2E76 D;  2J5U A;  2OQQ A;  3JCU H;  2NPS D;  1KV4 A;  1U57 A;  2OTJ P;  2C0W A;  1L4A A;  1MZ9 A;  3CXH D;  1ZRT E;  1S1C X;  2P58 A;  4H44 B;  4PJ0 H;  1YJ9 P;  2GM4 A;  3FWL A;  1X0T A;  1USE A;  2W6B A;  2K37 A;  5BU8 B;  2JEE A;  1ZR2 A;  3A2A A;  2E74 D;  1RF1 C;  1RF1 B;  3L72 D;  1JUN A;  5KAF H;  4H13 C;  3H1K J;  2YMY A;  2N1T C;  4PD4 H;  2YXQ B;  1S3J A;  2LKM A;  3SWF A;  1N7S C;  1S5L X;  1GZL A;  1NTM K;  2KP8 A;  4M3L A;  5L8R J;  3HD7 B;  4I6M C;  4DOJ A;  5CHX A;  2QM7 A;  4WY4 B;  1BCC E;  1NAY A;  1YBK A;  3EFG A;  1MKM A;  1GW3 A;  1BSN A;  4L75 A;  3AE2 C;  5APW A;  4Y99 B;  5AVQ B;  3RBZ A;  4BXL A;  1EZV I;  2E75 D;  2R3S A;  2R5B A;  1SQV G;  1GK4 A;  3AE7 C;  1NTK K;  4C7N A;  1HJB A;  1DH3 A;  3RK2 C;  2FFD C;  2JO1 A;  3II6 A;  1JNM A;  1FJK A;  1OW7 A;  1GMJ A;  1OMI A;  2QG4 A;  3KYQ A;  1IJD B;  5AW5 B;  3CCS P;  2Y9Z A;  3G3Z A;  3H32 A;  3IAO A;  1BGY G;  4PD4 D;  5APT A;  2OYI C;  3CCE P;  3TNU B;  1BSH A;  2D2C D;  2HOD B;  2P67 A;  3HE4 A;  2WSC H;  4Y28 J;  1W5C E;  4HH2 A;  5APQ A;  2H88 C;  1PIX A;  1JCC A;  1PP9 G;  3P8C E;  1HH0 A;  3VTP C;  4XE5 B;  5CMZ A;  3RL0 C;  2QE7 H;  3CME P;  3H1J G;  1AFO A;  1YJW P;  1S4X A;  1LGH B;  4TLF A;  5KAI H;  4D6T E;  1CW5 A;  3CWB E;  3CX5 H;  1ZRT D;  1ZW0 A;  3A3Y B;  1IK7 A;  1NKZ B;  3H1J E;  3H32 B;  1OFC X;  3E1R A;  2O01 H;  1PP9 E;  4Y99 C;  1VQO P;  4GOF A;  2PAJ A;  1URQ C;  2JDI H;  2YKP A;  2QJP B;  1FU1 A;  1T2K D;  1H8A A;  1EC5 A;  2IPP A;  2N1T A;  1GK6 A;  2D2C C;  2ZVO B;  3Q3D A;  2H7H A;  1M7L A;  1KZU B;  2BCC J;  3AE3 C;  4N6J A;  4PD4 I;  5APV A;  3L70 D;  1QGK B;  3BCC D;  2LR2 A;  1SQX J;  3AED C;  1NTK E;  2IBZ G;  1L0L J;  1PPJ D;  1X9V A;  3L71 J;  4WB4 A;  3RK3 E;  5TIS H;  2C9N Y;  2QJP C;  1JO5 A;  4XA4 A;  1G1J A;  3AE9 C;  4KHX A;  4OGQ C;  2WSE J;  2M5A B;  4H44 C;  2CK3 H;  3HUS C;  3AEB C;  1PPJ G;  4I7Z B;  1KB9 E;  4DZO A;  1M90 Q;  2E5Y A;  3CCU P;  1SQQ G;  3L70 E;  1MUU A;  3RL0 g;  2WWW A;  3BCC E;  3VYI A;  1FZA A;  3KQG A;  1RE3 A;  3NXS A;  1PGO A;  4YPC A;  5TIS E;  4R4M A;  1PGQ A;  3L35 A;  1SQP K;  4GDO A;  3CCR P;  1GL2 D;  1G1I A;  1IK9 A;  2N1T D;  2R44 A;  2J58 A;  3AEC C;  3P8C D;  5AW9 B;  5DJT B;  2FY8 A;  1IFN A;  5CCG D;  2OYI A;  1FZB A;  2E42 A;  4JQ0 D;  2D2C B;  2K9J A;  1JY3 P;  3WUU A;  1X22 A;  3PH0 A;  4U3F J;  1KQG B;  4WWI A;  3HD7 A;  2KNC B;  1VQ7 P;  2BCC D;  2FKW B;  1DEB A;  1FZE A;  2WMM A;  4K35 A;  3L74 E;  2XNX A;  1BGY E;  3JCU E;  3L73 G;  2HG5 D;  2XU6 A;  1YIT P;  1H88 A;  3EQ2 A;  2O3J A;  4H0L D;  3AE6 C;  5KAF E;  4IFD K;  2FXP A;  3TYY A;  4OH8 B;  3VP9 A;  4HB1 A;  1SQV E;  3TGU E;  1OXZ A;  1N8R Q;  1L0L G;  2E75 C;  1K04 A;  1RQV A;  2BCC E;  3L71 G;  2E5T A;  3S1K A;  1SQQ K;  3MZW B;  1JMM A;  1FZC A;  2WZ7 A;  1VQL P;  4UB8 E;  4HKZ H;  4OVN F;  2IDB A;  1SQP D;  1UIX A;  1SQP G;  1LP1 A;  1WT6 A;  1AVY A;  1S72 P;  1K8A Q;  1FZG A;  2Y0C A;  5GTH H;  1L0N J;  3CXH H;  4DCK A;  1ZXG A;  3H1H E;  3RK2 B;  4I1L A;  2GUS A;  1JTH B;  2Q1K A;  1SQB K;  1JEK A;  2WTY A;  2JJL A;  3CLQ A;  3L75 J;  3LW5 H;  1KYO E;  3S9O A;  2WT7 B;  1CI6 A;  1XTC C;  1IC2 A;  1OX3 A;  2AEM A;  5B66 E;  2YO2 A;  1L0N E;  1N7S B;  2WSF H;  2E76 C;  1FZC B;  3B5N C;  5KLI C;  4O9B A;  2A45 I;  5APY A;  4HJG H;  1IFP A;  2IFM A;  3KPE A;  2QSI A;  2I1K A;  1NTM J;  3C1L A;  1JY2 O;  3SSU A;  2HPC B;  4JPZ B;  3CCV P;  2M3E A;  1JY3 O;  2W27 A;  1OZH A;  3BCC J;  5AW4 B;  3UIA A;  2K88 A;  1YHQ P;  2FYN C;  2WQY C;  2YKO A;  1FOS E;  1VF5 C;  4LLH A;  1FDI A;  5KLV D;  2YMK A;  3CX5 E;  1KYO H;  3L4F A;  1Q2N A;  2KS1 A;  2OAR A;  3LID A;  3RK3 C;  1RHZ B;  2RKL A;  4DT0 A;  1W2B O;  2L91 A;  1Y47 A;  2CPS A;  4QMA A;  1BCC J;  1NWQ A;  1FJP A;  1N7S A;  3IN6 A;  1QLE D;  1SFC A;  2AXC A;  4C7R A;  1BGY D;  1L0N K;  3HTK B;  3B5N D;  1HBW A;  3H1K E;  3E7K A;  3B4S A;  2KSE A;  1FS0 E;  1KB9 I;  4N78 E;  3RL0 D;  3AEE C;  5AW2 B;  4LC1 A;  4W7Y A;  4W7Z A;  4DJG A;  3A0H H;  5E79 E;  5KLI B;  3PJS K;  3B5N B;  3CWB G;  1KIL B;  4EDF A;  1NGM B;  1KTM A;  2KS1 B;  1NVO A;  1LTT C;  5AW8 B;  5H2F H;  1VQ8 P;  1PZQ A;  1DD4 A;  2C0X A;  1WRG A;  1LTG C;  2ZT9 C;  3H1K G;  3OJA B;  2KNC A;  2KXP B;  1QL2 A;  4N78 D;  1LTI C;  1LNQ A;  1DIP A;  4PV1 D;  1HTL C;  2MJZ A;  1YJN P;  3K5B A;  3PLN A;  2KI7 B;  5EFW B;  1A02 F;  1S5L E;  3I55 P;  1H0T A;  2ZAE B;  5K5G B;  2W8Z A;  1N2D C;  5CJ4 A;  4A7P A;  2W6J H;  4ASV A;  2LXB A;  1VL2 A;  1IFI A;  1YYC A;  2NZ2 A;  2HYN A;  1KIL A;  4I2L C;  4C46 A;  3CX5 I;  4ZKP A;  1SQX K;  1VF5 D;  3CI9 A;  5GTI H;  1BE3 D;  1HGV A;  3WMM 0;  3KZI E; 
#chains in the Genus database with same CATH homology
 1NTZ J;  5KLV J;  1KB9 I;  3H1L J;  1SQX J;  3L75 J;  1NTK J;  1L0L J;  3L71 J;  3L74 J;  3H1J J;  4D6T J;  1NU1 J;  1BE3 J;  1PP9 J;  1P84 I;  1NTM J;  1SQQ J;  1KYO I;  3H1K J;  2FYU J;  2IBZ I;  3BCC J;  3L72 J;  4U3F J;  3CXH I;  1BGY J;  3CWB J;  3H1I J;  1SQB J;  3L73 J;  1BCC J;  3L70 J;  1EZV I;  3TGU J;  3H1H J;  1L0N J;  3CX5 I;  1SQV J;  4PD4 I;  1SQP J;  2BCC J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...