1KB9J

Yeast cytochrome bc1 complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
127
structure length
127
Chain Sequence
EVKLQESGAGLVQPSQSLSLTCSVTGYSITSGYYWNWIRLFPGNKLEWVGYISNVGDNNYNPSLKDRLSITRDTSKNQFFLKLNSVTTEDTATYYCARSEYYSVTGYAMDYWGQGTTVTVSSAWRHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL-CYTOCHROME C REDUCTASE COMPLEX CORE PROTEIN I
publication title SPECIFIC ROLES OF PROTEIN-PHOSPHOLIPID INTERACTIONS IN THE YEAST CYTOCHROME BC1 COMPLEX STRUCTURE
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase/electron transport
total genus 21
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2001-11-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kb9J00
2Y36H 5FB8A 4WWKB 2RCSH 3BIKA 1D5IL 2X6MA 4V2CB 3TIEA 1XF4B 3X13A 4PPTA 5FUCC 1X5LA 3H3PL 4UIMB 1QFPA 3D2UA 3VXNA 3RVVD 4M8QA 4DK3A 2C5DC 4H25B 4JFZH 3WDIA 4ENED 1Q1JH 1WWAX 3HE6C 3DOSA 2V7HB 3B6SA 3BPCA 1XGTA 3WUWG 4AJ0A 4EOWL 4ESKA 2FZ3A 2VISB 2FJFA 1IKFH 4QTIH 5H37H 4MB4A 1D5MA 2C7UA 3CX5J 2A6DB 4PRAA 3IETB 1AIFB 1KJ2L 4OLYH 5D7LE 4KDVA 5D7KE 1JYNA 2PO6D 4LLYB 3T4AB 4CVUA 2OQJB 1D9KC 1P4IL 4G6KL 4X99B 4HIIA 4PJ9C 4XPFH 2XT1B 5EZJB 4HKXA 3IFOA 1BQLL 3X14A 1I9RH 1JWUA 1AO7B 3SDAB 1KCLA 3X3FL 1F90H 3IDMA 3NIGF 5EA0L 4ELKB 5KTEL 4TSAL 4M00A 4G9FB 5DI8A 5KSAD 3O6FD 1MRCH 3NZ8A 3BE1H 3DGGB 4NO2A 2R1WA 2H26A 4Z7WA 4HMCA 3JV4B 5F7HA 2HKFH 3WFEL 2YKLH 4ZG1A 2ZWLT 2DOCA 3DWTA 4HAGA 1M7DB 2ZJSL 2VLJE 3BD4A 3OKNB 4YDVA 1I7RB 4NZRL 2DQHH 3ZDZE 4UT7H 2GY7B 1OY3B 1QOKA 3GKZA 2DIBA 3HMWH 2R1XA 3RIFK 5T1KD 3I6GA 3W82A 3N85L 2JJSC 2CLZA 2D31A 2DI8A 5GRJL 3OHXA 2VMFA 1OL0A 1R5IA 2PO6A 5LG1A 3OGCA 3GK8L 3GMRB 1RIUH 3INUL 3CMGA 4KTDL 4XNYL 5JIIA 4ZNEA 4UV7L 2OXGA 1NGWB 4U7MA 1J1PH 1WFNA 2I60H 2P5WD 2J6EA 4HIEB 4UILH 4X0KB 3UPRA 3RWGA 2RFXA 2DKUA 4X4ZA 1AO7D 3OV6A 2EH7L 2X1PA 4TVPE 1U58B 1A9BB 4WNQA 3O41B 1H15B 1I4FB 1XF4A 5GZOD 3A0OA 1A4KA 4XC3H 4UIMA 3W0WB 4OSUH 4AZ8A 4H25A 3RDTC 2NXYB 3QIBB 5J1SC 4U0QB 4ZFGH 5C09B 3PDDA 1F2QA 1Y18B 3FO9B 2APWA 4XPAH 3ZYJA 3QUYB 2HYMA 2MTPA 1EVUA 3GHBH 5HYIA 2DQTL 4PJDF 3MLXH 1DQDL 5T1KA 1GGCH 2BSRB 5CIPB 4R4ND 3HI6L 2VISA 3BH9B 4PJ7B 3Q5YA 2FCBA 2HLFD 4APQB 3IETA 2PR4H 3SO3C 2ARJQ 2VDQH 2R2EB 2OL3L 4XP4H 3K8KA 4LLYA 3T4AA 2OQJA 4LAQL 3EYVB 2P5WA 5B38G 4K94L 4XVJL 3K1DA 5A3IC 5EZJA 1AO7A 1O7VA 1NMAL 5F7KC 1S7QA 3BT2L 4XNMA 4ELKA 4WHDA 1N5YH 4G9FA 5E5UB 1BF8A 3QUZB 4M6OH 1I8LC 1RIVL 3DGGA 4FABH 4RGND 3LZFL 4H20H 3ARYA 4QHKI 2QHLA 4KKCD 2HTLD 5DZLA 3PV6B 2QADC 5INDA 1LDPH 2VXUL 5CLTA 1NCNA 4NC1C 4I9WD 4PREA 4FXGB 1M7DA 1NAKL 3OKNA 1I7RA 1RUPH 5FOJA 3OJVC 1Q0YL 5FKAA 5FXCH 2IC2A 5FGSA 4PLOB 1WT5A 2DQUL 3L95B 4FNLL 5D7LB 5E8EB 4LPVA 2X40A 1W72L 4Y16B 4YHLH 2ZUTA 1DSFL 3KWWA 4FQJL 1FZOA 3KXFE 5GS0L 2NY6B 4LVNC 2XTJE 2XKNA 3V4PL 1NGWA 1FQ9C 4KI5F 4HKBB 4DEPB 4HIEA 5GRWA 4FQ1H 4MCZB 3BMWA 4EVNB 5E4IA 5IGXL 1LE9B 4PY8I 4I0PC 1F2XK 2VXSH 1H15A 1I4FA 4U6YB 4Z7WF 4XGZB 4I0KA 2E9IA 3W0WA 3CLEL 3B83A 4NGHH 5JHDE 5J9PB 5JW3L 5L7XL 5EBMB 2EZ0D 3MV7E 2PNDA 3OX8B 2EDBA 1HIML 3QIBA 2VLJB 5CP3H 4M1GH 5BVJA 1GH7A 1Y18A 3QHFH 3TFKC 3QUMB 4KAQL 2Y23A 5B8CC 1UWGL 1ERNA 3ARED 5BOZG 3MRIB 4HPYH 5DHVB 1JFQL 5ISZE 5EOQH 5CCKH 5CIPA 4WO4B 3BH9A 5ITFA 4PJ7A 4BSVB 1NBVL 4XX1E 5EFIB 4XPBH 4APQA 2R2HB 3LQZB 2F58L 3BO8B 4QHKJ 4PYGA 5LAXA 2R2EA 3GRWA 4PBXA 4NHCH 3WSQH 3QO0A 5GGRB 2FSEB 1WBXA 5GGTL 4HHAA 1R3JB 4K9EC 3WHE1 3BWUC 3I6LE 4ZQKA 1B6DA 1ZSDA 4WUUE 4JREB 4F3FB 4U1SA 5I8EA 3TBWA 4P9MH 3ARGC 3GSUB 2E8ZA 4HJ0C 2CRIA 4R0LB 3ARBD 5F9WC 4NN5C 3KNBB 4KDTC 5ALCH 4QXGH 3L5JA 5IFHL 4L4VD 4FXGA 5HI5C 4PGCA 4AG4H 2BCKB 3S37X 1ZVYA 2DQJH 3AS2A 1KB5H 1T0NA 1CFNB 3L95A 1KYOK 3O3AB 4PY8J 3TM6A 4XNUH 4O2FB 1F42A 1T21A 4ELME 1B0RB 5TFSH 2IEPA 3S8WA 2IPUG 3OKKB 4P46C 3SDYH 2Z31B 3FRPG 2F53D 4L29B 1F11B 3CH8A 4EVNA 2NY3B 4OFVA 5FUZH 4Z0XB 2LU4A 2BERA 1LEGA 1LE9A 1KCVL 1LK3H 3ARBA 4N90D 5J9PA 4WI2A 1JHTB 1UT9A 4LQFL 3V2AR 3THML 4L4VA 1L6XA 2VLJA 5CUSH 1G7IA 4PRDB 3REVA 3B9KD 4KMLB 3QUMA 3RJDA 3WS6A 5EU7C 1JPFB 3P4OA 2HP4A 3MRIA 3KXFB 2XZQL 2HJLB 3MUJA 4AK1A 4OCWH 4G7VL 5T1MB 1J1OL 2VB5A 4WRLA 3VD3A 4PR5A 3LQZA 3MNVB 1YEGL 5KVMC 4Y8AA 4XNQB 1IGTB 4J8RB 4FFYL 5GGRA 1QQDB 1OD9A 1I7TA 3EHBD 4NKOA 3ZTJH 2QSTA 3FRUB 5F89B 2B1HH 2MPAH 3WFDL 3EZJB 4BUGA 5JHDB 3MV7B 4W6WB 3KPOA 2W65A 4M48H 3RNQB 4RFEA 4DQOH 3KNBA 5TGBB 5JQHC 3UBXA 1G1YA 5ISZB 4IOIB 1X5GA 5FYKL 2BCKA 3O2VL 2VRAA 3DYOA 1MQ8A 4K9EL 4LAJH 4R8WH 3VWJC 1U9KA 1MCFA 3EJYC 3O3AA 5D1QB 3LY6A 5B4MC 2A38A 2V2TA 2AJXH 4KQ3L 4N8VB 5B39A 5KVFH 4LFHD 4S1RH 3OKKA 4JFDD 5DO2C 1GOHA 4JRXD 5L6YH 5IF0A 1DQMH 4WUUB 2IANE 1F11A 4XHJC 3WS3B 4QXUH 1IGFL 1RK1B 4GRWE 2HT2C 5IFAH 2P8MB 2VQTA 3O6LH 4GSDL 2WLZA 3V6BR 12E8L 1ES0B 5IMMB 5I30H 4H88H 4P3DB 3JTTA 4WV1B 2OP4L 3CZFB 1J87A 2W9DL 4U3CA 3MXVH 1JPGA 1AQKL 1JPFA 2W0FA 2GKIA 3KPRD 4HWZB 4Q9RL 4AIOA 4D9QD 3P9LB 5KANI 5DMYA 1AQDB 2P47B 1P7QD 4ELMB 5CHNB 2HJLA 5I8OL 1TVBB 2MHAA 3V79C 1U42A 2X7LA 4YGAB 5T1MA 4KWUA 4KRPB 4LPYA 3TPKA 3QDMD 4JRXA 4F37K 4AENB 3LQAH 4XNQA 3BQUD 4WU5B 5DLML 4PRHE 4KVNH 4J1UB 1QQDA 3S3PA 4NQVB 4RMTA 5J6HB 1C7SA 2XY1A 4HV8B 3FRUA 5JHDA 1NLDH 3MV7A 2NQCA 3BGFB 1P1ZB 3U2SB 3WXVH 3ARUA 4X83A 4LKXB 3QIWB 1EJ6A 5DC4B 1XCTB 2VN4A 4PGEB 5F7EH 5ALBH 4JKMA 5ISZA 4IOIA 3KPRA 4Y4KB 4LF3B 3EUUA 2NY2B 4M8VA 1P7QA 5FGBC 5CZXD 4UAOB 2PCPB 3B3IB 5D1QA 1AGCB 3VH8B 4HUWB 3L7EA 4JRWA 4N8VA 5JTWA 5GJTL 4ZXBB 4KUZH 2LU7A 1YQVH 1I3GH 2M1KA 3BQUA 3B8YA 3EOAA 1J7VR 3LKRA 4HGKC 4WUUA 5JW4Q 2LAGB 1SMAA 4CDGC 3KDMB 1DE4B 1KCUH 3HLAB 3MRNA 4JG0H 1ADQH 1ZHNB 1NKRA 3DECA 1HDMA 4GMSH 3GSRA 4OD3L 4WFFE 3SCMB 5IK3B 1NL0H 3FN3A 3OAZH 1CE6A 5IVZA 1EBPA 1P4BL 2BNQE 5IMMA 3TT3L 3I75B 5ACMA 4P3DA 1JGVH 2NY1D 1A7PH 3JWOH 4WV1A 1T1YA 3QIWD 1DQQB 1PKQA 3P0YL 4H8WH 3IU4H 4M93B 4JY6B 1A22B 1RUAH 3K1KC 4HWZA 3P9LA 2OXHA 3QYCA 1AQDA 3S36H 1S78C 1ZAGA 4N68A 4ELMA 1KEGH 1X5AA 4OCRH 2NR6D 3RWDA 4H1LH 3X3GH 3HNTH 4N8CL 2LQRA 2O93L 1A3LH 5KSVA 5GRVL 5JXEC 2IANB 4P2OC 4RISH 4ZXBD 5GRUL 5D1ZD 2QSCL 3O9WC 4WU5A 2AGJL 2VZTA 3UTTE 1V3KA 2ADFL 1TPXC 4J1UA 4NQVA 1VHPA 3QG7L 4JM2D 1WFUA 7FABL 4P5KB 5KAQG 4GRWB 4I3SL 4FFWD 5EZOH 2B5IB 3TN0C 1CQKA 1DQJB 4PJHF 1CWVA 1OTSD 3QDGD 3LCYA 1P5UA 1IM3B 1I3UA 1T1XB 1YNLL 1P1ZA 3U2SA 4I4WA 4X80H 4XMPL 5EDXA 4QHNB 4LKXA 3QIWA 1XCTA 5CBAB 1G7JB 3PIQB 2V5MA 4HWEL 5K9OB 3VFVB 1S8DB 3GO1H 4AYFA 2HT4C 1BGXH 3KYAA 4LF3A 5AEAA 1PW3A 4Y5YB 1OAYL 1BBDL 1QSFE 2QJDA 3MRJB 3QAZC 5BV7L 4JO4L 1WIPA 3LAFA 2JF1A 3UTZB 4YHYB 1DQLH 3B3IA 4IMKA 4UTAH 3A67H 3GBNH 2K3TA 1K4CA 3IJHB 4PRHB 4ZXBA 2XRAH 5D1ZA 2YHGA 5KVGL 1RZ7H 1OAXH 4XVSH 3IFPB 4JM2A 5DQDL 3KDMA 5GGSY 3GSVB 1HH9A 4NBXB 3TO4D 3HLAA 2Y4SA 3C8KA 3N0PB 4GRLD 4XP1L 1CD9B 5HHVH 3L3HB 3QDGA 4LPXA 1A7NL 4TRPL 5IK3A 3NH7H 4POUB 1MCRA 2QTEA 3MBED 3CDFA 3AFLA 4OCXH 4TQEH 3L5WB 4U0RC 2D7TL 3RTQC 4CN4A 2AABL 4LHUB 3P4MA 1NANI 2EDOA 1Q9WB 1N26A 5LXGL 4JY6A 4PBWD 4FQPA 4PJIF 3U9PH 3FOLB 4YDIL 5EUOF 2DQCL 5EWIL 2ESVE 4MB5A 4O51B 3M17B 5DD0H 2HKHH 5KVDL 2I24N 3TBVA 3STZB 3CU1A 2IANA 5F97E 5FA3B 3N9GL 3VGAB 4M1CD 4MQ7A 3V7AE 4Z7QF 2FYYB 3TO4A 1ORQB 3B5GA 3BKMH 4P5KA 3SDCC 4GRLA 1QHOA 3MRKB 4NQEE 3DBXB 4HSQA 3C60D 5BZDB 2IAMB 1NDGB 3C2AH 3QUXD 1A6WL 4QTHB 1BFVH 4O5LH 2BNQB 1IM3A 4RSVA 3FO0H 3NFSH 1T1XA 2V5SA 1X5ZA 5KSUB 4NWUH 5E4EC 4QHNA 5CBAA 1G7JA 4HIJB 3VFOB 5LWYH 4NN7B 2FEDD 1JV5A 1MPAL 5GGQL 3SOBL 3VFVA 1R5WA 1KXQE 4MGXA 5JXAL 4JN1L 1TTGA 1N59A 3QH3B 1D5BB 3UTZA 4NC2B 1JE6A 3UJIH 3PWPE 3TVMD 5D7JB 1CLYL 3MSPA 4XI5D 3UTTB 1QNZL 5J12B 5HHOD 4I77L 3AXLA 5CEYB 3ZT6A 2O5ZH 1BF2A 3GSVA 3H7LA 4DJMA 4NT6B 4HIXH 2IALB 1Y6MR 1CFBA 5E99L 4PRBB 4GAJH 4NO0D 4PG2A 4PV9B 4RGOH 2AQ3A 5FO7B 5BMFL 1G7PA 2BVPA 4KKAD 1JRHH 2C1PA 1P6AB 4JFXA 3QRGH 1LILA 1EAJA 1RU9H 5TPWH 4M43H 1IGIL 1Q9WA 1QSFB 2EDNA 5DT1H 1JPTH 4X6FA 4JPWL 2UUDK 5C0GB 4Y5XA 3MXWH 1C08B 4GMTH 3AAZA 3PWVB 4OF7A 2Y5EA 1OAZL 2NW2A 5TDOA 3JVGC 1J11A 2ZNXA 3NABH 2MCG1 4XBPB 5DF0A 3STZA 5HHXH 4GT7A 1IMHC 3ROLB 4JM2F 4QLRA 3G5YB 5HHOA 5L0QB 1NC4B 1SBSH 2VLME 1MEXH 1J8HE 1BZ7B 1OT2A 4JG1H 2AAVA 4NZUH 4C58B 2FYYA 1FVCB 3MRKA 4XP6H 3MV01 2OYPA 3LVEA 4CVXA 3M1BB 4NO0A 4C4KO 5D2LA 4QTHA 4X9BA 3CVHA 3DVIA 3JV0A 5GRYA 5T3XL 4N0CC 4CN1A 5KSUA 3V4UL 5DS8A 3WLBB 4XNXH 1BJMA 4L8SA 4OCNC 3VFOA 1CICC 4XC1L 3QR2A 5JNYB 3FQUB 5I73C 2CJUH 4TULH 2ESVB 1GGBL 2V6HA 3LKSB 5HVGB 2D03H 4BQBA 1E27B 4JDZA 3NN8A 4Z7VA 4K3DL 1KGCD 3HE7D 5D7JA 1YEEH 4HLJA 4ZSOA 4YX2L 4X4ME 1LNUB 3HR5B 5KS9F 4IRSD 4NQEB 5FK9B 4MJ4A 2DDQL 2OJZH 4P9HL 5CEYA 2OZ4A 4R2GD 4K7FB 4X7SL 1FIGL 3NCEB 2CD0A 4PB9L 1ONQB 2H9GB 4UT6L 5IVXE 4JFED 4NT6A 4HJJH 3FONA 2D7PA 4O00A 4HUKB 2JB5L 3SJVE 3VI3F 4PRBA 3VXSD 1NFDE 3O45A 4PV9A 1Q72L 2RGSA 4K2UH 4YHML 3HZYB 3GJFK 1U8MB 4QRPE 2D9QB 3EBAA 3LKQB 5DR5H 3ME0A 1VSCA 2P8PA 2CMRH 4OI7A 3ZDYE 3NGBB 5K9KB 4CMHB 3QJHB 4LLVB 4JKLA 1EO8L 3MCLL 1UKQA 3BKYL 3DO3A 2E7LA 2DMBA 1UXWB 1WBZB 1NCWL 1FLRL 5EN2B 3PWPB 1KPUB 3H9HB 4F9LA 2FB4H 2AXFB 2PXYD 3HG1E 4KJPC 4XBPA 5FGRA 5CZKA 2AXJA 4IRSA 3G5YA 4XXDB 3ROLA 4LNVA 1A4JA 3FAXA 1BZ7A 2R0WL 5I8CB 4MS8C 1NC2B 1NMBL 2EDEA 1KPVA 5FOBB 4K3EH 4R7DB 1F4AA 3N50A 1DR9A 1E4WL 3GSXA 1F3RB 1JI2A 2H6PB 4HF5H 4WW1A 4NRYB 5DK3A 1RUML 1M05A 5HYEA 1HCVA 5JNYA 3KHOA 3O11B 1SEQL 2VZOA 3O4OC 1WSST 8FABB 4LCCB 5HVHB 3O2DL 2ESVA 3LKSA 4RBPK 4Y19D 2XTLA 3FQNA 4LSUH 4RAUB 4JR9H 5JQ6H 3I2CH 2PXYA 4W70A 4LLUB 2RBLA 3QWOA 3WFCH 1C7TA 4YUEH 5DMIH 2OX5A 5IESH 4WI8A 5TDNA 3PJSA 1V5JA 1LNUA 2EDKA 3HR5A 5H2BB 1INEH 3EYSL 1T4KA 1J1XL 1X4YA 4K7FA 5FHBL 1S5IH 5D2LF 2DQDH 4WW2C 1ONQA 2H9GA 1E6JL 2H41A 4OD2B 5ENWA 2VWEE 1FHGA 2BDNL 1OGTB 1INQA 4FOMA 1JUFB 4HC1L 3ULUD 3DX9A 3HZYA 2CLRB 1U8MA 4Y7MA 3UDWC 5D1XB 2X42A 2CIKB 5TF1L 3LKQA 5JHLH 2BRQA 3NCFB 5JW4M 1KB9J 1DLHB 5M7QA 5MHSD 5I1KH 3EYOB 5JOPD 2A83B 4LLVA 3RKDD 3V5HA 3JTSB 1UXWA 2AI0H 2H1PL 1C8PA 4NBZB 1YPZF 5F8RC 4QOKD 4LLWB 3Q6GH 5I1IH 3PWPA 1IM9D 3ALPA 1N2RB 1HZHL 1TJIL 1YMHB 1TJGH 4A6YL 1FO0H 1IAIH 2DI9A 3PL6D 3NZHH 5IBTL 4L8DB 3GJFB 3BPLB 4XBEH 1NCDH 4Q7DA 1HQ4B 4QRRE 5IQ7H 1IC5L 1NGZB 3L9RA 2B39A 5I8CA 5IVXB 2EIZA 5JZ7C 1NC2A 2WQ8A 4ZUVA 5J06A 1ODAA 3MRBB 3CVHH 5JUEH 1B6UA 1Z0MA 1NFDB 1IEBB 1RJZA 4E9LA 5CKAA 5FOBA 1OVZA 5IT2L 1DL7H 4QRPB 1WBYA 5F72S 5KSBE 4ZO6A 4WU7B 4KI1A 1GVIA 4IRJB 3CFBB 4F58L 2BVOB 2H6PA 5F71A 3O0RL 5DYOB 4NRYA 3MRMB 3RWIB 15C8H 8FABA 3FB7B 2X9WA 4LCCA 2GTZA 2CKBH 4UZGA 1V3LA 1M1SA 3HAEB 4TVSa 4ZFOL 5DJZA 1IM9A 2VZ3A 4FZEH 2NY7L 1F00I 3HG1B 1XGUA 5F1SA 3MROA 3FOMA 3RVTC 2Y6SC 5EZLB 1MY5A 3V0WL 4NKQB 3HPJB 4UU9B 3UO1H 2P46B 2JJWA 3TCLB 4NRXB 1S7UA 5FGCE 5DVLA 2ZCKH 2R69L 3LN5B 4ZS7H 4LCUB 4DCQB 2B1AH 3LEVH 3P9MA 1OGTA 1SHMA 2QHRL 3BIAX 1TNMA 4D3CH 2BVUA 2WBJD 4NWTH 5MP6H 1LVEA 1QVOA 2CLRA 2YD4A 4DKDC 4X6DF 1Y0LB 4XPFL 2CIKA 4O2EB 2MKLC 3GGWB 1T6VN 1I9RL 1T22A 1ZANH 1YEFH 4WHYG 4P3CH 4GUPA 2A83A 1TZGL 4UOJA 2A1WL 5DUBA 1V8HA 3JTSA 5DJ2B 4KROC 4OLZL 4GXVH 4NCC1 1S9XB 3BUYB 3MJ8B 1QSED 4LLWA 3DO7B 3P77B 5C08E 1FZJB 1UVQB 2WK2A 4JQVA 4CADA 1DUZB 3GJFA 2FWOB 3U4AA 4LGPB 4QRSB 4NJAL 2HFTA 1TMCB 5LQBL 1G6RB 5IVXA 1CGWA 4JHAH 4R9HA 5IW6B 1K8IB 3MRBA 1PEZA 1NFDA 3V5DA 2R8SH 3FHQA 2ED9A 3MNWA 3RGVB 3F62A 3CUPB 2WBJA 1L7IH 1MAMH 3G5XA 4IRJA 2LTQB 3CFBA 1DQTA 2BVOA 2Q7YB 3HMXA 1CDCA 5K59F 4ONFL 4JFFD 3KS0H 1RPQA 1ZS8B 1ZKAA 4K8RH 3SKNA 2G75B 1TETH 3SE3A 2A9ML 3FB7A 3F7YB 4OCYH 5TQ2L 1QSEA 3CFIC 2EYTB 5D9SB 3LN4A 5CJ5A 3MJGX 3GMPA 1JNLH 5J89A 4KI5C 5LVEA 4ERSL 4D9LL 3TT1H 4QRRB 1EEZA 2EC9T 4ZO8A 5DSCB 3KPSE 1MVFA 2Z91A 4QRTB 1UCTA 3VG0L 3HPJA 4AEIL 4PJGF 2XWJA 4JDVB 4LKCA 3MREB 1I7UB 2OR8A 4KTEL 3HNSH 2GYSA 1MRFL 4NRXA 5FHAH 1HHKB 5GQBA 4ENEC 5IW1B 3NPZB 2G5BB 4PLKD 3LN5A 1RIHH 1E0OB 4DCQA 2FRGP 2ICEB 2PR4L 2KPNA 3CSPA 3UJJH 5IM7B 5FYLE 3RWFA 4OZIE 1HHGB 2HVKB 3NCYS 3U30B 4H1LG 3T65B 4YXLH 3UAJC 4DAGH 3BVNB 1UM4H 2YD3A 1MLBA 4OZGA 2PO6C 3BZ4B 3FAWA 3MV8D 2Q6WA 2EH8L 5IBUG 3U82B 4HT1L 1KOAA 1FFNB 1DEEB 3KPTA 2UWEA 2FL5B 1S9XA 3BUYA 4DZBB 3DO7A 5C2BL 3P77A 5KSAC 1FZJA 3O6FC 4CNIB 1UVQA 2V5RA 5IG7B 3FQXA 2AXGA 5E8OA 3Q3GB 3L5XH 1K2DB 1NGXA 3L5HA 3OKMA 3UBXG 1ZHKB 4QRSA 5FGCB 2CLVB 2HAZA 1MCIA 4X6BA 4GG8A 1G6RA 1I85A 4YE4H 5IW6A 4YBQD 4AIZA 2LU3A 2R1YA 3RGVA 3CUPA 2C4FU 4R97C 2VNCA 4OB5H 4FHBD 4V1DD 3MR9B 5DD6B 5B39G 1C16B 3TH3T 4GAGL 2EKSA 4RMSA 3KR3L 4X4XB 2CRZA 2Q7YA 5MEOA 3MV8A 4FQ1L 4QXWA 1FNHA 3PWLA 1JYXA 5HVFB 2G75A 1RMFH 3F7YA 4K23H 4HWBA 5C08B 2VUOA 3DVFA 5D71H 2VR5A 3R8QA 4JQIL 2YUZA 1S9WB 5DC0A 3O8XD 4FZ8L 5AYUH 2VO5A 4ODTL 1ZT4B 5DSCA 1KIUA 2XI9A 5GZOC 3HFMH 4KKLD 3GB7A 4P5MB 3RAJH 4JDVA 3LH2L 3MREA 5DRZA 3O4LE 4HPYL 2QV2A 3M8OL 3ARPA 4N0RA 3KGRA 4FTVE 4XVTL 1IGCH 3DRQB 1PAMA 2CGRL 4BZ2L 5IM7A 3W2DH 1A9EB 4R4NC 4LFHG 1WT5C 4PJAF 2HLFC 3VFUB 4MJ5A 1IAKA 2OCFD 4HK0B 4WTXA 3MRCB 2WINB 2FLRT 2IQAA 4Y88A 1DDHB 5I0DA 1M71B 3DSFL 4XCEB 4P9ML 4FQHB 2BX5A 3W9DB 3VFSB 1FFNA 1LO0L 1DEEA 4NUGL 3O8XA 2FL5A 4DTGL 3P0VL 4DZBA 1ZMYA 3KPSB 2XN9D 4PJEE 3JZ7A 3MRLB 1F6LL 1PY9A 4CNIA 5KVEH 2DMKA 5IG7A 5DRXB 4R4FH 3QULB 4F7PB 4RGNC 3VW3L 4ALAH 4KKCC 2HTLC 5EC2A 2CLVA 5FUCE 3BD5A 1VCAA 4YO0B 4IS6B 2CRYA 4ODXB 3GEWB 5ACZA 1DBKH 4XX1G 2HA1A 4Y8DC 1OT1A 5CEZH 1S7RA 1YMMD 3CDYA 2ICWA 4HUNB 4MA1B 3OJMB 3WKNA 4MMXC 4Z5RA 1MIEH 3JWDH 5EIVA 5E2VL 5DRWB 5GGRY 2J6EL 1N8ZB 1HSBB 4N8VG 5JPNA 1C16A 2VITA 4NN6C 4DFHA 4OZGF 1MVUB 5DJYB 1CDJA 1JGUH 4X4XA 2R15A 1HE7A 3LS4L 3AB0B 4WCYH 1MHHB 3QUKA 1C5BH 1D5ZA 2MKWA 3BXNB 4DVRH 1EIBA 2QKIA 1UB5B 2UWEF 3MX0A 3U1SL 3HZKB 4JGMA 2NY0B 3CX5K 3VJ6B 1OPGL 1S9WA 3P73B 2XA8L 1WZLA 4EQ2A 3MLSH 1KJ2B 3LQAC 4PJFE 1WAAF 4G8FB 4J6RH 1ZT4A 3VFRB 1K4DB 4Q9QL 3LKPB 1ACYH 4LEXH 1VEOA 3LD8B 5GIRB 1HKFA 3LMJH 3I9GL 4HKZB 4JHWL 3ES6A 3VMPA 1QFWI 2YPLD 3K4DA 4XWOD 1PBYA 4OCWL 4OGYH 2DD8H 4KHXL 4YC2B 3AREC 5D2NA 5DHYA 4M02A 1N0XL 2X44D 5B3JE 1A9EA 2AS5M 4CJ0A 2VDML 4PJCF 4OM1L 1TTUA 3SE9L 1CDHA 1H8OA 3MRCA 3WEXB 4NO5B 5IJVA 2WINA 1H5BB 1KN4H 4G6FB 4PRPE 1M71A 4XCEA 3MTRA 4M7KH 5J11C 1CCZA 5CP7B 5AZ2H 3VFSA 3ULVD 2IF7A 4NQDD 2JB6A 4PV8A 3KPSA 4U4BA 3UBXI 1QYGH 3O2WH 3OKOB 2V9QA 1EPFA 3O4LB 3MRFB 4C59B 3CK0H 2B20A 3QULA 3H42H 3ARBC 5LCVL 4F7PA 3CX2A 3BN9D 1I1CA 1OM3H 5A1AA 4ZFZB 4FTVB 1AR2A 4IS6A 2YPLA 2X4UB 4HXBH 4ODXA 4YO0A 2FATH 3MLVH 5I74B 3DNKA 3HC3H 5C86A 2CXGA 5ICYB 3WS6C 3MOBH 3JWOC 4XNZB 5JLZB 2GJJA 4M6NL 4LRNL 5B3NA 1KC5H 5E1AA 4LNRB 4O9HL 5KVFL 4P99A 2DJSA 1RSFA 4H8WC 4NQCE 1MVUA 1MJJB 1DQML 35C8H 2KUTA 2RHEA 1T7VA 4TUOB 4Y2DB 2X9YA 2EDDA 4XAKE 5KJRH 2F8OA 4Z76B 3UTSE 2FX9H 1UB5A 4NYLB 4PJEB 1EO7A 2BZDA 5I9QB 4EI6B 3CC5B 1JMXA 2GJ6D 3QDJD 3I02B 4TUJB 4RZCA 4X7CC 3MRRB 1KIQB 3O3UN 4NCDA 5JW5B 4JKPL 4G8FA 3TNNB 5CSBA 2OL3B 1K4DA 2X9XA 2J7LA 3LKPA 3MXVL 3FT4B 2WIMA 1MAJA 4HKZA 2O26U 1FPTH 4KMTH 5FCUL 1U93B 4G9DB 3B9KC 5ETUB 3DV6B 2BMKB 1VADB 2BOCB 3DTXB 3H9SE 5E2TH 3HE6B 5ADOL 1K85A 4NZJA 3GRWL 3V5KB 4AEHH 4HUVB 5E8PB 1CG9B 5T5FL 3ROOB 3MLWL 4V2BA 3QXVA 5IVOA 2WUBL 5C0EA 1S3KH 1WTGT 3PWJB 1SM3H 2XWTA 5IWLA 3CU7A 4IMLB 4Z0BH 4GLRI 1D9KB 2QQLH 1RQ5A 4PJ9B 3UTQB 2NZIA 4B0MM 2Z8WC 1DANT 1FGNH 3IDIB 5CP7A 3FN0L 4PJFB 2GJ6A 3QDJA 1MQKH 3EHBC 3T3PF 5IB5A 4G6ML 4XH2B 1NSNL 4JY5L 3A6BH 3BFOA 3X12A 4UQ2B 1BFSA 3MRFA 3MLRH 4G5ZH 5HDQH 3P4NA 1T5XA 1QBLH 3QXWA 2DQIH 2X4UA 5DUMH 3VFTA 5MEQB 5ERWB 3LHPH 4YZFF 3BZFB 5JLZA 4UBDD 3ZE0E 5CJOL 4LNRA 1ZA6B 3EKCA 5E8NB 3W39B 4JO3H 1YQVL 1KLGB 4G7YL 4I8DA 4MDJB 3RUGA 2D7MA 1Z9LA 4KXZI 3TO2B 4PRPB 4NNPL 2QQKL 1IC7L 3I3EA 4Y2DA 4YR6B 1FORH 1DFBH 2BK8A 1HINL 3ZZ1A 2H32A 4UNTA 4NYLA 5FYKE 4PJEA 5EORH 4Y1AE 4PJBA 2OSLB 1FG2B 4YHPA 1YJDL 1WEJL 1IGML 4TUJA 3I02A 3QUML 2YA1A 3MRRA 1TCRB 1LWRA 5JW5A 3B8SA 1YQ2A 2YA2A 2GUOB 3TIDB 2YK1L 1S9VB 4HEME 4DVBB 2NXZD 3T8XB 1VFBB 1FVDB 1WIUA 3RDTB 3G6AB 2EE2A 4G9DA 1QFWL 5DVOA 4HLZH 4PTTA 4W4OA 1VADA 3ZKXC 3DTXA 3HE6A 3X3GL 3QEGL 1DJSA 3V5KA 4HUVA 4NQCB 5J1TC 3NACL 5E8PA 4OF0A 1CG9A 5DHVH 4GKOA 3OF6A 4UTBL 4TVPL 4U31A 5MERB 5IQ9B 3SO3B 3PWJA 2PYFA 3UTSB 1IQWH 5F70A 4YXHL 4FQXD 1WFOA 5J1AB 1T03H 1QRND 3ULVF 3E6HB 4BKLB 4H26A 1I7ZB 4Y0GA 4PJ9A 4NOFA 4WY7L 3B2VL 3BQUC 4Z77B 3IDIA 3MV11 4PJFA 2W59A 4XH2A 4ZTPL 1OHQA 2FO1A 1QHPA 3ABZA 3V6FB 1OW0C 1AKJD 2QADB 5F7NC 3O6KH 1J88A 3H9SB 1CD0A 3E2HC 5SWZE 2NW3B 4KRMB 1RHHB 3QIUD 5MEQA 5ERWA 4QF1B 1HI6B 4GBXC 5EU7E 2BY0A 1ZA6A 3NPSC 2O5XH 5HHPB 2P7TA 4MDJA 1G9EA 3HZVB 2OMBA 4TUKH 5C07D 3TO2A 43C9B 1FL5B 3D3VE 2APBA 4LVNB 4FFVD 1QRNA 4U1IA 3ULVH 4YR6A 1IZJA 1FRGL 3PP4H 3DIFB 2E5EA 4WFEE 1YYLH 5KOVC 3ZE1F 4L8BB 1OB1B 1HOCB 1BZ9A 1FG2A 3DXAD 4XT1C 2PW2B 3FL7A 2ZG3A 5HHQA 5I75C 2X4TA 1WK0A 4I0PB 1FVEB 1CDGA 1MELA 2GUOA 3EW3B 1S9VA 1AKJA 2J1KA 1L9NA 3QCTH 3WFBL 4HXAH 4U2YA 1FVDA 3RDTA 3G6AA 2NY1C 1JL8A 2F5AH 1Q94B 3F58H 3HNVH 4JPVH 3DUUA 1JTTA 1QBAA 1G0DA 5B8CB 3E1F1 2DS4A 2HKHL 4NQCA 2UVFA 3RUGF 4QEGA 5C07A 2FBJH 1SYVB 3D25B 4OZFB 3WNNA 5J6GA 3UTSA 5D8JL 1UH4A 3WLWC 1PVHA 3N1PC 3QI9D 1ITCA 2DICA 3E6HA 3NTCL 4K3JL 4Y1AB 3VFNB 4BKLA 5D1ZC 4PJBF 1TQBC 2KBGA 2I07A 4Z77A 2W91A 3DYMA 4JM2C 3NFSL 1RUQL 4S10A 4FFWC 5HPOA 2WP3O 3EIFA 3KYOB 2HLAA 3ARGB 2Q76A 3GMQB 4JZOB 5LJYH 3PABA 3RWCB 5ESQB 3C2SA 1U8PB 1BAFL 1AC0A 2AJVL 3BGMB 4Q0XH 4XZUB 3OAUH 4M9PA 4M7LT 4NN5B 5F9WB 2EDWA 3C09C 3HI5L 3MUGB 2NW3A 3PDOB 3MFGB 4JFPB 4XMLH 1AC6A 3QNXB 1A1OA 1CT8B 1HI6A 3GMNA 2F19H 3FB6A 3JUYA 5ANMA 4MJID 3MLPA 1IFHL 3RL2B 3QJFA 2VH5L 5BRZE 5M95B 5F7DA 1UACL 4EBQH 3HZVA 1KENL 1FL5A 3QI9A 1JNHB 1RZIB 2H32H 2G2RB 2GT9A 4MQXC 1OAQH 2VDNH 3JV6A 4PS4L 5HGBB 3QFDA 5F7YC 4P46B 3RZWA 1KPRB 5L8JB 5E9DE 3MODH 4KQ4H 4UNUA 4M5YH 4LLDA 2PYED 1BHGA 4MYWB 4L8BA 3OZ9H 5F7LB 3OAYK 1HOCA 2EO1A 5C1MB 3TO4C 2PW2A 1IGYB 4CN6A 3FT3A 4IHOB 2C4XA 3CDGA 4OCMC 5JIPA 4JFHD 5K93A 4I0PA 1FVEA 5DEFB 2IQ9L 1RD6A 3MBEC 3V7MA 1P84J 4IEFB 2L7JA 5AAMA 3SKOB 1ORSB 1JPTL 1D3CA 5SWZB 1JBJA 3MUHL 4HD9A 2CO7B 4B50A 2XZAH 3FQWA 3LS5L 1JIBA 3VXTB 4R96B 2BVYA 3QBTB 5B8CA 1JNJA 4PRIE 1IAII 1CD8A 3ZSTA 4MAUH 1T1WB 2J4WH 2Y5TB 3EYFA 1KLUB 3D3VB 4PD4J 1MJ8H 1CR9H 2IBBA 1R3IL 2GJZB 1S9YB 5CFHA 4LQ1A 4NPYB 2YA0A 1M7IB 4L4TE 1HK6A 2YRPA 1J0IA 2EEBA 2CR3A 1LEIA 4W6XB 4Y1AA 5KN5A 2HWZH 2UYLB 2PYEA 4M1CC 3H3KA 1GIGL 1RZKH 4L9DA 5F9JA 3VFGH 2YBRB 3BW9B 3C60C 2OR9L 3QUXC 5KBNC 1HYRC 5AWNL 5GISH 4JZOA 4KDWA 1VESA 5CJQL 3CIQA 2AJYH 5ESQA 3QWRD 3IKCB 1U8PA 2EEDA 4BA8A 4CVWA 5DD3L 2ZSWB 5E00B 3WNLA 3BGMA 1HSAB 4EXKA 3QNZA 4KDTA 2AK4D 3DETD 3BP4B 1BFTA 1Y6NR 1YYML 2FEDC 5TE7L 3MUGA 4RGMC 1MCBA 4JFPA 3DVNA 3ILPB 4LPWA 3OXRB 3QNXA 4GRMB 5K9JL 3VWJB 1AGFA 4Y5XC 4YHIB 4Z6AT 3TBSA 3RL2A 3GMMB 1AE6L 3ILQD 5DD1L 1LD9A 2DM2A 4ZUTB 3TVMC 1LP9F 1JNHA 5C0AD 1RZIA 1RAMA 4NO3A 4XI5C 4BSWB 4OJFL 3KPNB 2GITB 5HGBA 5E6YA 2GQHA 1F4XH 3GIZL 4HJJL 5EIIA 3JBG7 1NCTA 3E8UL 4AY0A 2EICA 3SPVA 2E27L 1KTLA 3SKJL 1MFNA 5GGVY 5B38B 2X4QB 2VDPL 3MRDB 3RX5A 4JVWA 4NQUA 3OKEA 4R6UA 1WFTA 3QWRA 4Y4HD 4KKAC 1IKNA 2FIRT 3UZVB 3SKOA 3ZE2E 1ORSA 4XTRD 5CILH 3RNKA 3TBYB 3MC0A 4QRUB 3BRDA 2AK4A 5D96C 1EFXB 3BUTA 2QSQA 3ZMRA 1IBGL 4L8SC 1OGAE 3VXTA 4R96A 2IPUK 4HCRH 2DLFL 4TOYH 3CFDB 1CZ8H 5BRZB 1PX4A 2QLVB 5ADPH 5JW4N 1T1WA 3D3VA 3LQMA 4LDLB 1AHWA 3EJYD 1A6UL 3MUY1 4P5TD 1UWXK 1LK2B 2GJZA 1S9YA 1CL7I 4QXTA 4NPYA 1M7IA 1QLEL 1YEIL 3BAEH 2VN7A 5E9DB 3BRGC 4JRYE 3TV3H 4ODBD 5DK2B 3EO9L 1ZWIA 4XWGH 5EBWA 4MHHG 4LSPL 2ZUSA 5IKCB 4ZTOH 3VFWA 1CI5A 4OIAA 5C0CD 3O3EA 3MBXH 3BW9A 5T33L 3G5VB 3MLYL 1VFUA 1CFQA 4G43A 3H2WA 2VERN 2QBWA 4WI9A 2AK1H 1SJHA 3IKCA 4U1LA 4P23D 2ZSWA 5E00A 4CVZB 4G8GE 1VA9A 1G6VK 4HULB 3BP4A 5HGAB 5C0BE 1OSPH 5IB2B 1DEDA 2VZUA 1MREL 1FNFA 1GCFA 2VDRH 4XCCH 3GJEB 2RAMA 2F9BT 3H3BC 4N0FA 3OG6B 5TQ0H 2IFFH 4YHIA 4L4TB 4P5TA 3VD5A 2BC4A 5TE6H 3WIIL 3PP3K 2FD6L 4OZHE 4WFHE 1JMZA 5C3LD 2WUCL 4ZUTA 4ODWA 3HE7C 4GKNB 4GW1A 5T3XE 4BSWA 1YEDB 1EAPB 1S5IL 1GSMA 3KPNA 4JZNA 2GITA 5GHWH 4MA7L 4IRSC 3D39D 4F9PA 3UZEA 4R2GC 4YHOH 3O3BA 4FFZH 1HXMB 1QO3A 2VDLH 4DKFL 3LPGA 2W9EL 3QSKB 4Z7UE 3DROB 1RK0B 1JHLL 2EKJA 2J3SA 4P23A 3VCLB 5T3ZD 3MGAA 5FM8A 3CFJA 3IDGB 3QNYA 3TBYA 4HBCL 1I1YB 4TTGA 4UIKL 3P40A 4I1NB 5DGRA 3PE9A 3GBLA 2EDQA 2X4NB 3CFDA 5IHUL 3MJ9A 2I9LA 5F9DC 4W68A 4X6CA 5DVNA 1HHJA 5CZVH 4N1EA 4K8RC 4GQ9H 3BP7A 2JLLA 1CYGA 1ZA3A 5I1JL 1Q9LA 4ODVL 4ZOEA 1N4XH 1ZTXH 5EU4B 1MCJA 2PXYC 2YD9A 3TYGL 1NAMA 4P2OB 3CVHL 5JUEL 4AM0B 4OI9A 1CQYA 1BBJB 3D39A 1MCOH 3IKKA 5DK2A 3O9WB 3NA9L 4GXUN 1DL7L 5GS2H 1TPXB 1B4JL 5A2LH 1V7MH 5LBSL 3TN0B 4QT5B 1U3HD 4NCC2 5I8KL 4IRZL 3RY4A 3PGDB 1OGAB 3DMMC 1YY9C 1T2QH 5I1DA 1YDPA 1II4E 5AZEH 1KELH 5IB2A 2NY4D 3PQYE 1H0DB 1FE8L 1KN2H 2OI9C 3GJEA 1TITA 4OZ4B 1MI5E 4LPUA 3QAZB 2BXYA 3X11B 2Q7NA 5KW9L 5FGBA 1WWCA 2OZ4L 4L4TA 4M7JH 4Y89A 4JRYB 1FN4B 3OR7B 2VXQH 4PJ5D 1FNSH 3KYNB 4GKNA 4F7CB 1MJUL 5CMAB 4AH2A 4P2OD 2VC2H 5DFTA 3RU8L 4MSWA 4J4PD 1MFDL 1WZ1L 1HXMA 2R0ZH 1B2WH 2D7OA 2A9NL 1OAUL 3BKJL 1RK0A 3S96B 2H2PD 1SEBB 4UT9H 1ZANL 2GFBB 4K71B 3VCLA 3CPLB 4P3CL 4U0RB 5IB4A 3K8LA 3MACL 3IDGA 4PGDA 5D70H 5C0BB 2BRRH 1A5FH 3RTQB 3SDXA 3U0WL 1PLGL 2BVQA 1EGJH 4DZ8A 3VA6A 3G6JB 1IZKA 3KYKH 3EDDA 3RKDC 2X4NA 2GCYB 1AGDA 3KPPB 4JDTH 4OZHB 4Z95L 4PJXA 4E41D 1ZLSL 4JN2B 5I2IB 4P48A 2YN5A 1D6VL 3QPXH 2OTPA 4YK4C 2LV4A 4PJ5A 1OP9A 1CL7L 5EU4A 4OTXL 5I76B 3PL6C 5JXEA 4MHHI 4KZDH 2X4SB 4P2OA 4AM0A 2D7NA 4ZD3H 4AL8L 4OBSA 3STBA 3O9WA 5DMGD 4IOSD 3O6MH 3SKUD 2DF3A 2PTVA 1OQXA 2O5YL 3D18A 4Z7UB 3QA3B 4WI7A 5HYJD 3MOAH 5GGVL 4HW6A 4C4KT 4L5FH 4P2RD 4QT5A 1GGUA 1U8IB 4O02H 1XGYH 4OD1H 2R4RH 4S1QH 3DHMA 4HK3N 2X1OA 1F6FB 2XFXA 1JHKL 5DK0B 5E4EB 2XXCB 3SGDI 3PGDA 4YLQT 1OGAA 3I6KB 1A6AA 2MFNA 3ZKQD 5JR1H 4OLXL 5FYJU 1BD2B 3R8BB 4KHTL 2P48B 4NUJA 5E6ID 4YHKH 4OZ4A 3IT8D 1A1NB 2DN7A 5L9DH 3DUSB 5JDSB 1K5NA 2CQVA 1FNAA 3VWKD 3LKNA 5DQJB 1WC7B 1FN4A 3OR7A 3L3KB 3AS1A 4P4KD 1S7TB 4F7CA 2IGFH 3SY0B 1OP5K 3CH1A 5DJ0A 1UM5H 3R1GL 2PW1A 4HQQL 5CJBA 5HYJA 1DBJL 4QGTA 1MLCA 4HLZG 4P2RA 3SDCD 3CXDL 1HKLH 3N1GC 1N64L 4NHUB 1A14H 1MFCH 1SEBA 3KPMB 4D9RE 2WBJC 2GFBA 5I1EL 2JIXD 2B2XL 2KDGA 2W0PA 1H8NA 3KAAA 3F12B 4ZDHA 3RTQA 3B9EA 4PP2B 3PQYB 3V0AC 1GPOL 2AEPL 3MJ9H 3P30L 4PRNB 1HXYA 2VR4A 1MI5B 3T4YA 1RFDL 3MA9L 3G6JA 2PN5A 3T2PA 1ZHBB 2ATKB 3RX8A 1GC1L 1BD2D 4HGWA 1N6QH 3EO1B 1P6FA 3KPPA 2QEJA 4JN2A 5I2IA 2FO4B 4MD0B 1ZLVH 4AQ1B 4LCIL 2P1YA 5DD5L 1TTFA 5C0ND 1A2YA 4NFBA 5I76A 2JCCE 3HC4L 1ZEAL 3ULUL 1IC4H 4I13B 4YHNB 3UTPD 4NM4L 1PQZA 4JPKH 4RAVB 1MF2L 5HXMA 3SDCA 2BY2A 3V95A 4XXCC 4BQ9A 1NCCL 2VLKD 1U92B 1A47A 2JE8A 5T3ZH 2YD6A 5F44A 5FYJD 3VXRE 1U8IA 1M6OB 1CXHA 2FEEI 1F8TL 2AJZA 2JIXA 3SDXF 2YD8A 3H7BB 1Q0XL 3ULSA 5DK0A 3FMGL 2HH0L 4ETYA 4KZEH 3I6KA 4JFYA 4K23L 3F65A 3RIAF 3EO0A 1A6ZB 1CICB 3EJZD 4RWHA 3D85D 4POYA 1BD2A 2L0DA 4PJXF 5I73B 3WIFA 3GKWH 1A1NA 3CZJA 3HFML 4ZOAA 5JDSA 1F4HA 5BOPA 1BM3L 1KB9K 5I0ZA 3DARA 1T66D 2VDOH 5DVMA 3MCKB 2NNAB 4X5LA 5DQJA 2P5ED 3L3KA 3HS0B 2X05A 3U4BL 3OXSA 3FT2B 1U8NA 3K2MC 4NDMA 2XPGA 5FUOL 4MA8L 5FKPB 1RUKL 3U7YH 3ZKMD 5F9OH 5I15L 2F74B 1BREA 1XGPB 3NIGE 2VLLA 1GGIL 2VLKA 1I85C 1IEAB 3KYMA 3P4LA 4PLKC 5DQ9B 1UCBL 1N7MH 1FZMB 4NHUA 5I19H 1FLTX 3G5ZB 3NCCB 3TA3D 4HWUA 4PP2A 1VACA 3PQYA 1QR4A 4DKEL 1DBAH 4D2NA 4OF8A 3HPLA 1VFAB 4OUUB 1MI5A 4MD5B 1ZHBA 3U0PB 3BKCL 4F57L 2ZPKL 5CGTA 3EO1A 2R4SL 3IFNH 4GJTB 1J0HA 3L1OL 1C5CH 3VGFA 3IFLH 2P5EA 2ICWI 1P7KB 5J3HD 3MPCA 3GZKA 2ED8A 1R0AL 3RWHA 5MEPB 3MNZB 5T1DL 2D7QA 3WIHA 2ITCA 4OCSL 3GSWB 1MIEL 4DUXA 5EH1A 2Z8VC 5DJDB 2XZCH 3FCTB 1YNKH 3HMXL 4YBQC 3WKMH 2FR4B 5ESVB 1QFUL 4LU5L 4UDUB 1CU4H 1MWAA 1E4XI 2EE6A 3ZYZA 2ORBL 3TA3A 1HEZA 3UYRL 1FNGB 3GI9H 1PSKH 3QUYC 3A6OA 3U7WH 2VDKH 3GHEL 4OLVL 5ECJE 1A6ZA 1CICA 1KBGH 4YDJA 4PJDE 3DGCR 1N5AA 3IJYA 3DVGB 3O4OB 1T0MB 1IT9L 2XG4A 4ACPA 1FYTE 1T7YA 4G8EA 4XAWL 3S37L 3HAEH 5E56A 1KTDA 1ZT7B 2BSSB 4LSRH 4W6YB 2OK0H 2VKXA 2JCCB 3O8XC 2NNAA 4EDWH 5L8KB 2NYYD 5I1AA 3T0DA 3HS0A 4X7DC 4KKLC 5JA8B 3NAAL 4NP4H 2YPVH 5FKPA 2A6JA 4M7LL 1HQRB 2F74A 1XGPA 4JM4L 1MHEB 3QUZC 1JWSB 3VXRB 4WW2B 2CSPA 3QEHB 4LLAA 3LEXB 1IEAA 3CCHA 4RNRB 4WENB 5IB1B 3BEWB 1JNNL 1UXSB 4GKSB 4NNXB 1WICA 1A7QL 2ICWJ 2EXWD 2E7BA 2ERJC 2VXVH 3PWNB 1I9JL 4LARH 1VFAA 2EYRB 5EOCL 4OQTH 4J23A 5DJAB 4JPIB 2CDGB 6CGTA 4U1JB 1NGQH 2W60A 3E6FA 5C6WH 1FDLL 1G6RL 2GSIA 3E0GA 1XF2B 3BPNC 2C3VB 4R3SB 2IG2H 5EU6E 1P7KA 5HSFA 4KI5E 3MGTB 5DURB 1X5XA 3MNZA 2KZWA 5E03A 5BJTB 1XF1A 4IJ3C 3U6RB 1RZJH 4MD4A 5DUPL 3GSWA 3WJJC 5DJDA 2FR4A 3FCTA 4LHJB 4Z7WE 5ESVA 4UDUA 5HY9A 2F54D 5KSBF 4PG9A 3R4DA 2HMID 2FEEL 2RJMA 5D2NC 3D9AL 2DTMH 2VABB 1YEJL 4HWBL 4BH8A 2CH8A 4U6VH 1FNGA 4LHQB 5DA0B 1P69B 4XCFH 1QFHA 3FO2A 4MXVF 1EEYB 3G08A 2A2QT 1CD1A 1NLBH 3DVGA 1F4WH 1T0MA 3ZTNH 3O3DA 1MHCA 4RWYL 3TH2T 4MNHA 3V52H 3S34L 1IL1A 4WGVB 1JGLH 4NZTH 1ZT7A 2BSSA 4ZNEE 1XIWD 2JCCA 1Q9KB 1CGSL 5TJWK 5CWSB 3BN3B 3EOTH 1NEZB 4HUXA 3WMSA 4XPGL 4YDLC 1JP5A 3BIBX 4CKVX 2Q87A 1V7NL 3G04A 4KJWD 1MCPL 4YDKL 1XH3B 5FYJH 4Z8FL 4F7MB 1BVLB 1KLFA 4XP9H 3S88L 3LRSB 4YIQA 2PTTA 3SE8H 3IXAB 2BNUA 3QEHA 4MXQC 1A7OL 4RCAA 4XWOC 4BFIA 4RNRA 5IHBA 2FHFA 4JLRB 3BEWA 4GKSA 2EYSA 3EYUH 1BQHB 5L88H 1EX0A 3BDYH 4M61B 2KL6A 1U8QB 3UDWA 2FX7L 3PWNA 3OL2A 1IAOB 4NM8H 1XCQB 4PJDB 5EZIH 2CDEA 3GBMH 4FQCL 2NY5H 1FYTB 1PG7H 2ITDB 3GSNA 4ZAKD 4N5UA 2CXKA 2DL2A 2VE6B 3PXJA 3PWUB 4RDQF 2R0KH 4KROB 3RZCD 3ULVC 1ZE3C 1VKXB 2P5WE 3VDCA 5F88B 1T3FA 4HZAA 1XF2A 1HHIB 2C3VA 4R3SA 1AR1C 3B4NA 2I5YL 1QBLL 2B8OT 1AO7E 3LV3B 3MGTA 4C56D 3IVKA 1MIML 1E6OL 3X13B 5DUML 1EUTA 5D72L 5D7IF 3RVTD 2Y6SD 3D0VA 1YEKH 3BN9C 1CXEA 1DUYB 3D2UB 4HS8H 2Q8AL 2IBZY 3WD5L 5J7CC 1MWAH 3MO1A 4U7SA 4UB0L 3QZWA 1MRDH 4EIGB 1E4XL 3ARFD 3BJ91 3BPCB 1EH9A 1XGTB 1EO5A 2VABA 3Q1SL 1BEYL 2BNRD 4E42A 3HRPA 3ARXA 1CBVH 3PHSA 1I9IH 2XKUA 25C8H 2FJFB 1IQDB 1D5MB 4PRAB 4OLWH 4PP1D 1EZVY 1EEYA 1OARH 5E24E 1CLZL 3GNML 4MXWH 2J88L 2DWDB 2Y06H 1U8LB 5EU6B 4HKXB 2AJ3A 2K7PA 2XTJC 5DFVD 1BVKA 1KIPA 1Q9KA 2NX5D 3IDMB 4K3GA 3STLA 5BO1H 2VXTH 4NKDA 1NEZA 1LO4H 1X4XA 5TE4H 3QFJD 4I3RH 3NZ8B 4UDTA 4TNWF 2DQEH 3QHTC 1XH3A 1X5JA 4TNVF 4R4BA 4Z7WB 4CRPA 5I66A 4RGNE 5GS0D 2UVEA 3RVXD 3V9FA 4NKIL 3LRSA 3UJTL 4NNYB 1OD7A 5ILTL 3IXAA 1F58L 1L7TL 4LCYB 1EEQA 3RHWK 2DM7A 2AKRB 4J3OC 3ARFA 1IGJA 4O58H 4YDVB 3T3MF 4I9WE 2BNRA 1IQWL 3PGFH 4X5WA 4OZIF 1BQHA 1SJVA 4PJ8D 1A3RL 2R1XB 4ODHH 3I6GB 4PJDA 1IAOA 3HA0A 4F8TA 3UYOD 1R5IB 2G60L 1R3LB 2PO6B 1JZ4A 3OGCB 1KJ3L 1G1CA 3PWUA 2ZZUT 1K9TA 5HDBF 3UPRB 2BFVL 3GUTA 3RWGB 2RFXB 2NX5A 1VKXA 3MLTB 3SQOL 5ITBL 4FQQB 1HHIA 4HPOL 5KSAB 3O6FB 3QO1A 1EA9C 5GJSH 1I75A 5FYLL 3LPFA 4OLUH 3UC0H 3LV3A 4WNQB 1MCKA 2J2ZA 1H3PL 1W72A 1VGKA 1A4KB 3JWNC 4Q2ZB 4RQQB 2XQBL 1DUYA 2K9UA 4MNQD 1EHLL 1LO3L 1UG9A 4WUKL 4IOFD 1XF5B 1YECH 4XPHH 4G42A 4W4OC 1AY1L 5SX4H 4UBDC 4R97B 1D5IH 4PJ8A 5CP3A 2BHZA 1SY6A 3DPBA 4ZS6C 5T1KB 4XP5L 4ZFFA 3H3PH 3ARDD 1QBBA 5HYQB 1IQDA 2NCMA 2V2XA 2W1NA 4EIZC 2AV7A 1I1RA 2XQYK 3UAJD 3CLFH 5F7FA 5C71A 4CBPA 1A1MA 4RMVA 4OF6A 1G9NC 2P5WB 3S5LB 2DWDA 1QFWM 4NFDA 4KGLA 1U8LA 5EU6A 1QSVA 4EOWH 2I26N 1NPUA 4OFIA 1S7QB 4JAMA 4XNMB 2CPCA 1UYWL 1R24A 3ECBA 3KLAB 1KJ2H 5C2UB 4KJYA 3BSZL 4P2QB 1T2JA 3W11D 1RZKC 1F4YL 2F5BL 1KJMB 4MNQA 2NXZC 3MRQA 4GAFB 2J8UF 1P4IH 4G6KH 3WNMA 4J7RA 2Y72A 3DRTB 5INDB 5IIEA 2DIAA 3MCG1 4NNYA 5DWUL 1MFEL 3HKFA 5C0DB 5FYKU 4NKMA 3X3FH 4LCYA 4Z78B 5EA0H 4PREB 2AKRA 3VRJA 4TSAH 3WHXA 3RVWD 5KTEH 1TJHL 4L4VE 4UINL 5I1CL 5FKAB 3ARDA 4U1GC 1DLFL 4Z7NE 3VXUD 4G6JL 3GSNH 3AS0A 3KWWB 3QG6A 1BOGB 1B4RA 1UKSA 1FZOB 1KB5A 2Q8BL 4FQXC 1R3LA 3WFEH 1J05A 3OAZK 2ZJSH 2XKNB 4JJ5A 4NZRH 3ZDXE 5MEND 1EJOL 2VZSA 3HUJA 5I1HL 2F53E 1T7XA 3MLTA 3R0NA 4FQQA 5KSAA 3N85H 3O6FA 2ZSVA 4EUPA 3D69B 5GRJH 3T0ED 2B0SL 1DVFD 1KUMA 4RGNB 4P2QD 3GK8H 3INUH 4JB9L 4KTDH 4XMLL 4Q2ZA 2ATPA 4RQQA 4XNYH 4ODSL 4UV7H 4B5EA 2CO6B 2DYPD 4N90E 3WNOA 3C08L 3L3OB 4TTDC 1F97A 1QUNA 5BVJB 1QEWA 1XF5A 1QKZL 1MCCA 3QIUC 1EFQA 3VFMA 2EH7H 4BSJA 4F80A 5F3HA 2Y07L 1AI1L 4NZDA 3WN5C 3DYPA 4M3KB 5F1OB 3VXUA 4LDEB 4NN6B 3ETBF 3QQ3A 4LMQI 5HYQA 4OIIL 5ITFB 1CFVL 1G7MB 3HN3A 4FFVC 1DN0B 5LAXB 5I18L 3EAKA 3CVIL 4HUMB 1BQSA 3S5LA 5MENA 3J7HA 2DQTH 3QO0B 4LBEB 1DQDH 1KIRB 1WBXB 4HHAB 2XA3A 3RBSA 2Y1VA 3HI6H 4ZQKB 1AXTL 3L3GB 1ZSDB 4ZO9A 4DW2L 3T0EA 3KLAA 4U1SB 1S5HB 5I8EB 3TBWB 3VGEA 4P2QA 3GIVA 5DMJB 3RL1A 1ZVSB 2OL3H 1KJMA 2P43B 4LAQH 4K94H 3LKOB 1RJLB 2W0KA 3DRTA 3RWJB 3KPQA 4CJ1A 2XYCA 4MAUL 2J4WL 2AJSL 5HPMB 3MA7B 4PJHE 5C0DA 1NMAH 1T89C 4Z78A 1XMWA 3AREB 1CK0L 1G9NL 4PGCB 1EUUA 3MRHB 5C6TL 1RIVH 5F7MC 1T0NB 1IAMA 2R0LL 3LZFH 1NH6A 4L9LA 1JYWA 1BOGA 4K7PY 1UB6A 2VXUH 4OKDA 1T21B 2CUIA 3QI9C 5BQ7B 1OTUD 1TNNA 5J11B 1NAKH 2AEQL 3NOIA 4J12A 1Q0YH 2OMNA 4JFDE 4P59L 5J56B 4JRXE 4WJ5A 4WEBL 2DQUH 4FNLH 1W72H 1DSFH 1LEGB 3C9NB 4FQJH 3D69A 5GS0H 8CGTA 3AU1B 1I8IB 3ARBB 1NBYB 1QBML 2GW5A 1CXFA 2A0LD 5F21B 2XNAA 3L3OA 4LIQL 4BH7B 4L4VB 3REVB 4GO6B 1G7IB 1SY6H 3LN9A 5FM5M 3LEYL 5IGXH 2ZOKB 3ZO0A 6FABL 3P4OB 3KPRE 1IE5A 1YEHH 3CLEH 2WBKA 4D9QE 5JW3H 5L7XH 1G7MA 3GSQA 3LOWA 5K9QG 3Q48A 4N0YL 1HIMH 4PR5B 4FQIH 1DN0A 4I48B 4PJIE 4JY4B 4H1LB 5EUOE 4KAQH 3VXPB 1A0QL 2F53B 2CDFA 2Y25A 3HUJF 5A40E 2LABA 3QDME 1JFQH 4LBEA 1KIRA 4HUUA 1I7TB 5IBUB 2F15A 3L3GA 4NKOB 1NBVH 1X6NA 3ZKSD 1S5HA 2FJHB 5HTSA 2F58H 1ZVSA 4Z7QE 4UV4L 3KPOB 1MCWW 3WO4C 4PTUA 2X70A 2BOBB 2W65B 1HYSC 3LKOA 1RJLA 5C8JA 4JO1L 3RWJA 3B9KB 4RFEB 5GGTH 5HPMA 3MA7A 3UBXB 1R3HA 1L6ZA 3QCVL 3AREA 1PKQE 3MRHA 1NFKA 1BFOB 1FGVL 2Z92A 2HN7B 4GW4B 2V2TB 2JJUA 5B39B 2FGZA 5BQ7A 1J8KA 5IFHH 3UX9B 3FN9A 3KPLA 4KUCD 1QZ1A 5IF0B 1RY7B 4EUPH 2ZG2A 5FO8A 4LDOB 3GM0A 4I2XA 3C9NA 4LCWD 4WIQA 1U8HA 3AU1A 1I8IA 1NBYA 1ADQA 4J3TA 4E5XB 2E7MA 1IKNC 4PJHB 5LGHL 1X5HA 5B22A 3F5WA 3BGAA 3JTTB 3VGBA 4D0DA 4ODUB 4BFBD 5LGKA 3DETC 5E08H 2Z0BA 1XZ0B 4BH7A 2VZ1A 4KPHL 3EOBB 1JPGB 4KRLB 4CDHA 5T1LD 2W0FB 2ZOKA 4TN9A 3VXQB 1KCVH 3QXDB 1C1EL 5D7SL 3G9VA 3ILQC 2MHAB 1YY8B 1AHWC 1CN4A 2X7LB 4LQFH 1A6TA 2FJGB 3NIFE 4WTWA 3THMH 3C6LD 2IMNA 4XMKL 4I48A 4JFDB 4QKXB 4JY4A 4H1LA 4JRXB 5CINL 3VXPA 2F53A 2HVJB 3FFCD 5JMOC 3TCXA 4RRPG 2XZQH 4G7VH 3OB0K 3AGVA 1J1OH 2FJHA 5SWSD 4Y4HC 4F7EB 4RFNC 1YEGH 4M9OA 3QDGE 4RA0C 4XTRC 2BOBA 1IILE 3K4ZA 4FFYH 4LVHC 3B9KA 3P11L 1Z9SA 3QISA 3ZKXB 4YBLC 5T1LA 1NQBA 1ZGLB 5EBLB 3LRHA 4RFOL 4RIRA 3KPRB 3WFDH 4BQ8A 2DJUA 4TSCL 1P7QB 1BFOA 4P5TC 1MFBL 4PJIB 5BS0D 3L7EB 3C6LA 2HN7A 4GW4A 5EUOB 4OZFH 3L3IB 4LL9A 3QDMB 4TSBL 1MNUL 5FYKH 3BQUB 2DWEA 4NQSA 1DN2A 5AD0B 3O2VH 3EFDL 3EOAB 3LKRB 2XZZA 2R2BB 4R90L 4G3YL 3S35L 2C26A 4F9PC 4K9EH 1PKOA 1VGEH 3EZ8A 4QNPE 1GXEA 1NMCC 3OJ2C 3T0VA 4ONGL 3MRNB 4D0CA 5SWSA 4DGVL 4ZYKA 1HDMB 1JTPA 4YJZL 5KS9E 3FQTB 4KQ3H 3GSRB 1NUDA 3VRIA 1CE6B 1RJCA 4P23C 5IVZB 3RQ3A 4E5XA 4PJHA 4ZPTA 4ODUA 3E2HB 1T1YB 1XZ0A 1RJYB 3VI3E 1PKQB 3EOBA 3MLZL 1IGFH 2WAHA 3MMEB 1P84K 5K9QI 2UY6A 2XG5A 3IYLW 4GBXB 1UZ6F 2QQQA 2EE9A 3VXQA 3OSKA 3QXDA 1OCWL 3NPSB 2YN3A 3MLUL 3S98A 4GSDH 1ZV5A 4DGIL 5BS0A 12E8H 5L8LB 1YY8A 1WZKA 3RWDB 1P2CB 4XCYA 1RVFL 2OP4H 4K7PL 2FJGA 5KSVB 2W9DH 1JGDB 1S7SA 2FIKA 3V6OA 4YEEA 1JZ7A 4JFDA 1AQKH 4FA8A 3CFCL 4PD4K 1YC8A 2HVJA 2WMPA 4Q9RH 5KZCD 1T83C 5I17A 5I1GL 1QA9A 3PHOA 5I75B 5I8OH 1A5FL 1IAIM 3W9EA 1XGRB 4F7EA 3VG9B 3GI8L 3SQBA 2NY1B 4I4WB 4YWGH 5DLMH 3GM8A 2GIYA 1KCRL 1ZGLA 5EBLA 2V2WA 4WFGD 1NCBL 1U8KA 3RGHA 4GBXD 3QCUL 1EMTL 3F7QA 3BDXA 4YXKL 1Q9OA 4KUCF 4PJIA 5EUOA 2UZYB 3VDAA 1AGBB 3L3IA 5BVPL 1K4CB 3QDMA 4X5XA 1ZT1A 5D1ZB 1TQBB 3OKLA 4MNGE 5AD0A 1K6QL 4JM2B 2R2BA 4U1MA 5L2JA 5HHOE 5E7BA 4LEOB 1HH9B 3SDDD 3C8KB 4QWWD 4J3UA 1U3HC 1L0XA 3FQTA 3QDGB 2DKMA 5GJTH 3PF2A 1A02N 1OW0A 5E5MA 1WQVT 4YBHA 3K2UL 5D2LE 1QRKA 3SN6N 3UP1A 3C09B 3P4MB 4LSSL 1RJYA 2NY4C 3P9WB 3MMEA 3OB8A 4QCIA 4GBXA 4WI5A 3RA7L 4OD3H 3BP5A 1VPOL 3S3JA 2I9TB 1P4BH 5IBLD 1P2CA 4ONHA 2C3HA 5GS3A 4X7TA 1JGDA 3TBVB 3WLWD 5IVNA 4Z7VE 4X98A 1YPZE 1HKLL 4ZSOE 4J4PC 1U6AL 4MAYD 5ELIA 3AVEA 4MQ7B 3TO4B 5KS9B 3SDDA 4L3AA 1NGYA 3Q5OA 4GRLB 4HG4J 4QHMA 3I50H 4N8CH 1XGRA 4ZUUB 2H2PC 3MBEB 3BWAA 2KKQA 2EDFA 4JKKA 5GRUH 4NSKA 2QSCH 1JK8A 2AGJH 5SWQA 1A6VL 5DTFB 2ADFH 2O61B 3DI3B 1JF1B 3QG7H 1B90A 3F8UB 4I3SH 1JV5B 1NAML 5TF0A 1R5WB 5F6IB 3CMOH 4YFEA 2A77L 1Z5LA 1EK3A 3BEVA 1QFOA 3WDJA 1N59B 1BMGA 1IC4L 5IUSA 4XMPH 4GAYB 2EXYD 1QPPA 1XR8A 1X44A 1AGBA 1WCQA 4HWEH 1DBMH 1KGCE 4MQXD 5T3ZL 5DMGC 2FGWL 4MAYA 3LSOA 3PNWA 3MRPA 4GFTB 1OAYH 1BBDH 2SEBA 3AXLB 1JF5A 4LEOA 4JO4H 4M62L 5BV7H 3C60B 3TWCL 2R29L 1KFAL 3QUXB 5F96L 3ZL4L 5FEBA 3DJ9A 4JFEE 1NUNB 1FFOB 1G7PB 1XGQA 2BVPB 3NIDE 3VXSE 5KVGH 2C1PB 4MCYA 5H37G 1I8KA 4JFXB 2CK0L 5TDPA 2XICA 3JV5A 5HVWA 1MCDA 5E6IC 4XP1H 4X6FB 3SHSA 4X6DE 5ID0B 1A7NH 4Y5XB 4TRPH 4DN3L 3L3JA 4PUBL 1FP5A 3AAZB 3VWKC 3C5ZD 1QD0A 4XPTL 3U7YL 2NW2B 2EE3A 2I9TA 2D7TH 5TDOB 3TVMB 4P4KC 2AABH 4MNGB 1KEML 2YMXL 1B0WA 3OQ3B 4HZLA 4YEFA 4LSQL 1LDSA 5DC9B 4MA3B 1PGRB 4KVCL 5HHOB 4P49A 3NCYP 5IP4A 1FO0B 5LXGH 4JE4B 2JELL 2Q20A 3QHZL 4YDIH 4DUVA 3GDBA 1T0PB 5KS9A 3HZMB 1I3VA 2DQCH 3F7VA 5EWIH 4TPRL 5A2KH 2OBGA 3VXMD 1OSZB 4CVXB 4NO0B 3BMVA 4F33B 4ZUUA 5D2LB 3SEPA 4ZPVB 3CVHB 3MBEA 2QR0B 4I3GA 4IDJL 4G8IA 2ZUWA 4X8XA 4OT1L 5D96B 3WXWL 3N9GH 5DS8B 5DTFA 2O61A 3DV4A 1JF1A 4L8SB 2J8OA 4X7EC 1Z6JT 1A6WH 1FCGA 5E2UH 1VERA 2NTFA 3REWA 1PEWA 3N06B 5K59E 1G9MH 1Z3GH 2YSSB 4JDZB 4Y19E 4EQ3A 3QXTA 3NN8B 2CKBB 5C0NC 4Z7VB 4GAYA 1YPZB 3TH4T 2W0LA 2HFFB 2ZCLL 4S1SL 4XBGA 1BQUA 4ZSOB 3U83A 3B9VA 4DGYL 4S1DD 1MPAH 5D5MF 5GGQH 3SOBH 5SV3A 3QZWG 3S6CA 4HAFA 5I16A 5JXAH 2BJML 1C5DB 2IBZX 4JN1H 4LASL 5SX5H 3BD3A 3C60A 3OJDB 1PSKL 3QUXA 1YN6A 3FONB 4PJGE 1CLYH 3O45B 1J5OH 1FFOA 1GHFH 5EO0A 5EB9A 4S2SB 2AJUH 3ULUE 1GAFL 2P8PB 3ARRA 5IROA 3EJZC 2ED7A 4JO2L 1FV1B 4JVUA 4F2MA 3KJ4C 5MHSE 4YQXL 3LPWA 3K46A 5E99H 2B4CC 5JOPE 5ID0A 4J3XA 5BMFH 3QXAB 2NY5C 1NEZG 3IDUA 1TZHB 4NP4L 1T66C 5E8DL 2X2YA 2QL1A 4FQ2L 5H35A 3HE7B 4QOKE 1NUFA 3S7GA 3TVMA 2EIDA 1PZ5B 2D9CA 4MNGA 3D87B 1UGNA 1IGIH 3BH8B 2GEEA 4OBRA 4UUJB 5HHMD 4MA3A 4IRSB 4ORZC 3ZKMC 1AFVH 3TJEH 1A4JB 1FO0A 4JPWH 4R2GB 5CD5D 2CIIB 1ZHLA 3HZMA 4JFEB 1BQHG 2HRPH 1OAZH 5T5NF 1KPVB 2VXVL 2H2SD 2Q86A 1OSZA 1A6PA 4OM0L 4UMGA 3VXSB 4F33A 4ZPVA 2QR0A 2HJKA 5B21A 3TA3C 4HH9B 3PP3H 1CFSB 1NCAL 3GSXB 1NGQL 3JXAA 4WW1B 4X6DB 1M05B 4EN3D 3V0VB 4NFCA 1U8OB 4KK6D 1E4KA 5L2KD 4NJ9L 3L3DA 3ESVF 4GQPH 3FQNB 4OFYD 2XY2A 5T3XH 2IJ0C 2YSSA 3VFPA 1Z0NA 3MV9D 5J13C 2CKBA 5J3HC 3V4UH 1H3VA 1YPZA 2PXYB 1CLOL 3QWOB 2HFFA 3EYQD 1BIHA 2BHUA 4XC1H 5TDNB 3PJSB 1YA5A 1NEUA 5AUMB 3RVUD 4E0RA 1I8MA 1C5DA 3IGAB 1GGBH 1T4KB 5E0QA 3WUZA 1FAIL 3UPAA 3S9DB 3OJDA 5A43C 1INDL 4K3DH 1SYSA 5ENWB 2ZKHH 5FECB 3FB5B 4R26L 1INQB 3DX9B 4S2SA 2MMXA 5EG6C 3FTGA 1AJ7L 1BLNA 2ZG1A 5ID1B 2DDQH 3V52L 1RZFL 1T1ZB 4EN3A 1O0VA 4P9HH 4FN0A 4X7SH 1FIGH 5JA9A 1FV1A 5IV2B 4PB9H 1Q38A 3SGEH 2IPTL 2OI9B 4Y19B 1EXUA 3V5HB 3QXAA 1Q72H 4OFYA 4J3VA 3MV9A 4M5ZL 1TZHA 4YHMH 4HFUL 4K8RD 2V9TA 2NYYC 2WBWB 1C12B 1BPVA 3HE7A 1QSEE 2UZIL 1PZ5A 1EHAA 4BZ1H 2ENYA 3BH8A 4UUJA 1RULL 5DEZA 3BYYA 1GL4B 1EO8H 3L9RB 3MCLH 1G7LA 3BKYH 1UA6L 1RZ8A 2EIZB 3FJTA 3BDYL 4PJGB 2CIIA 5EO9A 1FLRH 4ZUVB 4JFEA 2VLRD 1F6AB 5JDJA 1RJZB 3S3SA 3L5IA 3VXSA 2AQ1A 1FC1A 2B4CL 1WBYB 2C3GA 1CVRA 2ADGB 2EXWC 4HH9A 3G6DL 2OM5A 4Y5VC 4M3JA 1CFSA 1FBIL 4JZJA 1SJXA 2R0WH 5IMLA 5GGUB 3DMMD 1YY9D 1ZLUK 2WWMD 4X8JA 1DBBL 1NMBH 4X6DA 3CDCA 5JPMB 1CF8L 1MHPH 3V0VA 4AMKL 3LIZL 1U8OA 2CK2A 4JFFE 4ZOCA 4N9OB 3WIHL 4OZGE 2GTZB 2QQNH 1OP3H 4EUPG 4QOKB 5DJZB 1IM9B 4YK4B 2ID5A 1E4WH 1XGUB 4HS8L 2UWEE 3MROB 3PL6B 1RUMH 3FOMB 4P2CG 4EKXA 1SEQH 5AUMA 3O2DH 3IGAA 1WAAE 1ND0B 2VLRA 1KCSL 1S7UB 1TDQA 2E7CA 2ZOLA 4IIQC 3U9UA 2R56L 4DOHE 4DUWA 2I25N 2ZCHL 4QGYA 2HMIC 2BP3A 5IW3A 3RY5A 5FECA 4RMQA 3FB5A 3P9MB 4NQXA 3QEQD 2X09A 1G7QB 5C0RL 1QVOB 2EECA 3DMMA 3EYSH 5ID1A 1UKTA 1KJVA 4QRQA 1T1ZA 1J1XH 4YPJA 3S5LG 3X17A 1T22B 5FHBH 5IV2A 5KOMC 1A7RL 2V17L 4GUPB 4U7KA 4EI5D 2EO9A 1N3NA 3MV8E 5DUBB 4Y19A 4PJCE 2BDNH 2MSPA 3S35X 3MFFB 2EDLA 4HC1H 1XIWC 1XEDA 3ZTJG 2VQ1B 1C12A 4OCLC 4AQOA 1SQ2N 4LSVL 1FNEB 3HI1A 3U79A 2WNGA 4CADB 3FZUD 5ESAB 4KJWC 3F6LA 1TIUA 1MFAL 3TZVD 2H1PH 2W38A 4PJGA 5HHNA 4ODHL 1ETZB 2I27N 2VZVA 4M1DL 4WI4A 1F6AA 1HZHH 1TJIH 3VU2A 3BHBB 3V5DB 4A6YH 3MNWB 4YAQA 5IB3A 2WBJB 2ADGA 5IBTH 3VD9A 3G5XB 3NCBB 1IC5H 4V1DE 4K7PX 1HILA 5GGUA 3WCYA 4LSTH 5DHXB 1FH5L 5JPMA 1X5YA 4EI5A 4N9GA 4ZAKC 3BPOC 2H8PB 3SKNB 1AD9A 2Y36L 1JJUA 5IHZB 1QPXA 5IT2H 2RCSL 4ETQA 3RZCC 3DX6B 4D8PB 1OLLA 4QOKA 1QSEB 4FRWA 5LKNA 3LN4B 3GMPB 4F58H 2V9RA 1RHFA 3C6SA 2H45A 1EEZB 3PL6A 4WTZA 4JFZL 3T08A 2Z91B 3KLHD 1Q1JL 3TZVA 2XWJB 4LKCB 3TF7C 2YUWA 4IDLA 3UMTA 1ND0A 4Q6IC 1UJTA 2NY7H 3O81A 5EPMB 4WW2F 1IKFL 4K94C 4QTIL 4O2CB 4EJ1C 3ARFC 4OLYL 3CLFL 4B7LA 3RWFB 3HC0B 4LPTA 3V0WH 5CEZD 1G7QA 3QP3A 4PP1C 4JFFB 1XFPA 1MLBB 2VKWA 4OZGB 3AM8C 2Q6WB 4HX1A 1F90L 2R69H 1MRCL 4C54A 3FQRA 5DFVC 3MFFA 2QHRH 3BE1L 3QEUA 4QHLA 2UWEB 3QQ9D 1T7WA 2VQ1A 2XN9E 4L3ED 4UQ3B 1U3JA 1FNEA 2XQYG 2AXGB 3FQXB 2HKFL 3S4SB 5E7FA 1NFIA 2YKLL 5E8OB 1HWHB 5ESAA 1NGXB 3OKMB 1TZGH 3T3PE 4DOHB 2A1WH 4X6BB 2DQHL 4GG8B 3RVXC 4UT7L 5GS0C 4WWKD 4OLZH 1FFRA 4CGTA 3HMWL 1ETZA 1X9QA 4X4YA 3GSNL 4AIZB 3BHBA 1YMME 2R1YB 2JJVA 4PJ8C 5E95B 1KG0A 1RIUL 4LGSB 5D2NE 2EKSB 4NJAH 3FKUS 5LQBH 1J1PL 2I60L 1BX2A 4YZFE 2HT3D 4UILL 5MEOB 3MV8B 1UJ3A 4PJAA 4PJCB 3PWLB 2YWZA 4MWFB 2H8PA 2P45B 5IHZA 3DX6A 5A2JH 4D8PA 1WWBX 4XC3L 4LVEA 4OSUL 4KKBD 1HNGA 4L3EA 4GS7B 4S0TD 5E94A 4ONFH 4RMWA 4ZFGL 1NJ9B 3GB7B 4HS6B 4XPAL 3SDAD 2A73A 4WVRA 2A9MH 4WWKA 5DRZB 4B53A 4KMQA 4G9FD 3GHBL 5TQ2H 2Q3ZA 3BP6B 3MLXL 4IOFC 4XXCA 3RI5F 1GGCL 5EPMA 1TZIB 4ERSH 4BFEA 2YPLE 4D9LH 4ZNCD 4O2CA 3GMLB 5F7WC 1ZLWH 4V1DB 2VDQL 3HC0A 3ARDC 5ABDE 4XP4L 3VG0H 4AEIH 2ADJB 4L3CB 4YNYB 4MZ2A 4MJ5B 1IAKB 2V7HA 4KTEH 4X7FC 4JFFA 1MRFH 1OAKH 3N1MC 3VRLF 2IQAB 1N5YL 2A6DA 4JCLA 1O5DT 1AIFA 1YUHB 3RWEB 4M6OL 4GG6F 3T2OA 4FABL 3O8XB 4PBVC 3GMOB 4BUHA 4H20L 4W81A 3ULVE 4X99A 4NQDE 4DN4H 5BW7C 1LDPL 4UQ3A 3Q0HA 3W11C 3S4SA 3SDAA 4N1CA 1AGEB 1WAAA 3AMKA 2EH8H 4F8QA 5EC2B 4HT1H 1RUPL 3M45A 5I71C 1CGUA 1MCNA 5DRNB 5ACZB 2ZUYA 1CTNA 2WIIB 1A3QA 1S7RB 5C2BH 2ICWB 3RVWC 4YHLL 1GRWA 3QT2A 3W0WD 5EU3B 1U3ZA 3JV4A 4Z5RB 2NXYD 1A64A 2X1XR 3QIBD 1WJ3A 4ZMAT 2ERJB 5D6DC 5C09D 5JPNB 2VITB 3ZYOA 1EDQA 3QUYD 1J0KA 3SBWA 3QUKB 4PJCA 1D5ZB 3U7AA 3RY6A 4MWFA 3JUZA 2QKIB 1BIIB 2GTWB 4AT6B 4APQD 2VXSL 1UM6H 1KXVC 3GMRA 2XN9B 3BPNB 4GAGH 2N7BA 4NGHL 4J3WA 3KR3H 3T0EC 2GJ6E 3QDJE 1MCWM 1P53A 3IDXH 4X0KA 1DVFC 4M1GL 1NJ9A 3IRZA 3ZE1E 1SY6L 3QHFL 1JZ8A 4HS6A 4IJ3B 2C9AA 1U58A 1A9BA 3O41A 3ES6B 3B43A 4PGZA 3BP6A 3QUZD 4JQIH 1YMMB 5EOQL 5CCKL 4JANB 3LB6D 1YEHL 1WLHA 4FZ8H 1TZIA 2NMSA 2OTWB 3PG2A 3GMLA 4ODTH 4XPBL 5D2NB 5DHYB 2HTKD 3HTLX 4FQIL 4V1DA 5C09A 2BVEA 3FO9A 3QPQD 3SGJA 3QUYA 3LH2H 2ADJA 4L3CA 1U0QA 4NHCL 4L9LC 4YNYA 3WSQL 1NKOA 2BSRA 3M8OH 4PLJD 3RUGE 5IJVB 4OGXH 4FQLH 1TQCC 4XVTH 1ACZA 2P8LB 5D7LD 4Y16D 5D7KD 4YGVB 5KANG 1YUHA 2CGRH 3RWEA 4BZ2H 1H9VA 3VGGA 2R39A 3ZSSA 2NY6D 2JB6B 3GMOA 4PV8B 1QLRB 3U36B 3EYVA 2EDXA 3ALXA 1X3DA 4ZODA 4YDLB 4PJBE 5HYFA 3VE0B 5ALCL 4QXGL 1CFTB 1AGEA 3DSFH 1H3UA 4M7ZC 4AG4L 4UNVA 3QUZA 3VD4A 1LO0H 2DQJL 2YPLB 5DRNA 4NUGH 1KB5L 4DTGH 1P9MC 2WIIA 3P0VH 4FP8H 3PV6A 3U46B 4XNUL 5EU3A 1QR1B 1DTUA 1MCHA 4KJQD 5E1AB 5TFSL 2VLJD 3MZTA 4Z18A 3VW3H 3SDYL 1OTUC 3EDJA 4MJ6B 5FUZL 5D7LA 5E8EA 3L7FB 4Y16A 5JIKA 4WO4D 2K1MA 1BIIA 2GTWA 4AT6A 3IB4A 4NQDB 5E2VH 1BJ1H 1LK3L 2J6EH 2XN9A 2PUQT 3RJQB 4OF3A 1T7ZA 4HKBA 2X5PA 4RZCB 2LVCA 5E08L 5CUSL 3LS4H 4MCZA 2A74B 4TVPD 3GSOB 2A0LC 3U1SH 2FLBT 3WJJA 1PDKA 4U6YA 4YH6A 4XGZA 1I1AC 1OPGH 1YMMA 4JANA 1F5WA 2XA8H 4MXQD 5EBMA 2OTWA 3OX8A 1CDIA 4Q9QH 5FFLA 3UYPA 5C0EB 3I9GH 4JHWH 2MWCA 2XWTB 5DHVA 4WEUD 4YFLF 3DI2B 4U33A 4WO4A 3NA4A 4BSVA 4LIQE 4KHXH 5EFIA 1LHZA 2P8LA 1QRNE 2B1HL 2MPAL 2R2HA 2XIDA 2XTJB 4YGVA 1N0XH 3BO8A 5DMKB 3SKMB 4QO1A 2GJ6B 3QDJB 5CSGA 1QLRA 5IB5B 3U36A 4M48L 2VDMH 3RHWF 1AR1D 2IPKB 3VI4E 4OM1H 3X12B 3CJJA 3SE9H 2FSEA 3G9AB 2Z31D 4DQOL 1R3JA 1LQSR 3H6JA 3VE0A 1CFTA 1J0ZA 2NY3D 3FO1B 4F3FA 3B5HA 4KTYA 3P4NB 1T5XB 1QLFB 3GSUA 2N7AA 4R0LA 4R8WL 2WV3A 2V5TA 3VFTB 3U46A 3QQNA 1QR1A 1UWEH 2AJXL 3VGHA 5ICXB 5LCVH 4S1RL 5IEKB 3RUGB 5L6YL 4PJ7F 1SVCP 5C07E 1VGEL 4MJ6A 1CFNA 3TYFB 4QXUL 3KXFD 3L7FA 2D3VA 3EGSB 1KNOB 4O2FA 2H32B 5J4MA 4M6NH 4LRNH 1B0RA 4O9HH 4NQDA 5IFAL 2XTJD 1LP9E 3O6LL 4PJBB 5T5NG 4YHPB 1F3DH 4G80B 2RR3A 5I30L 3DXAE 4H88L 4U3XA 5IHLB 2Z31A 4L29A 1PG7X 2W07A 1SMOA 5GSVB 1JVKA 2A74A 4Z0XA 4KFZC 3GSOA 5CS7A 5JW4R 1ITBB 1MAKA 2ENSA 2V7NB 5JHDD 4PTTB 3MV7D 2AV1B 1JHTA 1Q8MA 2GY5A 4NC1E 4HFWB 4JKPH 1Z9MA 1YN7B 4PRDA 1T5WB 2EC9U 3B9DA 5CIPH 5ISZD 3LQAL 5ANME 2PYFB 5FCUH 1JF6A 3C6LC 4KVNL 3KXFA 4I18C 3RP1A 4H26B 5FDWB 5ADOH 2BSTB 3GRWH 5D1QD 1G0XA 5DMKA 3MNVA 5C3TA 1NLDL 5T5FH 3SKMA 3MLWH 1CDYA 4WHYH 2WUBH 3WXVL 4YWGL 2AVGA 2IPKA 1IGTA 4LMQE 4J8RA 3I6LD 4WUUD 5BV7C 2MCPH 5F7EL 2NXZB 4H0IA 5ALBL 2ZUQC 3H8NA 3FO1A 3RIFF 3KLDA 2VTFA 5F89A 3FN0H 1QLFA 2DLTA 3AY4A 1VFOA 2F8VA 4KY1H 2P49B 4G6MH 3ZDZF 1NSNH 4JY5H 2HFEB 3R0MA 3RNQA 1GGYA 4U1GB 5TGBA 4Z7NF 1D5XB 4KUZL 2Z93B 4ZS6D 5ICXA 5IEKA 1I3GL