1KBBA

Mechanistic analyses of catalysis in human pancreatic alpha-amylase: detailed kinetic and structural studies of mutants of three conserved carboxylic acids
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQAVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE, PANCREATIC
publication title Mechanistic analyses of catalysis in human pancreatic alpha-amylase: detailed kinetic and structural studies of mutants of three conserved carboxylic acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kbbA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kbbA01
1QNPA 4Q22A 3VUPA 1R86A 3LRMA 1U30A 2X2YA 4WSKA 5DT5A 4GQQA 4HMCA 4AEFA 5IXEA 8CGTA 4WKFA 5IFPA 1QVBA 5CXPA 1VBUA 1G01A 2XM2A 1E43A 1Q6DA 1Q4NX 1SMAA 1US3A 4M24A 1EOKA 4JCMA 1GOIA 2D1ZA 5E6ZA 4AIUA 2XSBA 5LA2A 2WKLA 3DDGA 1JZ6A 2YL6A 4NF7A 3THDA 4FNTA 4NZCA 3GH5A 2W67A 3EJPA 5CGTA 3VOCA 1ECEA 2DSWA 5D9PA 4B16A 1E3ZA 3CLWA 2VR4A 2G3IA 4PCTA 5A6LA 5CPTA 4JAWA 3J7HA 4HMEA 1GOMA 4HU8A 3AXIA 1B3XA 3EMZA 3MUZ1 3OZOA 4ZEPA 1HKMA 4FMVA 2ZXDA 3UG3A 3KL0A 2D0HA 1Q6CA 1E3XA 3ARYA 1UH3A 3AS1A 3SCVA 2MANA 4W86A 3K4AA 3VGEA 3OA5A 1CECA 2DH2A 3WDHA 3POCA 1E4IA 1B30A 1OB0A 1QNSA 1UASA 1LWHA 3NIYA 4OIFA 3GYCA 1TMQA 4Z2IA 1F4HA 3GH4A 4BA0A 4UQCA 3WNMA 1JYXA 3M46A 4P8UA 4D1IA 1B3WA 2UWFA 2XVKA 3T0BA 3VIOA 1IV8A 1BYAA 1ISZA 1KXTA 4URIA 3CV5A 2DSZA 3UR7A 5CSUA 3BUQA 3AMLA 1LL4A 1ODZA 2WVVB 3B9DA 2VZOA 1GNXA 2DH3A 2HVMA 2RGMA 4Z2GA 5BXSA 1HJWA 1SFSA 2EXOA 3OG2A 4PUDA 1BYCA 1BVZA 3BVVA 1UWSA 3ZT5A 3OGSA 2E9MA 3HN3A 2ZICA 2QV4A 1W1YA 3K46A 3QR3A 2VX4A 2BHYA 2W91A 2VRKA 1K9EA 4CD8A 5A8PA 4L4OA 1C7SA 1TFVA 3AFBA 5A95A 1C8QA 4DUVA 4GIAA 4J3VA 4CGTA 4UQEA 5TD4A 1E0XA 3MI6A 1C8XA 3WH5A 4LYRA 1TQUA 5A6KA 4U3CA 5E09A 2PI6A 2XWDA 2CETA 2AMGA 4UFKA 3AIWA 4GXPA 1VEPA 2PF0A 4H7VA 2V38A 2BHZA 3VGGA 3W29A 3EDEA 5EFFA 1TZ7A 2EPMX 1JF6A 2YL9A 2WVSA 4E4PA 1KBKA 3VD3A 1WKYA 3BSGA 1J0HA 1T0OA 2E9BA 3VIHA 4FF5A 1JNEA 1JDCA 6A3HA 1J01A 3GXIA 1WE5A 1XGZA 4D6FA 1R33A 2EACA 3VIIA 1HKJA 2DSUA 5BWFA 2AOSA 4MJ4A 2WW5A 5A1AA 2ZXAA 3CMGA 3WBEA 2WMHA 1E0VA 3N9KA 4OBSA 4NXKA 1KXVA 1LQ0A 2DT2A 1GVIA 3N18A 1XH0A 1MW3A 4B15A 2XIBA 1G5AA 1FH8A 1W3LA 3BVUA 4PYSA 3ARQA 3FY1A 3VIGA 1UA3A 4WSJA 3AIRA 3LPOA 5E6YA 2E40A 1VEMA 1V0MA 3WD2A 5A2CA 1NP0A 4UCFA 3OIHA 1EXPA 2XGIA 2OW6A 3OZPA 3EJQA 1GQKA 4UOZA 4AD1A 4W5ZA 3OLDA 2UY5A 4M82A 2WYSA 3BLBA 3MV11 3PZOA 4RE2A 4DWSD 1JI2A 2X2JA 4GO8A 4EK7A 2XPKA 3RM4A 1FH9A 4YHGA 1VB9A 5D8WA 3VIPA 2E0PA 4J27A 1K9DA 4H8HA 2VRJA 3BAKA 4U2ZA 5DT7A 4FNSA 3SCNA 1J11A 4CD7A 1ZJBA 2IGTA 3W37A 2PWEA 5DEZA 4CD4A 3UERA 1PIFA 1E1FA 1CGVA 2OSXA 1WB0A 3AZTA 2WKGA 1UD4A 2J47A 3EJSA 3RO8A 4JFSA 1B0IA 1JDAA 1NOFA 1J10A 4BQ5A 2ZUWA 4PMQA 4FNRA 5ECUA 2W63A 3MUY1 3RIKA 4DWSB 3OB8A 4TX6A 8A3HA 3LXCA 3MMUA 2F2HA 1HJSA 3WENA 1GQJA 4B9ZA 1XH1A 2WMGA 3BAWA 2G3MA 2WHJA 7CGTA 1M01A 3FN9A 3M7SA 2BVDA 1XD1A 3TTYA 5BRQA 5IHRA 1OSEA 3TTSA 1JYWA 4LX4A 1UHVA 2JIWA 3MSGA 3UETA 3SCTA 4NZJA 1LF1A 2WBGA 3WD4A 2FYVA 3DX0A 1LWJA 1PX8A 2ZXQA 2J77A 3N1AA 1M03A 3O9NA 2WXDM 3CH9A 1CIUA 5CQ1A 3ZJ7A 4J3UA 4UZUA 3LPFA 1CZ1A 2VX5A 2F7PA 3T0DA 2Y5EA 4PSRA 4MNLA 4JFVA 1EQCA 2WMJA 3AISA 1NWTA 3WF0A 5CGMA 2F61A 3OLGA 3U7BA 5C70A 1LL7A 3WL1A 3FW6A 1OD0A 2WMFA 3ARXA 3NSXA 1RP8A 5E0CA 3EMCA 3B9EA 2CNCA 4H8UA 4GZEA 3DECA 2D3LA 4WKAA 4OOZA 2TAAA 2QLYA 3WEMA 1W9VA 3ALGA 2J7DA 3GXPA 3MUIA 2WHMA 5D8ZA 5DFAA 1PX4A 1TA3A 3SCRA 5A94A 5IDIA 1S46A 2Y24A 1BPLB 1H1NA 2XVLA 3WQ4A 3A4XA 4ACZA 1ZBVA 5EFDA 1HN1A 1NH6A 5GPRA 3OGRA 2BNJA 3VDAA 2DT0A 2C8NA 1HTYA 3WDRA 1V3KA 1BHGA 3NJ3A 4Q7NA 3WF1A 2WBKA 2YDSA 1EO5A 1PEZA 3JUGA 2ZE0A 3AXHA 2OWXA 3VIKA 2VC9A 3PTMA 3PZGA 1GHSA 2WB5A 4J7RA 1CXIA 3ARSA 3VIMA 2WMIA 1TQTA 1V6UA 1J0KA 3WDIA 1BQCA 3LX9A 2QPSA 5CSYA 3U7VA 1LL6A 2Z1SA 3APGA 2J78A 4NZFA 1JZ3A 3VNZA 4M80A 4BQ2A 4W8LA 1G0CA 2CESA 1A47A 4PEEA 3VX1A 2OWCA 1QPKA 2IUZA 3BAXA 3H53A 3BMWA 5A6BA 1JXJA 1IZKA 2YL8A 3L4YA 1E72M 4DWSA 4EKJA 2W61A 3WELA 4TVDA 2UY2A 3AHZA 4MB1A 3MMDA 3GXNA 5JUVA 3UCQA 2DT1A 5CPQA 1MQRA 5A6MA 4AMWA 3WF3A 4H2CA 4M8UA 4C7FA 5BXRA 3WQ8A 5FIPA 3OLIA 3WY1A 3CHCA 3BVXA 1Q6EA 3ZIZA 3LXAA 2ZUVA 1UQYA 1OBAA 1NM9A 4GI9A 2FDMA 1W9XA 2CKRA 2A3BA 1DWAM 1L8NA 4QLLA 2WHLA 4ZXOA 3WIJA 4P8VA 3AYSA 3S5YA 3K8KA 5EBAA 3WH8A 3FNDA 1G9HA 4HZ8A 2Y8VA 1CGXA 3CHEA 4AEEA 2CITA 2GDUA 3AQUA 2FGLA 4NSBA 3WEZA 1ISYA 1OD8A 4KRTA 1EDTA 1NQ6A 2IXUA 4DO6A 2BS9A 1W9UA 1V3JA 3WUEA 1C93A 3L4VA 2FH6A 5GNXA 1O6IA 3DHUA 3WNPA 1BTCA 1HF6A 2X1IA 4C7DA 2ZX9A 4XZBA 4Z2LA 1QW8A 2NT0A 2XVNA 2C7FA 3BLPX 2QPUA 3PTKA 3DX3A 3ZR5A 3ZMRA 3BUPA 4HOWA 3W26A 1H0IA 2XN1A 3RPMA 1N82A 4OOUA 1HJXA 3D3AA 1J0JA 1FFRA 3PZTA 5DMYA 3AI0A 1PX3A 3SCWA 1X6LA 1V3MA 7TAAA 4TVUA 1ITCA 6CGTA 4HU0A 4NI3A 1EGZA 2EJ1A 4R27A 1VJZA 4W87A 2E8YA 4FNQA 2B31A 1V0NA 1KXHA 2WLZA 3BXWA 4JFUA 5EB8A 4NXSA 3WDQA 4NX0A 1CLVA 1CXKA 1WDPA 3A3HA 3WF4A 5E70A 4AISA 4S3KA 3MANA 1UKTA 2EADA 2VCBA 1K6AA 1DEDA 3WD3A 5A6JA 2VVSA 2WM0A 1Z32X 3OLEA 2WHKA 4M1RA 4ACYA 1VRXA 2WC3A 1ZS2A 4ATDA 5A8QA 2WVTA 4J3SA 3AHYA 4W7UA 1DWJM 1GUVA 3N17A 2VOTA 4UFIA 1E0WA 1UZ4A 4PMYA 2YL5A 2O9PA 4UFHA 4JZ5A 4P7LA 2BXZA 3F5LA 1KCLA 1E6NA 1PS3A 3GXDA 2X8RA 1E4LA 4J3WA 4AC1X 4D6IA 2ZX8A 4QLKA 3WEOA 3KEHA 2GVYA 3M6DA 3NSNA 4MNMA 2VURA 4FNPA 3SCQA 4QFUA 4W85A 4F66A 3W24A 3PN8A 3CZJA 2EBNA 1H41A 4W8BA 1GOOA 2F7RA 2YDQA 1KGUA 1GOQA 3GZAA 3ZJ6A 4U5KA 1QI2A 3IAQA 4J28A 2OYLA 4U5IA 1EDGA 4MDOA 3ARUA 2WZEA 1E5JA 1X1NA 4K68A 4P8WA 1TUXA 1W3JA 2CYGA 3WFZA 1JIBA 4FNUA 3VD9A 4ATWA 3AMDA 5LYRA 3VO0A 4IUGA 1KQZA 2VL4A 1W3KA 1CXFA 3TP4A 4D6GA 1GQLA 4S3JA 2XTKA 1BG9A 4WJXA 4AW7A 2W92A 1OGSA 2EABA 3KLKA 2DSKA 3AMGA 1KR0A 1LJYA 4QCFA 5BYWA 1BYDA 1NARA 2VQUA 2X0YA 1BAGA 3L4XA 3L2MA 3EDJA 2BXYA 3DHPA 4W93A 1J12A 2XM1A 3F5JA 3FXYA 4F9DA 4FLSA 1JZ2A 3WNNA 2VQTA 1YHTA 4PTWA 1JDDA 4AIOA 2WC7A 2BHUA 4V27A 1EHNA 2JFEX 1R85A 5ABGA 2WWDA 2E8ZA 1SYTA 3LMYA 5AYBA 3ZSSA 1V03A 1DTUA 1CGTA 4A3HA 5AY7A 1NP2A 3A22A 2YA2A 3L2LA 3GM8A 4HZ6A 3AS2A 2F7OA 2ZX7A 1GQIA 1HXKA 1MW1A 3PZIA 3PHAA 4A4AA 4ZE5A 3FHQA 5M03A 3BGAA 4QLJA 2E9LA 3WSUA 4PMVA 1JF5A 1RH9A 3WNLA 3HU7A 1QWUA 3W81A 4DM1A 1W1VA 2XFFA 5A8MA 1HNYA 3NDYA 1HJQA 4JFTA 1R34A 1KGWA 1WZMA 2WVUA 1CBGA 2CBVA 4DM2A 4GINA 1B2YA 1W9BM 1V08A 1JAKA 5AC4A 1U2YA 4CU6A 1CTNA 3SUSA 4U2YA 3VD4A 2WCGA 2G41A 3WDPP 1TQSA 2XHYA 5FOOA 1MXGA 1E6SM 2GFTA 3W0KA 1BF2A 1XCXA 3AMCA 4IPNB 3WUFA 3HG4A 1B90A 3WMCA 1CDGA 3CZNA 3BCDA 3QHNA 4RL3A 3WQ5A 4QAWA 3FHAA 1Y7VA 5A8OA 3SUTA 2YKKA 3VGHA 3MSDA 1MVYA 3NDZA 2YJQA 1ZBWA 2PC8A 1PZ3A 1TA3B 4J3TA 2BVTA 2J8GA 3IANA 3L4ZA 3AS0A 4W89A 2DEPA 4AZIA 4X9YA 4N0RA 4ACZB 3PBGA 3VGBA 4PMUA 1JYNA 5I78A 4FK9A 3VX0A 3H54A 1D2KA 1VFUA 4W84A 1XSIA 4ZENA 4TOQA 2WAGA 1OM0A 5AC5A 4MPKA 5E9AA 1UWUA 2V5CA 5CG0A 4UOJA 1AMYA 1KB3A 4ZXLA 3BCFA 2XGBA 2IXVA 1QBAA 1ISWA 1J18A 3WH7A 5E0FA 3W28A 2WMIB 2YDRA 4BZYA 1GCYA 4MAZA 2VZUA 4CN1A 4PUEA 2VNCA 3CZSA 1HJVA 3WD1A 3BC9A 1DWIM 2JEPA 1ISXA 3LRLA 3L4TA 5BROA 3BVWA 3ZQ9A 3BUDA 5LA0A 2EPOA 4ZE4A 4UQBA 3VKKA 5FD0A 2X0HA 2ZUMA 3VIFA 1PZ2A 5KZ6A 4PTMA 2YA0A 4E8DA 3VMOA 3WD0A 1CNVA 1EO7A 1MQQA 1E9LA 1SZNA 2FGZA 3K8MA 3W25A 2ZUSA 1MWOA 4B3LA 3BAJA 3QGVA 1XC6A 3MO4A 3EYPA 4WK9A 2D24A 1HVXA 3CUFA 2OYMA 2X09A 1UA7A 4XV0A 1EDQA 1BLIA 3BMVA 4CUCA 1V3IA 1ESWA 1OIFA 1QBBA 3BSHA 3AIVA 2V3FA 3DYPA 1NWRA 3TTOA 2WMKA 4CKQA 4XZWA 4JL2A 1JI1A 3OBAA 1WP6A 2XVGA 1EH9A 4EANA 1QHOA 2OSYA 4OBRA 4GPNA 4OUEA 3RMEA 5ABFA 3AICA 1CGYA 1WPCA 4OGZA 2EQDA 4JHZA 1E6XM 4LGXA 2PBGA 4KRUA 4TTUA 4H41A 4TXEA 2BY1A 4GQRA 1V6WA 4AYGA 1CGWA 1C3FA 4AWEA 1UR2A 4KWUA 4HPHA 2J7FA 1E1EA 2ZUNA 1EHAA 3SCPA 5HNNA 4N42A 1E4NA 1UKPA 2G3JA 2ZWZA 3VD5A 1AQHA 2D22A 3SUVA 1V6YA 1HKKA 3MMWA 4WF7A 5JIPA 2GJXB 2Y2WA 2YBTA 3S5ZA 4QP0A 3T2OA 1KXQA 3DDFA 3CZEA 1V3HA 3UEQA 1QHPA 3AOFA 5JBEA 9CGTA 1W1PA 4GO9A 3WNOA 1CPUA 3WH6A 2EPLX 3ZT7A 2BY2A 3DYOA 1XYZA 4M81A 4H8VA 3ECQA 1UD8A 5LA1A 2PWDA 1R75A 2J74A 3VDHA 1TQWA 3GDBA 4E8CA 5D9NA 3WY3A 4AZ5A 3G6MA 2PBOA 3NCOA 1Q6GA 1E73M 2D23A 1GHRA 2WC4A 4AZ7A 1OGGA 2WCAA 1QI4A 1CXEA 4UR9A 1B3ZA 2OSWA 4ZFMA 4DUXA 2QHAA 3K8LA 4CCDA 1R46A 2V3DA 1GOWA 1K9TA 4X0VA 1GZJA 3GNRA 2WCSA 3U5YA 1J9YA 1UWRA 4BS0A 1UH2A 1UR8A 1XV8A 1H2JA 4UOQA 3IJ9A 4PTVA 3IAPA 1JZ7A 4V2XA 1C7TA 2WSKA 5M17A 2UY4A 2PWFA 3VDBA 1MXDA 2Q8XA 2G8ZA 3CGTA 3GNOA 3D50A 1RPKA 1UR1A 3QOMA 1CGUA 3VMNA 2CXGA 1E6PA 4HOZA 2WK2A 1VAHA 1UH4A 1MW0A 1VJSA 4UZSA 1US2A 1H5VA 5I79A 4CCEA 2VX7A 3AIBA 1HL8A 1BYBA 4OZOA 4P7QA 4CVUA 1KTCA 2FHFA 3W4RA 3ARRA 4D6HA 1VF8A 1UZ1A 1AVAA 3WY2A 3HG3A 4MB5A 3AIUA 4H04A 1ZJAA 4E2OA 2XYLA 3BAIA 4EAMA 3DYMA 3NSMA 1JXKA 5BXPA 4BQ3A 1HXJA 1GW1A 2E4TA 3A21A 3FAWA 2ZUTA 1UQZA 3VGFA 2FHCA 4TX8A 1DP0A 1MYRA 2VJXA 4AZ6A 4YN5A 3D4YA 3HG5A 4PMNA 1QX1A 2DIEA 1UKQA 1JFXA 3AZRA 4KH2A 5I2UA 1V02E 4JKMA 1FHLA 3VD7A 1PIGA 3K4DA 2DQXA 1MFUA 2V3EA 3VTRA 3VSUA 3HJEA 2PWGA 2JF7A 3A23A 1NWUA 3ARZA 5CJ5A 3W27A 3LRKA 2OYKA 1QOXA 1V02A 4JKLA 2WZIA 5F7UA 1AQMA 4UTFA 4HZ7A 3IK2A 5FL1A 4M29A 2V3GA 4MNKA 3VVGA 3BUBA 1PPIA 4W5UA 2DPEA 3T09A 4HA1A 4P7RA 3D5HA 1VFOA 1TVNA 2GJXA 4CD6A 4BQ4A 1PBGA 4LXFA 1LG2A 1R7OA 5CPSA 1OGBA 5A8NA 3BAYA 2QMKA 4HP5A 1UD2A 4FLRA 3IJ7A 3ARTA 5GQBA 5HDRA 3WMSA 1EA9C 5FL0A 2CBIA 3CO4A 1C91A 4FLOA 1HJUA 1SR0A 3SEPA 4KMQA 1HVQA 4MNJA 2W62A 1E6RA 4HPGA 3W6MA 1NWSA 3TA9A 4GZIA 1JD9A 2X2IA 1UWTA 1QW9A 1D3CA 1SMDA 4JCLA 2JEQA 3VM7A 4AZBA 3GBEA 3SIMA 4AD0A 2CKSA 4JFWA 3WQWA 3CPUA 3WUBA 2GK1B 2EPNA 1OIMA 2J4GA 2F1AA 2CEQA 3PTQA 4HTYA 5I23A 1ODUA 4WIWA 2ZWYA 2DT3A 3H55A 3HG2A 3AHTA 1O7DC 3CHDA 1H09A 1CXLA 2D20A 2VZVA 2ZX6A 1WZAA 1FP8A 3WMBA 3TV8A 1QI5A 1H4PA 2YA1A 3A47A 5GNYA 4AD5A 4ML4A 4V28A 3A4AA 1WNOA 2ZUUA 3T2PA 3S6TA 5A69A 3S2CA 3T08A 3BH4A 3AZSA 1R8LA 3AHXA 5A6AA 2D73A 1OINA 4AD2A 4KGLA 4M56A 1DWGM 2O9RA 4JIEA 2A3CA 5A3HA 2X05A 2VUYA 1ZBKA 4AYSA 2J7BA 3TOPA 3WL0A 3SURA 4AZGA 1WO2A 3I3BA 3GBDA 5I3DA 2XFRA 4AZCB 4OKDA 2F7QA 2ZXBA 1OCQA 4A3YA 3E1F1 1W2PA 1W1TA 3A24A 1QNQA 1GOKA 3POHA 1XHGA 2FHBA 4GI8A 3A4WA 4F9JA 1W91A 5I6SA 3VINA 3WDJA 3PZNA 4U33A 3SCUA 3F4VA 3O2LA 1W3HA 3RM9A 1CWYA 4L4PA 1HIZA 2OW7A 3ZR6A 2DGAA 5HBFA 2YLAA 3VSTA 1NOUA 5AYIA 3EDDA 4W88A 3CZLA 4AIEA 4Z2JA 4D71A 1XCWA 2VI0A 3W53A 3CUHA 5D9MA 1TE1A 3AMKA 4PMXA 1GORA 1E71M 1W9PA 2EPKX 1UD3A 5ABEA 5KEZA 3DX1A 5CLWA 1QI3A 3TTQA 1VEOA 4QDMA 4DUWA 4RE3A 1I75A 1GJUA 1E6ZA 4D1JA 1E70M 3U57A 4ATLA 3EJTA 3RJYA 3BVTA 1WZKA 3AJ7A 2QF8A 2JALA 5GNZA 3BUIA 3D52A 1HX0A 1JG9A 4IPLA 2YFOA 4MJ2A 3N12A 4TTGA 1W9DM 1W32A 2EO7A 1E5NA 5CZKA 2GK1A 1K9FA 3TONA 5HPCA 4JHOA 3M07A 3O6AA 4TUFA 5DF0A 3KL3A 1ZL1A 3EBVA 3CUIA 1B31A 5FKYA 3W82A 4MB4A 2HISA 3AIEA 1D7FA 4X0NA 1V6XA 1J0ZA 1CYGA 2XIIA 3VILA 5ABFB 3PZ9A 4XB3A 1H49A 3QHMA 2VX6A 2WSPA 4UQ9A 2G3NA 2CBJA 3AYRA 3QHOA 2WPGA 3VM5A 1JYVA 2NW0A 2ZX5A 2ALWA 2BVYA 2E3ZA 3WN6A 4PTXA 2CCRA 4JKKA 1HT6A 5I77A 1BVNP 2D2OA 1TR1A 5HPOA 2DIJA 3ALFA 3KL5A 3PZVA 2VZTA 3ARWA 2J62A 3UG5A 1G94A 4AD3A 1R7AA 4MB3A 2GJRA 3CTTA 4AZCA 5A2BA 1JD7A 5A2AA 1AQ0A 5C71A 3T0AA 1JAEA 3W38A 3ZT6A 1P6WA 1CEOA 3EMQA 4W8AA 2FE0A 3CUGA 1QI0A 1QNRA 2A3AA 2ZIDA 2YFNA 5ABHA 1OWQA 4B3KA 1UKSA 2VT0A 3VNYA 2VZSA 1IZJA 5HOSA 1ISVA 2J7EA 2XN2A 2GUYA 2W4XA 5JIWA 1FA2A 1VENA 4IM4A 1EQPA 4FLQA 1FOBA 3MS8A 3RM8A 2PB1A 1B9ZA 1E6QM 3WY4A 3CBWA 3GH7A 3MUAA 3RILA 1V6VA 4W7VA 5M3WA 3CUJA 1OT1A 3VPLA 1EOMA 1JZ5A 2NSXA 1WDQA 4D6JA 2WWCA 4PMOA 5A6BD 1TQVA 5BCAA 3MV01 3VMPA 1KQYA 3THCA 1KGXA 3B9AA 3WQVA 4R5EA 3RDKA 3A6OA 2VMFA 1WZLA 2CBUA 1KTBA 1E55A 1UD6A 4DWSC 4B9YA 1V0LA 5JBDA 3WBAA 4P7OA 1W2VA 4GZJA 3LXBA 4WKHA 1R87A 3SCOA 4CD5A 1C90A 3PZQA 1JNDA 4PMZA 1KWGA 1BFNA 2D0FA 1MFVA 2WZHA 2G4FA 4BCEA 3GXMA 1CLXA 2O9TA 4UFLA 1HL9A 3CIVA 4AMCA 1WCGA 1KR1A 2XWEA 2J7HA 3VDCA 3KWXA 1H3GA 6TAAA 1CENA 3SUWA 2WVVA 4AZHA 1HP4A 1GPFA 1B3VA 3GXTA 3L4UA 1JGIA 3DC0A 1TVPA 1NOWA 1I1WA 4LPCA 2BY0A 5EMYA 1H0GA 4RE4A 3IJ8A 5IFTA 2EAEA 4U3AA 4PN2A 1A3HA 1E56A 2VTFA 4PMDA 4DO5A 5FCZA 1BGGA 2J79A 1UR9A 5JBFA 3QOKA 3N13A 4HA3A 4NRRA 3VU2A 1UYQA 3ZJKA 3PZMA 2GSJA 2NT1A 3I3EA 3WFLA 2CERA 4Z2HA 5HXMA 1C8YA 5I24A 3D4ZA 1E15A 2F1BA 4KGJA 2QMJA 1GONA 2GJPA 5CLTA 4Z2KA 1HP5A 2YLLA 3ZM8A 1VFMA 1DHKA 5C8BB 1U33A 2WLYA 1UWQA 1B3YA 1HKIA 3OGVA 4NRSA 1YQ2A 1KBBA 3EJUA 1FHDA 3MU7A 2XUCA 1LG1A 1QNOA 1UR4A 1IT0A 5E1QA 4PBGA 3BLKA 4BF7A 2YOCA 4CCCA 4GKLA 1VIWA 3K1DA 3RCNA 4JL1A 1UKOA 3CZ8A 2JE8A 1UG6A 2BFGA 3LPGA 2WNWA 3CZGA 1XH2A 4LYQA 4Y7EA 1R47A 3HMCA 2PWHA 3RJXA 4D6CA 3EDFA 1UUQA 4D6DA 2GDVA 1ZU8A 1OT2A 4GI6A 3KZSA 1V3LA 1BSIA 4AXNA 2CPUA 3CC1A 3AXXA 1UOKA 3B8SA 4WLCA 1RD6A 4CN4A 2ZOXA 2DSVA 3AROA 1ZBCA 2W5FA 3AIQA 3KLLA 3WKZA 1E4MM 1HWWA 4PMRA 2A3EA 2CHNA 1KFWA 1X6NA 2VCAA 4XUYA 3ARPA 2XSAA 4UNIA 3AHVA 2J25A 1CXHA 2OWWA 1DWFM 1QWNA 1ITXA 3ARVA 2AAAA 1ZB5A 2JIEA 4F8XA 2EEXA 1H11A 2Y4SA 3T2QA 3SUUA 2VR5A 4TVCA 4UQDA 3HZ3A 2XJ7A 2D3NA 4LYPA 1MW2A 2ESCA 2XN0A 4UFMA 4IISA 2A3HA 1UR0A 4MAVA 4AY1A 2WANA 1QHZA 3WH9A 3EDKA 2VVNA 3DX4A 3MKKA 5A6SA 1J0IA 1C92A 2VCCA 3ZO9A 4CN6A 1UD5A 2J8FA 5M5DA 3I3DA 2VRQA 4AMXA 4CU8A 1GVYA 3GXFA 3II1A 4YHEA 2Y8KA 1M7XA 3A5VA 5I0DA 3N11A 3ZJ8A 4U31A 1BGAA 3UR8A 3D51A 3DX2A 1XSJA 2BY3A 3VIJA 3AS3A 1M53A 4YPJA 3GTNA 3UESA 2X2HA 1L0PA 2RGLA 3EJRA 1XRVA 4P7NA 3KE0A 1TCMA 2VO5A 1JFHA 1XYFA 3ZOAA 2F18A 2DDXA 4QCEA 7A3HA 4UFJA 3G6LA 2CIPA 1M04A 4F79A 1G1YA 1KCKA 1JZ4A 3CZKA 4XX6A 2CHOA 1Q6FA 1WDRA 4CVWA 4CU7A 4MDPA 1XSKA 3WF2A 3WNKA 2O9OA 4D72A 1FP9A 3N15A 1VBRA 4OJYA 3WUGA 1MQPA 1JZ8A 1DWHM 1EIBA 4PCSA 1PAMA 1J0YA 1TG7A 1WAWA 1WDSA 2YBUA 2F8QA 5BRPA 3L4WA 1I1XA 1PJ9A 4PSPA 5DO8A 4AD4A 3UG4A 4LQ1A 1UWIA 1B1YA 4EE9A 2JF6A 4MTVA 3W6LA 4D6EA 3PZUA 4HOXA 5IHSA 4HA4A 1GJWA 1RP9A 5D9OA 1V0KA 4J3XA 2J7GA 3WQ6A 2BV9A 1VFFA 5BXTA 2XFYA 2Z1KA 4P8XA 1FFQA 3FAXA 1LLOA 3VGDA 4UQAA 1E40A 1FH7A 2UY3A 4DO4A 1JL8A 3NUKA 2YIHA 2O92A 3N04A 1O7AA 1F4AA 4W7WA 3SCSA 4HMDA 4C7GA 2OLHA 2W66A 4MADA 2D0GA 3IGUA 4PRWA 3GNPA 3NYDA 3LPPA 3U5UA 1KWKA 3F5KA 2XVPA 3CMJA 2XG9A 3CHFA 2J75A 2V5DA 2C0HA 3VSVA 2FH8A 1XD0A 2J7CA 5D4YA 5I5RA 3ZSTA 1BG4A
chains in the Genus database with same CATH superfamily
3HE7D 4TN9A 3OKKB 3F7VA 3TUUA 2HTKD 1UZHA 2BVQA 2FB4H 4RMTA 2AJSH 3F7LA 4AEIL 5INDA 1WD8A 2XM2A 2V67A 2UUDH 4DTGL 3Q13A 4QNWA 3NGFA 5G5DA 3B0UX 2XTJE 4YSCA 4DLMA 3CQFA 4UU9B 5CGTA 2B4GA 1XVSA 4CRPA 1KTDB 5E6IB 2G3IA 3URBA 3HS0A 3GUFA 3PNRB 5CPTA 4J12A 4HMEA 1KJMB 4ZX6A 1HKMA 4FMVA 1R3RA 3KL0A 3CFBA 3QFEA 2OJEA 3H2EA 1E3FA 2DPKA 1AYRA 3PABB 3QH2A 3NIYA 3Q0HA 1ZY9A 2Z93A 5I75C 2CLOA 3H7BA 3M46A 3MMEA 5HVWA 5C9XA 4NEHB 3HC2A 5T1LA 2QKIA 4LSUH 1T80A 5I1GL 5LGZA 2F58H 4MA3A 5E2WH 1AP2A 3LHPH 4IRZH 4ONHA 3SQBB 1SXNA 3LQZA 5FO7B 3B9DA 1U0QA 1GNXA 4OVXA 5EF0A 2FJUB 2GPZA 3ECWA 1QTPA 3V9FA 4FKHA 3HN3A 3ZX1A 2HJPA 2BOLA 3B9KD 1I1YA 4G70B 5D8JL 2VRKA 4G56A 4U0RB 5T9BG 3WKNA 3WH5A 3E74A 5LG1A 1AZNA 3BP7B 4C6DA 3F5WA 1H5BA 1KB5L 3U46B 3EXLA 1NGXA 2J9ZA 2EH7L 5C0DB 4PUKA 2E9BA 3UTTD 4URKA 3NT0A 3EXJA 4XMTA 5L2JA 3C8NA 2FJKA 3VRLE 5IW6B 1I9RH 4UDTA 2FJSA 4LPTA 5IHZB 5AYXA 3DIVA 5BWFA 1JQVA 2G30A 3K72A 3KPMB 1EJOL 4PJ7F 1A6VL 1XH0A 4WO0A 5DCDA 4DYEA 3QEZA 2YAOA 1TJMA 4XX5A 4Q3MA 1I8UA 3ZDYB 4Y2WA 3UJTL 1NP0A 1ZSDB 1CMOA 4Y16C 4LKXA 2ZC1A 4LDOB 5EC1B 1YSOA 3OAYH 3Q1SL 4M7KH 4JHWH 3WO3B 5DD6A 3RM4A 3V0TA 3FFDB 2P8LA 3G0SA 4DP5X 3BCJA 3RO6A 4S3AA 2ANUA 4EZLA 1HILA 3KFTA 1ZUAX 4GX8A 1RCYA 3ARGA 4FA3A 2HVBA 3O6FB 1J10A 2DI8A 5MKGB 4NM8H 5F1NB 3MLTA 2ZUWA 5E2TL 3SDXA 4QDWA 3BGMA 2YUWA 4HLEA 4N1EA 3Q5OA 3ZTDC 1GS6X 3DKJA 4N6QA 2PCXA 3FGCA 3T71A 5K33A 5CZRA 1MCSA 3LCXA 5TDPA 4C6LA 2VM9A 3MSGA 4XZMX 2N4IA 3NPSC 1AO7B 1JZFA 4FFTA 1CIUA 2AXJA 4XIMA 2IDFA 1E2WA 1ECYA 1ZANH 3S6OA 4PLKD 4ACTA 4HH9A 5K5YA 2QV2A 5AZEH 4NQDE 4DAFA 2MPAL 1FQ9C 2KLRA 1XGQA 3KBJA 1U8CB 1U3HB 1O5RA 4MQXC 1XR9B 2ZKHL 3MUIA 2P26A 5T1MB 4K8EA 4LAOA 1ADOA 1TA3A 4A2EA 3NRQA 3NJKA 3RWIB 2OZTA 1ZBVA 1IIHA 1G1OA 1AXTH 4RKAA 4F27A 1GTHA 4Q7NA 2YDSA 3ECBB 4PRPE 3K5XA 3VIKA 2HKFL 3T7VA 4MZ2A 1EUTA 1U36A 1FF5A 5BS0A 4QWWD 3RGVD 1MJ7L 1IJ9A 2Y7GA 2HV5A 5FJIA 1IO4C 4YJ5A 4UBDD 3EFOA 1TJ2A 4GSQA 1G4PA 4PJDB 1ICSA 2P8BA 3OAUH 1VCVA 4UTMA 2E7LA 3BMWA 1RQBA 4HHGA 3TBWA 2YL8A 3L4YA 5FYKE 2E7DA 3LQLA 4M0XA 1LO5A 3L1FA 4BZ2A 3RVWD 5GVJA 1XT5A 4AMWA 1GVRA 2HT4C 3BVXA 1R24A 1KN4H 3MLVL 3ATZA 5JQIB 3M0KA 1KG0A 4OF3A 4PLNC 1DWAM 4RFNC 4X50A 4F33B 3UIZA 1WD9A 3E3QC 4YH6A 3IUDA 4H6EA 4NSBA 5EIQA 3FTYA 5JQ9A 3HI5L 5EU6D 3P81A 4GYBA 2O4QA 1YRKA 4I9AA 1CVSC 4JFHD 1BEYH 1MI5A 5DQ9B 1UXWB 2DQ6A 3PTKA 1FRGL 3H9HA 3NZPA 2GTZB 4YDVA 4REQA 3PZTA 3GZPA 4C56D 1Z9AA 5F88A 1QDSA 1AAJA 4OLZH 3LZQA 3QA3B 1F18A 5F1IA 3BWSA 2OB3A 2VC2B 1V0NA 2C1GA 5B7FA 4PJIB 1E4XH 4JAMB 4NKQB 3ESMA 1OG0A 3WDQA 1CXKA 5IV2B 4AHOA 1UKTA 1WGOA 3N2MA 3L3OB 2PDYA 1R9ZA 2KYIA 1YPFA 5I1LA 4KBPA 3N17A 5CBAA 1EV2E 2VOTA 5LIWX 4AFYA 1I2RA 5B38G 5I6LA 2V5SA 4P7LA 2J88A 1KCLA 2V2XB 1I2NA 2B39A 4MA1C 4DPQA 3MLYL 5GZOA 3LKNB 2GVYA 4DJDA 1ME9A 4FNPA 4N85A 3CXOA 5GRJL 4IJTA 3VH8A 1CCWB 3U2JA 5AKVA 2A77L 4P04A 2K6WA 3NVQA 4XMPH 3DHMA 5F89A 2YDAA 1MCNA 5FECA 4IUGA 3QO0A 1GQLA 5K9JL 3DGGA 3M47A 4TNVF 2J72A 1JZDC 4HU3A 3VKBA 2X0YA 1DL3A 3QFGA 1KRCC 1NDGB 4J1OA 1BFSA 2J55A 1PGRB 4XBGA 3WMLA 3NP4A 4RDVA 5IVNA 5AYBA 3P60A 4HZ6A 1KY7A 4NN5C 1PNDA 4RGOH 3NRPA 3PZIA 3D25B 4PJ8D 1BFOA 3CSPA 2EDDA 1LE9B 1Y65A 4G42B 3WSUA 3M41A 1TKWB 5C0QA 3W81A 4NO2B 4LLUB 5I74B 3SE8H 3SI9A 3T40A 5D55A 4J2XA 1K2DB 3LK6A 4NQDD 4TQEL 4XPAL 5LGHL 1GVEA 3DSFH 1G1CA 1CL7I 3KBWA 3SGKC 3D87B 2PDKA 1TQSA 5FOOA 4MLRA 2WYZA 4QGTA 4A8NA 5D2YA 1XTMA 5DDHA 2UXVA 1UURA 3ZKSD 4QRUA 3ENLA 1VGKB 4IT1A 2AGJH 4IQEA 4PRPD 4P2RA 3F05A 3UZJA 4TS6A 3MCLH 4PY8I 5ADOH 4C60A 1JYNA 5I78A 1CR9H 4QRRA 5E9AA 3S1VA 4DKFH 2WUCH 4Z7UB 1N68A 4U1HB 4ZSTA 3BCFA 2XGBA 3FDKA 5JOEA 3CWNA 3N4FA 4DPPA 5CP3H 2JEPA 1E50A 1CLKA 3NGJA 4XHJC 2M83A 4Z7VF 4HJSA 4L9LB 1SZNA 2FGZA 4L3EB 1GOHA 2A6IA 3MRGA 4WW1A 1G7MB 5E08L 5G1YA 2EICA 2PDNA 2I07A 5JW4R 1XC6A 1BTMA 4ZUTA 2GTWB 1FFNB 1A5FL 4R8WL 1KFCA 4OLYH 1L6XA 4WXZA 3AIVA 3LZFH 4GXUN 3KJ4C 3DYPA 3QI9A 4INFA 3ZWSA 3OEXA 4CC4A 3W22A 4PULA 4RAHA 1XUZA 2XVGA 3ZW3A 4N0UE 3AM8C 4J5NA 1RULL 1P0BA 5T3XD 3WK1A 1BEXA 4EJ1C 4IGMA 4Q32A 1GA2A 4TTUA 2DWSA 3OKYA 4TSCH 3NZGA 5MEOA 2FGWH 2ZUNA 4CEUC 5KJ4A 5TDOA 1XLJA 2APFA 3SUVA 4UT6L 3LSCA 2YBGA 5GHWL 5JW5B 4QP0A 1ZT4A 2V7HB 2FX9H 3NQVA 1V3HA 2R1PA 3CHPA 3WNOA 3PWAA 1J1PL 1INDL 4WEBH 3D3VA 3DVGA 4OUOA 3ECQA 1G6RL 1CFTA 1PFOA 2R69A 4ONFH 3VNDA 2Y7OA 3IDXH 1H3VA 3IUHA 4X9HA 4PWFA 3BZJA 1Q6GA 5KSAA 4OFQA 1XGYL 3H4GA 3IDJA 4OF7A 3H4FA 2TYSA 4AQ1A 1V5XA 4AOFA 3GGWB 1CDJA 3T8XA 3GNRA 5IB1B 4FALA 5I0WA 2Y2TA 5FF6B 1HSAB 1R6VA 4JTFA 5J9PA 2DQDH 3D69A 3ULVL 2PW1B 4ZX4A 5EWIL 3M0IA 1YUHA 1D6EB 1FDLH 2ZXEB 5IB5A 3WYRA 1UH4A 1OAYL 5I79A 2VXTH 2FWUA 1TVBB 3QKEA 3MRJB 1AG0A 2V5MA 3VSQA 1AUSL 5J06A 4H04A 1RLBA 3U0WL 1VCBC 1F1GA 2GBAA 4NN6C 4PUJA 1GW1A 5B7ZA 3BWUC 2XWBA 3CAWA 1EBHA 3DROA 5HJDA 4CVXB 1VLWA 2DQGH 1JFXA 3CDGA 2VDMB 3K4DA 2DZSA 4O52A 3VTRA 4J2PA 3RFRA 1CFQB 4LLWB 2Z8SA 5IF0A 1VFOA 2O6DA 4BSWA 1G7IB 2ZCKH 1M05B 2CO7A 2CLZB 2DJSA 2I16A 3BP4A 4MCNA 2JXMB 3DUUB 2RB8A 2ZP0T 5IJKA 3C6SB 2A9MH 2DBLH 4HALA 5GZND 1HVQA 2W62A 3UXKA 4NZRH 1QPPA 1MCCA 4HGKC 3QUZB 4JIIX 5AW1B 1E9OB 5JIIA 3T3ME 1MDLA 2BCKB 2D4DA 4EQ3A 5F71A 4QTIL 4Q8UA 3BRDA 1O7DC 2RGSA 1H09A 4G43A 4TPRH 2YA1A 2OG9A 4H1LA 2OR8A 2AK4E 4Q4KA 1QSFB 1FWHC 3MROA 3T2PA 1BBJA 2ZDRA 2BOBB 4YSOA 1HWHB 2F53B 4EIUA 3WTUA 2NY3D 5CILL 3BLOA 1ZPUA 3L1GA 2F7QA 2TRYA 4FA7B 5FDYA 1BA9A 4IMLA 1F6AA 3POHA 3LEVH 3QG7L 1CICA 5F2GA 2XZCH 3VINA 3WDJA 4YSSA 5ICYA 3SY1A 4ZMAT 4AXWB 3LM3A 3S35X 1GQNA 1CFSB 3C8DA 5DZOA 3CV6A 4QRTB 5CD5D 3AALA 3QXDB 2DFAA 2V7NA 4AY8A 4FADA 3G6JA 3JS3A 2E68A 4P5KA 4ODWA 4LCIL 3W86A 1KPUB 5AHFA 3D0CA 1F5ZA 2V63A 4MD4B 4W9CC 3J8F7 4MG4A 4H5SB 2YMXH 4RE3A 5L9FA 2MCG1 2MPVA 5B8CA 3MRNA 3AJ7A 5GNZA 3KRSA 2E7BA 1W6TA 1KF9B 3FBKA 3RX7A 4MDIA 1AS8A 4RESB 2KKQA 3OJDB 5GJMA 3BW3A 2JI3A 4QG8A 2R0ZH 2XLLA 4R3SA 3KVKA 1KN2L 3RDJA 4X2UA 4F37F 1TDQA 2UY7A 4MB4A 1TQCB 4O02L 3STCA 3FUJA 1Q9KA 5C08B 1IBHA 1CO1A 5ABFB 1P43A 1FJ1A 1IE5A 3LKPA 3OVGA 4MWAE 3LVTA 3M1BB 3FRUA 3U7AA 3B8UA 1Q7MA 4J1UA 2D2OA 3GLEA 3Q8BA 1ASOA 4XMVA 2PU0A 4HU2A 1ZNNA 5LGJB 2P50A 5C3TA 4AZCA 3O3DB 2OI9C 1QAWA 2EYRB 4AGMA 1WISA 1TTUA 3RYMA 1LEGB 3W9EB 1RSCA 4DZBA 1UYWL 3RG6A 3VNYA 1RURL 4I4WA 3HN5A 3OZLA 1KTLB 2DMHA 3VKJA 3P3SA 4AQAA 3SPVB 3RM8A 4PB5A 4I3SL 3MUAA 3RFZA 2J1YA 3AQXA 1EOMA 1FTXA 4R9OA 3NYZA 3T4YA 2I5QA 3GZOA 2QV5A 2FDSA 3TN3A 3WQVA 1QNZH 1MHHA 1V0LA 1TPEA 4HC1L 2XWXA 4G6AC 4WKHA 4R4FH 2JJTC 1T8XA 4CD5A 5LUMA 3WUZA 4N90E 4PD4J 5CEZH 1X4XA 4UFLA 3HF3A 2Y5QA 1WCGA 1CENA 1A14L 1M7DB 4I9JA 1V79A 2DU2A 3QORA 1SYVB 1TVPA 4RLIA 1JUFA 3O8XC 3NJJA 4PR4A 2EAEA 2ZQKA 2JTDA 5AG8A 1A7BA 5KVGE 3TWCH 3SDDB 2GSJA 4GVFA 1HEZA 2CBMA 5HXMA 5I24A 2IV9A 1KYUA 3KPSD 3DFNA 4Y4HA 2MSPA 1RQ5A 2FECI 2EILB 3FB5A 3DVFA 2I5YH 1QRNA 1UC4A 1X5YA 4MJIE 4M43H 1BZ8A 4HH8A 3VOIA 3MU7A 2XUCA 1LG1A 1H8LA 5H37A 2F54A 3GC4A 5LQBL 4Q56A 4DXVA 1EJSC 1ID2A 4US6A 1XPGA 2B20A 4UNUA 4LSQL 4D6CA 2O6PA 3W9DB 5HDWA 3CC1A 5FR3A 1EVUA 2VN3A 3O3BA 3B8SA 1ZT7A 3UTSD 2WXLA 1B3JA 4KXZH 4C6JA 2M8XA 2J6EA 4JQ3A 3H9SA 2VCAA 3CVHA 4JZJC 2K7PA 4UNIA 1CXHA 2C9UA 5DRZA 2L4OA 4IMGA 4HPXA 3SUUA 2IALB 4N0YL 2XJ7A 4LYPA 4EI5D 2VW4A 2XN0A 2BASA 4UFMA 2WP3O 3PK7A 4EUPB 5BXFA 1TIWA 3O11A 2X3CA 4I5XA 4GISA 4XT1C 4XCEB 4X4XA 1IM9A 4H26B 4MVBC 3SBPA 2FQIA 2Y8KA 3A5VA 2GVJA 4LVFA 5LJYH 4HN8A 1ZLSH 4C90A 3R10A 6ALDA 1BQHG 1TCMA 4Q7DA 2R56L 1NGYA 2Z2UA 2CIPA 5C0IB 1KCKA 3UMNA 3CSTA 1CDCA 4XN8A 3PJSA 4Y4FD 4MDPA 3OZ9L 4TQHA 4A2LA 2Z25A 5FAAA 1FP9A 1TVHB 3MUCA 5D2NA 2YGNA 1XR2A 4RMQA 4HWUA 3UNTA 3GX9A 4NKIL 4BDVA 4C6KA 4AD4A 1N18A 1K8DA 2QHLA 3FTGA 1A1MB 2C1IA 3ELFA 3FH7A 5EZJB 4J3XA 1F02I 1CZ8H 4F7EA 3W2UA 3BKCL 2FKPA 4ZXBD 3GLAA 3VRIA 1JULA 4C6BA 2CO2A 1FWIC 3S3GA 1FYTA 3SCSA 1JV5B 4FQXC 3PQYD 3BDYH 1E28B 4OD3H 3F62A 2E6AA 4XZIA 4RIRB 3V0EA 1AD4A 1T7VA 2XKNB 2QPDB 1OQFA 4OE7A 1XZ0B 4EEEA 4DJEA 3HIJA 3H2FA 1XF5B 1J7VR 3I6LE 3CT2A 1Z0NA 3LRMA 4MMWA 4WSKA 1CFVL 3EYOB 1XR8A 2F0CA 3PPFA 3REVB 1VBUA 2GOKA 2VN7A 2LU3A 3K6FA 2AKRA 1R3IH 3ZL4L 5K9CA 3SKOB 2O5XL 2LT9A 4ZTEA 3LA4A 1CLZH 3ULVF 3D6GA 4JCMA 1OTUC 2V6HA 5G2NA 3GH5A 3W1MA 4OUUA 3FUMA 3HZVA 3WYZA 1J79A 3OZOA 3MUZ1 3FT1A 2YXGA 4PJ5D 3OQ8A 4N90D 4X6DE 3AS1A 3UYRL 1LWHA 1G7VA 2MEJB 2YK1H 1QU4A 4LAKA 2YW3A 4Z76A 1A3QA 1P7QA 5F7WC 4IOFD 3CWHA 1TJGL 5EZPA 4E41D 1V7AA 2F38A 4QQUA 4WOZA 4PBDA 2PWVA 1WA0X 5HHNB 3C5SA 1O9WA 4YHPB 2HROA 1I60A 1LMKA 1EEZA 3BVVA 3QR0A 1QBLL 3K46A 3QR3A 4YR6B 2PSNA 3IDYC 1FA4A 2SEBB 4AYEC 1V10A 4J3VA 2IQAB 1P1XA 2Z2AA 4K5OA 2WP3T 4OFIA 4IP4A 1RU9H 2CETA 2AERT 4OVUA 2H26A 3SDYL 3WGUB 1Y0LB 3UJJL 2EPMX 2PZNA 3T0EA 5I66B 4G8FA 1J0HA 3K71A 3VZXA 1M4KA 5T3ZL 3E8VA 1T6VN 1T1XA 4I48A 1KJ2A 1ITUA 1R33A 3GVGA 2DSUA 4WJ8A 2GQHA 1HHGA 1I31A 2AOSA 3NQ2A 1J1XL 4HNOA 2RALA 4PJHF 1JK8B 3QWOA 1HHIB 5GGSA 4LOVA 3LPOA 3KXQA 1V0MA 1HCYA 5A2CA 2Y6SC 5EU7E 4EQ2A 2V5BA 1NFDF 1NJJA 2OW6A 3ZUNC 1MFNA 3N40F 5E99L 3ILEA 5BRZE 4MXWL 1GIGL 1LEKA 2BLFA 4Y1AB 4TTDC 3VIPA 1S8DB 3TURA 3BAKA 5IQ7H 2D8KA 4JUTA 4DB7A 3F4DA 4FOMA 3UERA 1N8IA 3VA6A 4CVZB 4GRMA 4JTLA 4X80L 3CFMA 2YJLA 4WI2A 2WKGA 4JY4A 3MOBH 4PS8A 4JFSA 1Z3RA 2QR0B 5BVJB 4H8NA 2W63A 4V15A 1XIIA 3OB8A 4HVXA 4K5NA 3PNWB 1DBBL 4O4YL 2BJML 2WMGA 3DKLA 4UCGA 4TLSA 2B1AL 1Z9LA 2BVDA 4Y9CA 4FXTA 1GVOA 3H9ZA 1JYWA 1S2AA 4QRPD 1WKFA 3A6CH 2BNQB 4L3AA 4N2BA 1Q2RA 2ARJQ 5I5JA 1KCSL 1C12B 3WS6A 2WXDM 1OTSC 4UZUA 3LPFA 1CZ1A 3F00A 4TNGA 4MD0A 4TNVK 4NNAA 1N3NA 4A55A 1MCWM 1AKJA 5D6CB 5DD0H 1QR4A 3HVNA 5CGMA 3WF0A 3U36B 1EFZA 2GCYA 4IICA 1KYAA 2E6FA 2CNCA 4XVUD 3UA3A 4O00A 4L05A 2ACQA 4Q6IB 1Z89A 3LXUX 1VCFA 3GXPA 5LDUA 2WHMA 1PX4A 5F6IC 2NX5E 1E9ZB 2TODA 1H1NA 3M0HA 4ZI8A 1BAFH 3I50L 5DJDA 3DRQB 3E0FA 4AGLA 3PCYA 2JJSC 1WFTA 2FX8L 4E9RA 5EOQH 4JDVA 3TN0B 3PU7A 4BFOA 1W0YT 3MV8B 2GPTA 3ARSA 1JMZA 3L5HA 4WJEA 3W2NA 1IEXA 3QZWA 4YVPA 3GYRA 1GZQB 2ZWKA 3QJRB 4P2AA 1IU1A 2EF9A 1NGZA 3VNZA 4CSTA 2P5EB 2A4EA 3ZJAA 1VYSX 3SADA 1P9MA 2Y1YA 5E93A 5J11C 1HSBA 3HNVL 4BKLA 1G87A 5D9SB 5AUMB 4JYDA 3C56A 5FF7A 4LF1A 3MMDA 2FZ9A 5EOCL 3WFCL 1NY1A 1HNGA 2ARJB 1UBSA 3S1UA 2D2HA 1H19A 2PXYB 4EUPH 1CD9B 4HHAA 4RBPK 4GW5A 1G7PA 3ZIZA 2E9IA 3LEYL 1RJCA 1SJHA 3NZUA 3GSQB 4TO8A 4HUXB 2YZ5A 3JWNH 2C1HA 3ABKB 3USZA 4A6YA 3OJGA 3S88L 3C09B 2PTTB 4JQXC 4W9TA 4H3DA 3BOLA 4LV4A 1Z5LB 3WIIH 5F9AC 3SCMA 3IXAA 1OF2A 5C7HA 3OJMB 4H9ZA 2H0EA 1TRDA 3HOJA 2DWEA 4WQOA 5DHYB 1HF6A 4AX6A 3NZQA 2WOQA 4FHKA 4ZUVB 3U30B 5KVDL 3RP1A 3WFHA 2ZZ6A 4L9XA 5J5EA 2PPAA 2CRYA 1SYSA 1X6LA 3IPFA 2WBXA 7TAAA 5E4OA 3DENA 4OHQA 2V30A 1DVFA 3BQUC 1X7SA 1WYIA 2JI1A 1S9XB 4P3DB 1AI1L 3GSNA 4S3EA 3VXUA 3WMQA 3A3HA 3WU1A 3QFJD 2EKSA 1DEDA 3U2EA 5A6JA 3V6ZB 3O06A 3TT3H 2WC3A 4AUUA 3WBYA 3W7PA 1GZHA 4KO5A 4KVNH 3LD8C 3KRBA 1XLLA 5C0EB 4XTDA 5CJOL 2BXZA 3LLXA 4WEMB 4OTKA 4G8IB 3HN8A 4XC3H 2E5BA 3SCQA 5DJ8B 2LLNA 3LENA 3CZJA 4LB3A 1TELA 1NGQH 2NY0B 5BRZD 2YDQA 2MKWA 1KGUA 4WD0A 3BKJL 3I9PA 2B3RA 2NTFA 3BOVA 1Z3GL 1OCCB 1IBYA 2GGGA 4G3YH 3RU8H 2HLFD 2X2GA 3NIGE 4I3RH 3D39B 4XN7A 4ZQMA 4YUEH 1D5XA 2E59A 2HTLD 2WQDA 3RKDD 5EEUA 2A5HA 1W3KA 5LNVA 3GS7A 1SHXA 1UACH 5ADPL 4XNBA 4JG1L 4RXFA 2IMMA 4B3ZA 2QTVA 2ODOA 2K8MA 5EZOH 2B2XL 4MZRA 2HBXA 3WNNA 2EIBA 1E4KC 1A5CA 3LCHA 3E7JA 4XO5A 1YEDB 5F2LA 3M0LA 2VD9A 4K5LA 3ZL2A 4OGYH 4RH4A 3L5JA 2GK0B 3C2SA 2B59B 4JM2F 3UBXG 4LVOC 5CHNB 2F5BL 3LMJH 1UZ8B 1S78D 2Y89A 5CN1A 3B3IB 4IMDA 4JHAL 5HJ3B 4IJCA 3AITA 1PLCA 3FB6A 1R3KB 1BGXH 3GXUB 5I15H 4YIQB 3QHZL 4DM1A 4NP4H 1WZMA 1F58H 2MTAA 5DS1A 4RRPA 2PZ0A 4LT9A 1QO3B 3N3EA 1JAKA 3QJZA 1FZOB 4O58L 3L5IA 3K6NA 4FS0A 5C6MA 1G7JA 3PXLA 2VO8A 2NX5D 3PPSA 3IXTB 3QXTA 5IBUB 5MERA 3MSDA 5AEAA 3QDJA 3IS1X 1ZKAA 1KELH 4KJYB 5MP6L 4HJTA 3D12B 5AVRB 4JANB 3BZEB 3H2QA 5EEVA 2N7SA 3V4VB 2VLKA 1EEPA 1M1XB 3AC0A 1HEHC 2J1KA 1GOFA 4PRBB 1UEYA 2IQ0A 1D2OA 3KGUA 2WXHA 2GJ6A 4PUEA 3KZPA 2QGCA 4R96B 4KMTH 1KDIA 5IGXH 3QEGL 4ZFQA 2XV6B 4ZE4A 3C2RA 4MGXA 1A0CA 2KDYA 2O93L 4A2DA 4LARL 3ZE2F 3URQA 1F45A 7XIMA 4A37A 5J8LA 1UM6H 3ZVIA 3ZY7A 3CNKA 1IGYA 2NTSP 3RPDA 2MNWA 2DS4A 4WI7A 2TSBA 4YE4L 4C6OA 4BZ2L 1ESWA 1IXNA 1YEJH 5HDBF 4D0DB 3FSVA 2EVIA 4P07A 3JU2A 1NLDH 4M5SA 4DBUA 4ZW8A 2HE5A 4DGUA 4FTDA 1QHOA 1PSCA 3ZHKA 5LIKX 4G5ZH 4Y7MA 3K30A 1NMBH 1DIKA 1RIUL 2E6DA 1J88A 2WXRA 4PB9L 1WEJH 2D22A 1TFPA 2OL3H 4ZQKA 3EAKA 3ZKNC 3W0WD 2AZAA 1NF0A 2CLRB 3DUHA 1VFTA 3SSZA 4WJ5B 2PE4A 1D5MB 1DBMH 2BY2A 3PL6B 4YSTA 5LA1A 4GC4A 2VXQH 5C6PB 4HZAA 5D2LA 4S1DC 3MLZH 3CIXA 2BNRB 4JDBA 3WY3A 4AZ5A 3ZTNH 3HS9A 1OZQA 3V0HA 5IQMA 2WXPA 1T2XA 3RURA 1XF1A 3DO4A 3FFCA 4F37K 4GH3A 4G1MB 5AAWC 2QQKH 5D5MB 3VXRD 3IJ9A 4UQ3A 3H2CA 43C9A 1DVXA 5ANMB 4LSVL 4M7LT 3DTUB 3QOMA 1RA5A 1AIFB 2IBGA 2IO5A 1XIEA 4UZSA 4FZIA 3O4LB 1JGMA 1QSVA 5L8LB 4P7QA 5FV1L 2C9QA 1ECQA 3OR6A 3F2DA 3ARRA 2V2TA 3ET9F 3QZ6A 1YPZF 3BN9C 2ZOLB 4B2DD 3BAIA 2RHGA 3WLMA 3N4EA 4JQ4A 3FO9B 4BI5A 5A3ID 4JY6A 2UXFA 2V8MA 5ICXB 2VJXA 4IGBC 3QUYB 3MOAH 4LVHB 4XO6A 1ZHBA 5E56A 3LHWA 1YY8A 3UPRA 4JKMA 3UBGA 1PIGA 4H9MA 4BD4A 4AGNA 5CJ5A 3DFQA 3PUDA 1V02A 4ZT1A 4K71C 1WBXB 1JK9B 2AK1H 1P6FA 3UJIL 4OGXL 1E5YA 3T09A 2GJXA 3TJEL 3S36X 2QMKA 1UOLA 1TG8A 4JPKL 2Q8BH 3P3UA 3V7PA 2CRIA 1F4YH 5FL0A 1ET5A 4JG5A 3EOTL 4ZPTB 4W9DC 4IL0A 3BIKB 1AOZA 4WHTB 2WO3B 4LRIC 4G8GE 3ABSA 2P88A 2AJZB 5EUOE 3PWUA 1L9RA 1JCLA 4UTAL 2QZRA 1PSKH 2LVCA 5IY5B 1OARH 5AD0B 4R33A 1QI5A 4WENB 1ZJIA 4M6PA 2HRHA 4R3UA 5D1QD 1W1B1 3C2AH 4QE1A 1XB6A 3L8QA 4M6NL 2ATKB 3F2BA 2EUZA 2D73A 1XYCA 2Y06H 4F8QA 1DSWA 2VN4A 5I19H 1DDHB 3HZMB 1I53A 1EAQA 3WL0A 3GU9A 1KBIA 3MX0B 5CG7A 1LO3L 3IRCA 3L7FB 4DQWA 3E1F1 2CZ5A 4LSPH 2HNHA 2IXQB 1E2VA 5HMSA 4JICA 5CP7A 4NQEA 3A4WA 1NCWL 4O17A 3W7NA 2UV3A 3ILPA 2L04A 1TZHB 4KBXA 2JCWA 3TGXA 3STLB 2GIYA 3TXAA 2DGAA 1IWPA 3T2NH 1R0AH 4QI3A 1TE1A 1ZS8B 1SXBA 1TO5A 4NILA 4KCUA 2FATH 1BD2E 4W81A 4DP7X 3QFDB 3ITYA 4MNQB 3S35L 4LIQH 3TF7C 4EI6B 5SWQB 4QT5B 1WAUA 1ZE3C 2APTA 5AL0A 4OCWH 5B1BB 4NZTL 2PCFB 2GQ8A 1KA9F 4OW6A 1SUXA 4J4PD 5BVPL 1HWGB 5E8NB 3FNKA 1DFBL 4B6ZA 1J0ZA 2OMYB 2PR9A 1SJEA 4HUUA 3ES6A 4BK5C 2Q86B 3M9YA 1PYWB 1IT8A 4X42A 2W9EL 5C0BB 3QHFL 4Q7BA 4JKKA 5EBMA 1JXDA 1S7RB 3VH8G 4EDXB 4M3PA 3AY2A 1KIRB 1AZ1A 4N0CC 4R7XA 3MYOA 4I7UA 5JDSB 1HO1A 3JWDH 2H1LM 4ZTPL 2EDJA 5IB3A 5C0GA 3TA3D 3DMMD 2K1MA 4DXXA 3T8LA 1UKSA 3LSOA 4JGNA 1AD9A 4X83A 1IZJA 3D0LA 3T44A 4OY9A 3BLDA 3PULA 1ED3B 3GKZA 3DA0A 3HQPA 4J3OC 3DUSB 4C4BA 2WZPD 3R18A 2V2DA 2KQNA 2A6NA 2OJZL 2R69L 2Y8UA 4NNYA 3DCPA 3C6CA 4ZUUA 3V7AG 4XO4A 5FGRA 1ETB1 1XGPB 2VEMA 3TA6A 4P7OA 5FW8A 2M2DA 3V4VH 3DX5A 3GI8L 4HG4J 4EZKA 3H21A 1OE1A 4RDYA 3HFYA 1MFMA 1GAFH 5HHOE 2YHGA 1EYEA 5JORA 4JNMA 4H9XA 1AGEB 4Y5YC 2ODHA 2QJHA 4RE4A 3OC8A 2VL5B 2H8ZA 3D47A 1LRTA 4ZMNA 4L23A 4M9PA 3PG8A 3N13A 4ZSOA 4X3ZA 1BZ7B 4RZCA 4NDMA 1MHCB 4RZ5A 4AK2A 4M7JH 1IQ8A 3ULUD 1GY2A 3Q4DA 2GJPA 4X8XA 3SDXF 4YK4B 2XIOA 1UWQA 1HKIA 3C5JB 4JYEA 4HWZB 1F3TA 1QNOA 1YA5A 4CAGA 3I9AA 1IT7A 3K1DA 1UZDA 2EZ0C 1UG6A 3D2UD 3UDWC 2H32H 5TFSH 2C3HA 3HMCA 3EDFA 4X6FA 1Q72H 2CDEB 2GDVA 3DFOA 2O6FA 3N1QC 4EWND 4GBXD 2EXWC 3INUH 1M41A 1RD6A 4HN4A 3AROA 3OPZH 4JYFA 1RBAA 2VR2A 1FWSA 4Z7QE 2BM3A 2FMOA 4PBEA 3AHVA 2J9XA 1BKHA 5SWSB 3MCMA 2XN9E 1FWJC 1T89A 3QUGA 4JQIA 3VXQA 4NYLA 4NO5B 3AU0A 2YBVA 4YE0A 5L88L 3GNNA 6FABH 1K3ZA 3NH7L 2J5LC 1TPUA 2X4SA 2A3HA 1UJPA 3Q2NA 1DUZB 4NX5A 3MKKA 3P0YL 2XTJD 4UOW0 3DG3A 1C92A 2WQRA 4UV7L 2QUNA 1A9EA 1DL7H 3THQA 2X4RA 4L56A 1BGAA 1W1ZA 1FAKT 4J2MA 4FG6D 4MWFA 4PWHA 3T8VA 3GTNA 2X2HA 3GMOB 4AU0A 2IOMA 2O61B 1M68A 1UP0A 3OU8A 3WLIA 4UFJA 3B0PA 1OAUL 4J6RH 4HQQH 3Q05A 3V0FA 4CU7A 1TCRA 4DAGL 3WF2A 3TR9A 4DHLA 4XMZA 1MQPA 4HDIA 3KCPB 3O3EA 3HBGA 4IMEA 3AM8A 4P5TC 3MV7E 3SN0A 4AYDC 4WR3A 3CLFH 2PO6B 2Y7EA 2DF3A 3V6FA 4P4KC 2NX3A 3WZ0E 5C7XH 5I6XB 4U6TA 2DUZA 4LKCB 2H41A 2DTSA 1EGMA 1FFQA 3D05A 5ENWA 3W56A 4KKLD 4DO4A 2YEZA 5C0CB 3NUKA 2GHZA 4NYYA 3CCHA 2VABB 4D8ZA 3Q2DA 4FA6A 2Y1AA 1HI6B 3WXWL 3TC9A 1GW9A 5BV7L 3QDHA 4GG6A 4F93B 2NW3B 4QAMB 2G2RA 4MMYA 5DT5A 3HE7C 4ZYKA 1SQ2N 2X6CA 3WLSA 3BGJA 4WO4C 3RLUA 1EANA 2A73A 3EJZC 4U4MA 1Z9PA 1F11A 4FHAA 3T1FA 2BGNE 4K3HA 4M24A 4TNWF 4XNXH 4OAWA 1JPKA 1FWTA 2J12B 2WQSA 4XXCC 1V7YA 4RZ6A 5HD8D 3VOCA 1ECEA 2VELA 4RJEA 2XICA 3DBPA 4XAYA 3HC0B 3L48A 3IVUA 5E8PB 4KVCH 4ZEPA 5C0FB 3R4IA 3QV9A 2H0FA 3NIDB 2QDVA 1SY6A 2MANA 1ZPTA 1JXFA 4OD1L 4Q8VA 4PB0L 4XNQA 3YPIA 3ZXAC 1JYXA 3MFGB 3CLEL 4FI4A 3EYFA 4K3DH 4U6YA 1FL5B 3B8VA 4FPSA 3RY4A 4N5ED 1LBMA 4JRXE 1YJDL 3BUQA 3FO1A 4EIZC 4A3RA 3BVDB 5I6MA 1L6GA 2E9MA 3AXKA 3WQCA 3I9GH 2QV4A 3QISA 2VX4A 1I8LC 5TNVA 2VZ3A 3V5FA 5CAKA 3CN1A 4H1LG 1FGNH 3EJCA 4QCIA 5DGQA 3MI6A 1C8XA 1FL3B 4DKAA 5E09A 1HXYA 5HTSA 1XXFC 2O7QA 2NY2B 5IR1A 5I71C 1RY7B 4NPKA 5C8JA 1SN2A 2ZA3A 4FNLH 4JHUA 1RVFL 4KROD 4G7SB 1I9IL 2EACA 1IUZA 3CMOH 1B2WH 2X1SA 3FSTA 2DYSB 1II4E 3H7VA 4OBSA 2HRGA 2AQPA 2ITDA 4XO8A 3RPIA 3OD3A 1R3VA 2R0LH 3FY1A 2XN9D 1VCGA 4N0FA 2YEQA 2HNEA 1D7DA 2FSEA 4UCFA 5KW9H 3O2VH 1MNZA 3F7JA 2AEPH 2OMAA 4XX1E 4KUCD 2ZA1A 2ZAIA 1CL7H 2FYMA 5DJZB 1DE5A 3VWJD 5AVHA 1FO0A 5HWMA 3NSCA 3OTRA 2NUPA 1VB9A 3LB6D 5D8WA 2B4CL 2J6EL 1RUQH 1K9DA 3SCNA 2TSYA 3CVHL 4IW4C 5E4IA 5FYKD 4EN3B 1A1NB 3OP2A 4LQFL 3GK0A 1MRAA 3HHSA 3RUGB 1GKRA 3MRMB 1H9DA 2WV3A 4F2MB 1KCRH 1M71A 3ULAB 3QPEA 4MKTA 4X5WA 1FG2A 3N2TA 4G9FB 1OAKH 3HNTL 3L54A 3BKYL 4OFCA 1UXLA 4U6HA 5DC2A 1S3HA 3KW7A 4PWIA 2OELA 3KWUA 2RJGA 3M7SA 4B9IA 5IHRA 1B4KA 2WKOA 3V0JA 3B43A 1N26A 1BQKA 2HVJB 4AHPA 3MYPA 1QEXA 2YXWA 3TBCA 3UJEA 4F1SA 3ONCA 4NO0A 2YQBA 4LLVB 2BX5A 1TZ9A 2E86A 3L12A 4WIQA 3Q65A 2IANE 4YVUA 1BZ9B 4PLKC 1QVOA 4UIOA 3TYFA 2GC4C 1SVZA 4OOZA 3WEMA 1DJQA 4ZO6A 2B77A 5BO1L 4PTUB 2Y85A 4UR8A 1YY9C 3ZLHA 3D08A 3MHZA 3OGRA 1EXHA 1GYVA 1TFHA 1O60A 5J13C 1EO5A 1ZP3A 1YMMA 3MJ8A 1JHLH 5LLIC 2WB5A 1CXIA 4X6EA 4Q74A 4IKJA 3HQNA 2DZVA 4QRBA 3ZO0A 3ZRSA 4CW1A 1AHMA 2LV4A 1BQCA 3R7RA 2QPSA 3GBML 5DZAA 3ALPA 2Z1SA 4FQ2L 4QWWC 1RMFH 4NZFA 4HCFA 3EOUA 3QNFA 4LGRB 1G0CA 1ULVA 5MENB 4GRSA 2OZ4A 1KGYE 4HK3N 3OJ2C 1NCCL 1AACA 4ZZKA 1IAKA 5JA9A 2JJTA 3RZWA 3AHZA 3B3DA 3IDNA 1HH9A 4FXGC 4YFDB 3WY1A 4DGIL 3CHCA 3H6AA 1Q2SA 4NKOA 2W65A 4R4NC 1LTDA 3K5SA 3HLAB 5H37G 1FRBA 1VESA 3G5WA 2AXGA 2WNZA 3CLMA 2BVOB 1WTLA 1G6CA 3ETTA 2F19H 2K3HA 1O0VA 3QUXA 3VG0H 3PPCA 3S97C 4Y5VB 3M4HA 4BK9A 3Q01A 2BG5A 3FDWA 5AL8A 2PDGA 2H3NB 1Q94A 1L3WA 2QVFB 1JR1A 3S1GA 1OANA 4UQ2A 3WUEA 1C93A 5DMIL 1SEBB 3DHUA 1SM3L 1GSKA 4Z2LA 4S2BA 4DN4H 1CF1A 1RLWA 3BKML 1LL1A 2YLHA 3W7EA 1LP9E 3WJLA 1M7PA 4AB4A 4HXBL 4LCCC 1BM3L 3DHFA 3RWJB 1K8YA 4WU7A 4AXKA 4TOYL 4IIGA 4S3KA 3ZKMC 5C0JB 3G6DL 1Q0EA 4P9HH 3NCWA 4M1RA 1VRXA 3D0VA 4HIEA 4EOUA 1J86A 3DV4B 4JG0L 3TW6A 4JZJA 3UACA 4WWKD 5EGRA 2QQNH 1S2CA 4FXJA 4NWTH 3FQWA 1A65A 4N8VG 4JO3H 4I1PA 1I0DA 4YHKL 3ATAA 4UFHA 4JZ5A 4P8QA 1HKLL 3OJVC 1PS3A 5BWAA 2VC2H 3KEHA 1KCVH 2KZ1B 4WZHA 4E3VA 5M94B 4C6IA 4Y19A 5E9XA 4XB7A 1GVFA 2VLJE 2A4ZA 3KTSA 1RZKC 2XX0A 2Q8LA 4G8EB 3LKRA 3TCLA 1RLCL 1KJ2L 1EDGA 3STEA 1P5UC 2CBQA 1A8JH 4FFVC 2CYGA 1NC2B 2DQTH 2UV8G 2DW5A 1IR1A 3VO0A 2X30A 3G1XA 5ABDE 1N8ZA 4AF0A 1CXFA 3QO1A 4PUWA 3THAA 1VLIA 4D6GA 4AW7A 4P46B 4R88A 5I6NA 4M03A 3EH5B 3ORWA 1EEQA 3EWZA 4ZTXA 5A7BA 1MCIA 2WWKO 2E74C 2EDBA 5FKAA 1PZUB 3UGEA 3IJYB 3F5JA 2OMXA 1TU2A 4KI5F 3REQB 5F7EH 1A5KC 2PLTA 43CAA 4AZUA 3KOWA 2HMCA 3BP5A 5FW6A 3GM8A 5F6HJ 5I06A 2YCJA 5DQDH 1MSPA 5DQJA 1QYGH 4AGOA 1MXSA 3FHQA 1R3LA 3G6JF 2E9LA 3CVBA 3LG3A 1LEIB 3UJ2A 3FTSA 2WOBA 4PJ8C 3H7RA 3F8UB 4R4BB 3PIQB 4KKCD 2PLKA 1ZLDA 2NR6A 3QMTA 5L0QC 3L3DB 3ZDZB 2H1PL 2ATPB 4N4YB 2YXXA 1U1UA 4FQXA 2CDGA 1PMYA 2XJKA 3VOJA 3MXWH 3KXFA 4KQ3H 2XHYA 5JQ6L 3HRZB 3OR7A 3E5PA 2R6OA 1TZZA 1H5YA 1R0MA 4L29A 1I8MB 1CDGA 4A2MA 5EO1B 1DHPA 3FHAA 4LALA 3UABA 1ZJHA 4I9TA 5D09A 2BVTA 3L4ZA 3SB3A 4DGVH 3AYVA 4NRXB 5C0ND 3BUTA 4XI5D 5ILTH 3H54A 4FQLL 3STZB 5EIIA 2ZZ1A 2PPEA 2V5CA 3BJSA 4W4QA 3QIBC 5F7MC 1KEML 1GCYA 3GI9H 5DD1H 5CC3A 4C5YA 5GRWA 3FO0L 2GJJA 2CLMA 3NSYA 3CPRA 4D9PA 2W1NA 1FZKA 2HMID 1TJ1A 5D37A 3MV9A 3PGCB 1XLHA 3CPGA 4GACA 3V5DA 4OGAD 5TE6H 4N28A 2F5AL 2L0DA 2AHIA 2OYMA 3QXAB 1ZHLB 4XMLL 4EKXA 5CC7A 2INEA 4NQUA 2QHRL 1YEGL 1EBAA 5D70L 2IH9A 1QR1A 1FWRA 4NVTA 4MX7A 3RDTC 3VFNB 3WJYA 1GYLA 3FQRA 3D18B 2J8UE 2JK5B 4CNIB 2ZJSH 1A5MC 4HB7A 4XAPA 4ZX3A 2CHWA 3VFVB 4LCQA 2W0UA 1D3GA 2YPLE 3UZ5A 1OM3L 4A6YL 4KWUA 3U6WA 5EYWA 3FEQA 3MCOA 1DBKL 4N42A 5HNNA 1AQHA 1YEHL 5JIPA 1ORSB 3EF4A 5AVUB 1M9SA 1NIEA 4D8LA 3UEQA 3M0MA 3NO3A 1VR6A 3QLDA 3NK4A 2VXSL 1KD0A 2EPLX 4K1WA 2CM5A 2HPOA 1Q6OA 1UB5A 2WWKT 3V55A 1DQQB 3U4FA 1S7VB 1MCPH 2AK4D 1NC4A 4ZUSB 4UTTC 4ADUA 1M7OA 3FHEA 3K8LA 1DR9A 1YCSA 4FAMA 4DNLA 1GOWA 4DW2L 2VLJD 3TM6A 4XMKL 1GHFH 3GSNL 5TTRA 3IU4L 4PTVA 3IAPA 4F7TB 4Z7WB 4H2HA 4PRHE 2WIIB 1RPKA 3TJHD 2QCDA 1ONQB 4L4VB 3CC5B 5CUSH 4C1NA 2VRAA 1DJIA 3APNA 3IDMA 3KHOA 3UXFA 5LXGL 5IB2A 4N8VA 1A7NL 4K39A 5CEXB 2ZF8A 4UM8B 4RA3A 3RLVA 1OW0A 3TKFA 4H1ZA 4XVTL 5IIEB 1Y1UA 5FYLL 2W9DL 4LFHG 4MNGE 4NPYB 1Y6NR 2PWGA 4JDEB 2ZXGA 4J6IA 3MJGX 2A74B 4BCXA 1KBGL 2V3GA 3I84A 2ICES 4ZFCA 1NA8A 1QCWA 1VFAB 1ADQH 2YAFA 1PBYA 4MMXC 2VDMH 4M9OA 1IEBB 3VI4E 1C91A 4O9HL 4IIEA 4BV1A 2A6DA 4XCCH 4G6KH 2HWZH 5JMOC 2CA3A 3UFYA 4WGXA 3LBMA 2ED9A 4QHKI 5GZNC 4QSFA 4WFGE 4JN2B 4LEXL 3FPYA 2NUXA 1IGCL 3WQWA 2XH0A 1YRRA 3QZWG 3ISIX 1KC7A 3HPFA 5TF0A 4MWAD 3S36L 4F0RA 3DTXB 3HI6H 3S0CA 3IWPA 4YO0A 5LKYA 5I1EH 2JJSA 3LN3A 5CEYB 1WZAA 3C5ZC 3MRKA 5ACLA 4A68A 4IJ3C 2CIIA 1YNYA 2Y36L 2ZUUA 3W11D 5F3HB 4E38A 4AD2A 1IC4H 1A0EA 4IQLA 4JREB 1NEYA 2X6MA 3L5XL 2NQZA 2A3CA 2R2EB 1KLFB 1FCUA 2IIJA 5I3DA 4WKZB 4BSVA 1RZPA 3TNBA 1NAKL 3WAJA 1K4HA 2NY3C 3DXAB 3HI1B 4H8WL 3LTYA 2FHBA 4G7VL 5CCKL 1S2TA 1X98A 4C55A 5AYUL 4HJ0C 3SCUA 1AK5A 2PR4L 1A6AB 3NZ8B 5IMKB 4TIMA 3UPAA 5CD5C 2P3ZA 2GYIA 5GS0D 1G69A 3AMKA 4HWNA 5KN5B 2XUWA 3V18A 1POJA 5D4HA 2NY4B 4JQXA 3TQVA 3EYQD 2NSMA 4U6VL 5IFJB 2NXYB 2AQVA 3WL9A 1JPGA 4YHLH 3TBSB 2JALA 1JGEA 4MJ2A 4DI9A 1UJTA 3VE0A 3UTOA 4F92B 4UOW1 2XBZA 4LVGA 3O3AA 1KLGB 1AY1L 1IC5H 4Z3GA 3F6IA 4TSAL 4X4ME 3T4AC 2AABL 1QEWA 4MJID 4QITA 3BQUA 1CYGA 3VFTA 1QKZL 2Q1EA 3AFLA 4DK3A 4EBQH 2G3NA 4U1LB 1JYVA 5JHLA 1F00I 1OLLA 1KFLA 3ALFA 4DZIA 4S0SD 3FCTB 2Q6ZA 1T99A 3WTTA 1P4IH 4ANKA 2IVFC 5CS7A 3CQJA 1QI0A 4B7LA 3R4DA 2A3AA 3EZJB 4F58H 1Q38A 3MBEB 1NCNA 4RMSA 5HJXA 1FA2A 4FLQA 3KWVA 2REQB 3QDGB 1NINA 1VFBB 4H01A 1LLAA 1UQSB 3ALWA 5TDNB 5SWZA 2VXUL 1AL8A 4D6JA 4GAYB 2ORBH 3ARFB 1KGXA 3KPOB 2VMFA 2C4XA 1UD6A 3MGOB 4WHYH 4Z5RA 5C5YA 1RZFL 1YDPA 3K1KC 4NJIA 4ADJA 4Q4SA 1ZHNA 1BFNA 4EACA 4MKSA 2D0FA 3P14A 3VWKC 1TJ0A 2VISB 5H2ZA 1IGMH 3SUWA 1E4KA 1B3VA 3E2VA 1JGIA 2XU2A 2OA9A 1N59B 2CJUL 2OKMA 4G59C 4ERAA 1P84K 4RRPG 2XG4A 2GY7B 4U3AA 4TNWK 1A3HA 5FCZA 2J79A 4HXAH 1F0LA 5T33L 5JBFA 4LGPB 4Q8BA 3W57A 1ND0B 1GTNA 4ZAKD 4NI8A 3G1VA 1ZV9A 3GHEL 4BH8B 2YLLA 1X1ZA 1RZJH 2WLYA 2QF7A 4UDUB 3EJUA 4BQ9A 3A3XA 5CGYD 3RWHB 4FIQA 4GKLA 4JL1A 5LWYL 1J93A 2R2CA 5I0XA 3P3RA 3DPDA 1C5CH 3ME0B 4H0GA 4NAEB 5I2IB 4P2VA 1FNSH 4UILH 4E0RA 2R59A 1XIWD 2ADJB 3VD2A 4G1EB 2R1WA 3U6XA 2W5FA 1E4MM 2A3EA 3SKNB 1BMWA 3L1OH 1XIFA 3I6LD 3AWFA 4MA7H 1F3EA 3KOYA 4ALAC 2POZA 3M8OL 4R9HA 1TITA 5HI4D 2CCVA 2E1WA 5I3KA 5FESA 5ERWA 2VAAA 3TNNA 4EI5C 4E0CA 5H8DA 3SQOL 1V7NH 2AXFA 2QAFA 1J5CA 1XF3B 4C54A 2DIBA 4GMTL 2AJ3B 4AQEA 4JDZB 2X0UA 2P3EA 1ES0A 3GXFA 4G1NA 1I7ZB 4A63A 3EOBB 3CAFA 1P53A 4WHDA 2EDKA 3EO9L 1FC1A 4ZPVA 2PF8A 3DI3B 3N6QA 5I8EB 1RUPH 3RQ3A 2NV1A 2AEIT 3AREA 2MKLC 5IK3B 3CEPA 3L6FB 1Q6FA 4Z18A 2WSRA 4QOKE 4JTCA 4LC6A 3SE4C 5LGYA 2P1FA 3U9PL 1XSKA 2IFFH 4PJAE 3WNKA 2ADYA 4AENB 4Z1BA 1A49A 2YD7A 4Y4FC 1JZ8A 3GUWA 3W1XA 4OZFB 5I07A 4NOFA 2OR2A 2C1OB 3SBRA 5MF5A 3L4WA 5LHFA 5EU3A 3BUVA 3UT0A 1AH4A 4EE9A 3I02A 1UJ3C 1A6PA 2GITB 3PZUA 3QVQA 2NNFA 1JF1A 1G9NC 5JUEL 5CMAB 4WTQA 4MAUH 1F3JA 2VN5A 2R91A 3PPGA 4DH2A 3KVQA 1YNLH 3U0HA 5B3SB 4ODHH 4DJFD 4ZXBC 4HMDA 1DIDA 3ELQA 2GOUA 1GKEA 4WAFA 5H4YA 1KGCE 5EMKA 5AW7B 3DDMA 3EFFA 3HPLA 5IM7A 5C2XA 1T4KB 2VR7A 2Z26A 1A7PH 1AJ7L 5C2CA 1XD0A 2ZCZA 2HWGA 5JDJA 3JWNE 1F4WH 4KWWA 4FI7A 4YNYB 3SGEI 4BZ1H 4N25A 1A66A 4BKTC 4FP1A 3PUEA 1UWAA 1F1AA 1JTOA 3ZZLA 2VJ8A 5IXEA 3MLSL 4JPSA 4PJEA 5IFPA 2FIRT 3GRIA 4NAJA 1E43A 3SDAB 1D8WA 5E03A 3RTQD 4LBEB 3U48A 1C5DB 3MRHB 2R2BB 5D7JB 2NVDA 3UFIA 4KCVA 4AIUA 2DL2A 2J13A 3DDGA 1RUKL 5ECGA 5IVXB 4FNTA 5F8RC 2N7AA 3P4OB 4KIRA 2HLAA 1JNNL 4QRSA 2BCMA 2F9RA 1I1FB 3FKUS 1TLMA 5GXBB 1F3DJ 3QLLA 3ARBA 4KK5D 2FVKA 1DQDH 4FQPA 2LVEA 4IGBA 1PHWA 4P2OD 4C83B 2HK0A 5J7CC 4Z23A 1CECA 7REQA 1XS2A 1OLZA 3ZQXA 4L0ZA 4OIFA 2NNRA 5A5WA 5FYJL 4D1IA 2VQ1A 2QGEA 5C9JA 4X22A 2WLLB 4U1JB 4AYID 4N86A 1S7UB 2B1HL 2FFIA 2HVNA 4PV9A 2HFEA 2WJ7A 3ABZA 2P24A 3HZYA 2QR6A 3ZT5A 3HGJA 5C0AB 4IXXA 2P5WB 1N0LB 1C7SA 3AFBA 3IGXA 1EJFA 5A95A 4L61A 4JKPL 4WSGA 3CVIH 4LYRA 1NIDA 3G5ZB 3THMH 4HK0B 4LRIA 5HHVH 3K80A 2JKSA 4Y2DD 3U2IA 3HE6C 2VEKA 5BJTA 4H7VA 2BHZA 1S9YB 3CZFB 5D1ZC 3WD5L 3TNMB 1HOCB 5FK9A 4IOSD 1J01A 4BE6A 2ATSA 2EO1A 1BIIB 1BQGA 1ZD6A 1PCSA 2R1MA 1GZGA 1DJYA 1DV7A 3LQAC 5C97A 3VW3L 1YPIA 2Z34A 1MRQA 3L5AA 4O14A 2HB0A 2CZEA 2XXMB 1YEIL 4JFDE 1CK0H 1KFEA 2RKXA 1MFCL 2QDDA 5D7IB 3GQFA 4RE2A 4XRCB 3NJNA 2EDMA 5I8CB 3MVTA 2XPKA 4IMFA 5AW9B 2ADFH 5F93C 3WQDA 4Y9NA 3SPIA 3SFWA 4H8HA 5DT7A 2FYYA 3W37A 3OF6A 3O16A 2ZZ4A 2JJWA 3TX9A 5IEHA 3Q9QA 2ZSVB 4M62L 4JQIL 1B0IA 2CGZA 1JDAA 4FX8A 3W7HA 1NAMA 2OT1A 1CF8L 4K73A 4W68A 1A4KA 3GFYA 4FZEH 1JPSH 1EJTC 2XZAH 2ICEB 3ILQD 1OO2A 4UR7A 5AYTA 3VFWA 4NUMA 4PJFB 3SCTA 3RVTD 3DX0A 1KIPA 4HNNA 4B90A 3O9NA 2HXAA 5E8OA 2K9FB 5T5FA 1FZMB 4KWVA 2Y5EA 3AISA 1IT9L 1T21A 2JVUA 1L0YA 2F6AA 4BK5A 1LM1A 3IYLW 3FW6A 2Q76A 2P44B 2UWEE 3UO8B 3O05A 4R7NA 3DECA 3HRPA 3TZVB 4XVUC 4TXVB 3WUWB 3QC0A 1S46A 1JCXA 4U1KA 3ABOA 4HJWA 5J6HA 1PY9A 5D7LA 1EWEA 1SOXA 2CKBB 3D9AL 3PTMA 2A9NH 1S2EA 3KYMB 3ZTJG 3QDMB 1D6VL 3O1NA 2AJYH 4E3TA 1EGJA 3LIZH 4XCYA 1V6UA 5B3JF 4MQ7B 4Y16A 1TYGA 3LNFA 2V17H 1E9IA 4NBZB 4EXAA 4O2EA 1XYAA 4XC1H 4PEEA 1QPKA 4H25A 4ABUA 5D2LF 4XNZC 3HAEB 4U3XA 3FUKA 1A6UH 1NEZB 1QUPA 4Q4OA 1V4YA 1FVCB 5G1TA 2J88L 3E2RA 4L8BB 2BFVH 2RH9A 2PTWA 3I6GB 4N26A 3WFBH 3TEYA 4CMHB 3G24A 2VDLB 3LXAA 3RMJA 4JFYA 4GI9A 12E8L 4DCQA 5EDXA 5HI5D 3I65A 3HIZA 3V0VA 2X4QA 2Y7SA 4KZEH 3AYSA 3ZZ1A 1HQ4A 3F1QA 3FNDA 1FWCC 2GDUA 3MR9B 4E8GA 3MLUH 4ZMXA 1JWMB 4DO6A 3CPLB 1YEFL 2PDLA 3B0XA 2A1WH 1O6IA 3WNPA 5KVEL 4K94C 3VXGA 1CGSH 2X2UA 3FQ4A 2JK2A 3BFQG 4AT6A 3HC4L 3ZMRA 3DURB 4JFEB 2FSDA 2HFGL 5DMYA 1PX3A 1I8KB 4KZCA 8RUCA 3GS4A 1BVNT 2EJ1A 5DI8A 3SBWC 2B31A 4Q6JA 2QIIA 3LIUA 3GUTA 2LW3A 3HTLX 2IADB 2DLTA 3C6LC 4AISA 1DEEA 3WD3A 1FY6A 5A8QA 4W7UA 1ZVNA 3VFMB 4I90A 5DJ0B 1OAZL 4WDIA 3ARDC 1DLHA 3LN5B 3PAZA 3CK0L 4XXDA 3DZ1A 5KSBE 25C8L 3AQYA 4PJGE 1U21A 4NP7A 2YUZA 2YR1A 3IGHX 2H4EA