1KBBA

Mechanistic analyses of catalysis in human pancreatic alpha-amylase: detailed kinetic and structural studies of mutants of three conserved carboxylic acids
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQAVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanistic analyses of catalysis in human pancreatic alpha-amylase: detailed kinetic and structural studies of mutants of three conserved carboxylic acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE, PANCREATIC
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kbbA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kbbA01
5ECUA 3SIMA 5ABFB 1Y7VA 1TMQA 4HOWA 4NF7A 4WKHA 2E8ZA 4D6GA 3UETA 5M17A 2WC7A 4EE9A 1BGGA 3BMWA 4CVWA 2DSVA 3N1AA 4HTYA 4GIAA 4ATWA 2G3NA 1GVIA 1YQ2A 1C7SA 2X2YA 1GQJA 1ISYA 1W3JA 3PHAA 1CIUA 3GXDA 3W38A 4AZ5A 2VCBA 1WE5A 4TVUA 1UA7A 3NUKA 1HIZA 1UWUA 4AD3A 1E0WA 3DC0A 2WVVB 5E0FA 4URIA 1VEOA 1V03A 1LWJA 1GOIA 3WDQA 1TVPA 4TUFA 2WB5A 4UFJA 3SCPA 1GJUA 4UQEA 2DSZA 5DO8A 4ZXOA 1BYAA 2UY2A 3VMOA 3TOPA 2FHCA 2D23A 2VRQA 3ZR5A 1R75A 2W63A 4OZOA 4DWSB 3NSNA 4LGXA 5KEZA 3FNDA 5ABGA 4TX8A 2X2JA 2W91A 1HJUA 2QF8A 3K8KA 2YLLA 1CDGA 3ECQA 3WDJA 1MQPA 3AISA 3VGBA 4U5KA 3ZJKA 3AIUA 1EHAA 1H11A 2WVSA 5AC4A 1CECA 3LPGA 3VNYA 2F7OA 1C92A 1KTBA 3UERA 1EDTA 3RPMA 2VZSA 2ZICA 4P7OA 1VEPA 2EO7A 1BHGA 3L4TA 3GNRA 5DF0A 4GQRA 3K4DA 4TTGA 3WDRA 1V6UA 4PCTA 3VIGA 3WQWA 3PN8A 3SUUA 4E8CA 2GK1A 3WNKA 3CZNA 1OIFA 1UH3A 1WPCA 3KE0A 3VD9A 1GQLA 3WF1A 3NDYA 3NJ3A 3ARQA 4MAZA 1VIWA 4HOZA 4NZJA 2J79A 1E55A 1G1YA 5A2AA 1UWRA 4RE3A 1OSEA 1QPKA 1KQYA 2G8ZA 1PEZA 1FFQA 1JAEA 1W9UA 1MFVA 2O9PA 4WKAA 2WWCA 4UQDA 1KWGA 3N11A 1MQQA 2ZE0A 1GOKA 1BG9A 3WIJA 2AAAA 2O92A 4AZHA 2VI0A 1MWOA 3LXAA 1TA3B 1V08A 1L0PA 1LF1A 4AW7A 1QNOA 4OBRA 4JFVA 5A95A 3UCQA 1ISXA 1E71M 2JF7A 1C93A 3F5LA 3ZT5A 3UR7A 1JI1A 2G3JA 1KCLA 1BGAA 1R47A 1DHKA 1KGUA 1MW1A 1TQWA 1HXKA 2CBVA 4UFIA 1E6ZA 4H8VA 2CETA 1BTCA 3VKKA 2PWDA 1W9VA 1LQ0A 5FOOA 2DIEA 1UWSA 1FA2A 3AMDA 1FH8A 2J8GA 3AS2A 3N18A 1QI5A 1EH9A 3AIQA 4A4AA 3BSHA 5HXMA 4QFUA 1E15A 3WUBA 2CITA 2VQUA 1MW2A 4LYPA 3GYCA 3II1A 3NCOA 3ARTA 2TAAA 3GXIA 1B3YA 3DX2A 1NP0A 1UWTA 2VL4A 2OLHA 4FNRA 1JG9A 1S46A 1R8LA 2DGAA 2PBGA 2F2HA 1V6WA 1J11A 3TV8A 3WNPA 4NZFA 4JKMA 3ZJ7A 2F61A 1C8YA 2GJXA 3IAPA 3QHNA 2YA0A 1J0IA 2XTKA 1UD2A 1PZ3A 1KQZA 4MJ4A 4JFTA 1OD0A 2X1IA 2WYSA 1WDPA 5EFDA 3PZMA 2XUCA 4MB1A 2J25A 3ZT7A 5DFAA 3OB8A 1BYCA 1VJZA 3SUWA 3UEQA 1EQPA 1E5NA 2J7EA 1TCMA 2D0FA 3MV11 4PTVA 1VRXA 3OA5A 3T2PA 4MB5A 4IPLA 4CKQA 1PJ9A 5JBDA 3CZLA 1PBGA 4HOXA 3L4ZA 4GI9A 1ZL1A 2RGLA 4B3LA 2V3EA 3VMNA 2VZTA 2OWWA 4JIEA 3D3AA 3ZSSA 2VR4A 2ZXBA 1DWHM 3PTQA 4CCCA 4N42A 1LL4A 4X0NA 4YHGA 3UR8A 4CU8A 1X6LA 1HVXA 1LLOA 5A6AA 5HDRA 1XSKA 4UOZA 3VGDA 5BYWA 5AYBA 3CO4A 3CHCA 4M1RA 4LQ1A 1E6PA 4DM1A 1SMDA 4AIEA 4ML4A 4B9YA 1EQCA 1QHPA 3EJUA 3DDFA 3LXBA 4HZ7A 1I1XA 4UTFA 3MANA 4PMUA 4JFWA 3GTNA 1XYZA 2X8RA 3W82A 2XN2A 1B90A 2NSXA 1BYBA 2A3BA 3WD4A 5IFPA 5A6BA 4D6EA 1H41A 2BV9A 1VAHA 1PX8A 5HNNA 4WF7A 5CQ1A 3BLKA 3WNOA 1DP0A 3W0KA 4KGLA 1HTYA 4PMXA 2WHMA 3TONA 4GI8A 3BVWA 1JFXA 1C91A 3CV5A 2Y4SA 3GXMA 4OBSA 3K1DA 4U2YA 3GH7A 2J77A 3RM8A 3CUIA 1Q6FA 3GH4A 5IHRA 1CYGA 2F7PA 4Z2LA 1UD8A 1EIBA 5FCZA 4OOUA 2VT0A 3D4YA 1B3VA 2ZUSA 2J7GA 4BF7A 1PPIA 1MXGA 2XIIA 5CGMA 1B3WA 3SUVA 2WVUA 3WEOA 1W32A 5A69A 1V3JA 4V28A 1NH6A 1CGYA 1C3FA 5E09A 4AMCA 4FNUA 3QOMA 1V6XA 4NRSA 5I24A 1MW3A 3WDIA 2WWDA 4ZXLA 3FW6A 1E0VA 4W84A 4CGTA 1XH1A 5D4YA 4D72A 1QWNA 3AS0A 1LJYA 1UQYA 1KTCA 4H8UA 3BVTA 5IDIA 5DMYA 4JHZA 2EAEA 1HP5A 4PTWA 3N13A 4M24A 1NOWA 3BUIA 2G4FA 3EJTA 1R33A 5E6ZA 2E9LA 1V3IA 3SCUA 4MDPA 2Z1SA 4UQAA 1E72M 4NXSA 4PN2A 2VVSA 3T2QA 3BUDA 4GO8A 3PZGA 5A8NA 2ZXQA 3VIMA 1OGGA 2UWFA 3BUBA 3VPLA 1CXIA 3QOKA 4M80A 4J3UA 4AEEA 3AXIA 3RM9A 3WQ4A 3W28A 2DSKA 2JALA 2O9OA 4MNKA 1XH2A 1F4HA 3A3HA 3AZRA 4PTXA 4CD6A 1E6XM 1E6QM 4W86A 5A3HA 1HF6A 2ZWZA 2DT3A 1LL6A 1E73M 1VFMA 4OOZA 3B9AA 2G41A 4WJXA 3B9DA 3ARPA 3POCA 1UR2A 1I75A 1E1FA 5CG0A 1AVAA 2RGMA 4D6DA 2NW0A 5I79A 1WDRA 2J78A 1Q6DA 2XFRA 1BPLB 3AQUA 3CH9A 4UFHA 4UOJA 3CZ8A 1J0KA 1C90A 3WH9A 3HG4A 2ZUVA 1J9YA 3O2LA 4AISA 4JFUA 2GFTA 1MYRA 1E0XA 4HMDA 5IHSA 3SUSA 1ZBKA 2WZIA 3WF4A 3VSVA 1KR1A 2EQDA 1NP2A 1E4LA 3A21A 1UR0A 3KL5A 4WIWA 3AMGA 3QHMA 1JYNA 2EPKX 4AYGA 4LYQA 3CUGA 3A47A 2G3IA 5FL1A 4WLCA 3AFBA 1BG4A 3CBWA 2D3NA 3D50A 1B9ZA 3EDJA 2VZVA 5I3DA 4JFSA 4GXPA 1U30A 1VFOA 1FHDA 4CUCA 2EACA 2WMIB 4BQ5A 1JZ2A 4AZ6A 3SCSA 1QNQA 4W7UA 3BUQA 2F1BA 1Q6GA 2EBNA 1E9LA 2EABA 2CEQA 5E9AA 3K4AA 1C7TA 3AHYA 4PMNA 3K8MA 1M53A 2A3HA 1QWUA 3I3DA 1JF5A 3DHPA 2VQTA 1CXLA 1H2JA 4DWSC 3CIVA 1JXJA 3LRKA 3AYRA 2X2HA 1B3XA 4J3VA 1CLXA 2J8FA 1R85A 1HP4A 4HA4A 3AIRA 4W5UA 2XN0A 3WNNA 4LX4A 2FGLA 4DM2A 4AEFA 1BQCA 4MAVA 4X9YA 2YDQA 3MUAA 2XVPA 2DEPA 2F18A 2YFOA 1WKYA 1V0MA 3RDKA 5GNZA 5FIPA 4QP0A 2DSUA 3MUIA 4M8UA 2WCAA 4CN6A 5LYRA 3EMCA 1R34A 3U7VA 5C8BB 1E40A 2GDUA 4MTVA 1O6IA 1EXPA 2BHZA 3VINA 5HBFA 1E4NA 1AMYA 3N17A 1GONA 5BRPA 4FMVA 2HISA 1ODUA 2DH2A 4L4PA 1D7FA 4HP5A 2XFYA 3D4ZA 4AD0A 1HJSA 4DUXA 1WDQA 3WUGA 2WKGA 1QW8A 3WF3A 2BHUA 2XM2A 3F5JA 3OLIA 5A6BD 4AZGA 3WMSA 5JBEA 3BLBA 1OWQA 2J75A 3KWXA 3KLLA 4XZBA 3VD7A 2XVGA 2DH3A 3M07A 3EJQA 4UQ9A 4JKLA 5M5DA 1GNXA 2XWEA 2XN1A 3T0DA 1V3HA 1QNRA 2OSYA 1I1WA 2Y24A 3MSGA 5D8ZA 4DUWA 3VIHA 4AXNA 4FK9A 1QBAA 2GDVA 1B31A 3SURA 1E70M 4J7RA 2EPOA 4M29A 3MMDA 5E6YA 2W61A 4OKDA 3AXXA 4AD1A 4H2CA 4OIFA 2C8NA 5AY7A 2BY3A 3KL0A 4MADA 3A5VA 2W66A 4GZEA 2QPSA 4B3KA 3UG4A 5CPTA 1E6SM 3WMBA 1W9PA 3FN9A 3VIKA 1R7OA 1OBAA 3WH8A 1L8NA 3LPFA 3T08A 1EA9C 3MMUA 3WD0A 1OM0A 5M03A 3O9NA 3VIOA 1CBGA 4MNJA 4MB4A 1W9BM 5D9PA 3MKKA 1ISWA 3LRLA 2EXOA 1H0GA 4PTMA 4NRRA 1WDSA 4P7NA 4B15A 3WQ5A 4U3AA 1HWWA 5IFTA 5BROA 1GORA 3WL1A 4HU8A 5C70A 5A8QA 2WMHA 2X0YA 3VGHA 1B30A 3BVXA 3RMEA 2ALWA 3WFLA 3WQVA 4DO5A 1K6AA 5FL0A 1WB0A 2VX4A 4AD5A 1HL9A 3GXPA 3L4VA 3OG2A 3AXHA 3VD4A 1W3LA 2YL6A 4M56A 2Q8XA 5JIPA 2B31A 4ZE5A 5ABEA 1CWYA 3WQ8A 1TA3A 4P8XA 1HNYA 3GM8A 3AIBA 1PAMA 4AMXA 1JDDA 3SCOA 5GNYA 4GZJA 4F66A 3D52A 2OW7A 2J4GA 3OGRA 3N12A 3WH6A 2YL5A 3LMYA 3WDPP 2WMJA 4AYSA 2BY1A 5CZKA 5E1QA 3S2CA 3DYMA 5CXPA 1FP9A 3VO0A 1XCWA 2X0HA 4H04A 1JD9A 1W9DM 1OIMA 4BCEA 3WF0A 3BH4A 5GPRA 2BFGA 4Z2KA 4PMYA 3M7SA 4PMZA 3WF2A 1VF8A 1G94A 2QV4A 4UZUA 3AMLA 2CESA 4AD4A 8A3HA 1H5VA 1WZMA 2VJXA 4NXKA 3BMVA 3EYPA 3H54A 2OW6A 2WCGA 4GINA 6TAAA 1W1VA 2WZEA 3AHTA 4U31A 2F7QA 3CHDA 3AROA 1XGZA 1T0OA 5BXSA 3PZUA 1VBRA 2EJ1A 4UR9A 4ZFMA 4AC1X 2AMGA 3VM5A 2J7DA 2XIBA 4JCMA 2CERA 2BVTA 4KRTA 4WKFA 4NZCA 1TQTA 3CHFA 2VCCA 1JYWA 5I77A 2A3AA 2DPEA 3BAXA 4DO6A 1UWIA 3VUPA 3TTYA 3T0AA 4W8AA 2F1AA 1WZAA 3TP4A 1HXJA 1V3MA 1NQ6A 1B0IA 3M6DA 3SCNA 3VIFA 4D6FA 1UKSA 1UA3A 5A6KA 4P7LA 1V0LA 2FHBA 1ZBCA 4DWSD 3WN6A 3BVUA 2WHLA 3RJXA 3KEHA 4IUGA 4PCSA 5AYIA 3ZR6A 1JZ8A 4D1JA 1A3HA 1EGZA 1ITXA 4QCEA 5I78A 3BVVA 1GPFA 2ZWYA 2ZIDA 4PMVA 4HMEA 1VJSA 4KRUA 4PRWA 5KZ6A 4N0RA 4RL3A 1QI0A 4HPHA 1W1YA 3PZQA 2OWXA 3EJRA 1CNVA 4FF5A 1ZU8A 4FNPA 1H0IA 4P8VA 4W5ZA 3VOCA 4KWUA 2ZUTA 3U5YA 3MV01 1JZ3A 4U33A 5GNXA 3AHZA 4V2XA 2ZX7A 3PZNA 3W6LA 2YJQA 4KMQA 3QR3A 1FH7A 1BYDA 2HVMA 5EBAA 2NT1A 4CVUA 1GQIA 2XJ7A 5A6SA 2PWHA 2E9MA 2V5DA 1G0CA 1QBBA 3D51A 1M04A 3SCWA 3QHOA 4D71A 2J7BA 3H53A 3RILA 2WHJA 1DWIM 4FLOA 3APGA 4U3CA 1E6RA 1SYTA 4J3WA 3NYDA 3W25A 4UFKA 3HU7A 3A24A 1GZJA 2WPGA 3EDFA 2WK2A 4IM4A 5EFFA 3OLEA 2GJPA 4ACZA 4PMDA 1W1PA 4A3YA 5CJ5A 2V3GA 2GK1B 3HJEA 5A2BA 2CBJA 3WBEA 1UASA 2WVVA 4AIOA 1PIFA 1FH9A 1EO5A 2BXYA 1KWKA 1HJVA 1NWRA 3VNZA 1QNPA 4P7QA 3AJ7A 3U7BA 3WEMA 2XM1A 4QDMA 2UY4A 3WY1A 2GUYA 1UR4A 4AZIA 4Z2HA 1KXTA 1KB3A 2EADA 5ABFA 3VU2A 1B1YA 2WW5A 1W91A 5I23A 5LA0A 4X0VA 5F7UA 1JZ4A 1UD4A 2PI6A 3BC9A 3ZJ8A 2QLYA 1VFUA 4HZ6A 3ZSTA 4PUDA 3WD3A 3AZSA 4W87A 2DT2A 3SCTA 3AMCA 3WY3A 1QI4A 1UHVA 1OB0A 1J01A 2VX6A 1KXHA 1EHNA 2XHYA 3ALFA 3WNLA 2J62A 3VIPA 2BNJA 1J12A 2DT1A 5BXPA 5E0CA 3KLKA 1TQUA 1PIGA 1P6WA 3WUEA 1UH2A 3BCDA 1XCXA 1C8QA 2ZXAA 5D8WA 1XHGA 2V5CA 1JAKA 4S3JA 4F9DA 4PMQA 2IGTA 1HVQA 1SFSA 3PZVA 3SCRA 1SR0A 3NIYA 2YL8A 4UQBA 3AMKA 1WZLA 1JYXA 3VD5A 2WMIA 2D1ZA 2D0GA 1VENA 3VIJA 3RM4A 2EPNA 1JI2A 2QHAA 3OIHA 3GH5A 3W37A 4Z2GA 4C7FA 3EJPA 3OGSA 5EMYA 4TVDA 1UZ1A 1NOFA 3LPOA 3AHVA 2J47A 3FHAA 2PWEA 1UKOA 4W85A 3MO4A 2JF6A 4UNIA 2QPUA 4ZE4A 1QOXA 1QI2A 1XD0A 2FGZA 5M3WA 1K9EA 3MU7A 2PWFA 3BGAA 3VD3A 1BVNP 4E4PA 4AD2A 1BVZA 1HJWA 1BF2A 2VRKA 4AWEA 4CCDA 2E8YA 4HA1A 5LA2A 1JZ6A 1RH9A 4M82A 2F7RA 3W4RA 5HPOA 3VDCA 3A23A 3L4UA 2J7HA 3UG3A 4UOQA 1CTNA 3N15A 4HPGA 4FLRA 3WL0A 3EDKA 3VX0A 4PMRA 1E3XA 2YLAA 1GJWA 2VOTA 4D6CA 1V0KA 2WMGA 4CD4A 4PUEA 1US3A 1FP8A 2FE0A 4WK9A 5A6JA 3ZIZA 3DDGA 5I2UA 1TG7A 4ATLA 1UWQA 1WP6A 4J3TA 1G01A 1M7XA 3NSMA 3J7HA 2Y5EA 1NM9A 3TA9A 5EB8A 5TD4A 1H1NA 1LWHA 1JNDA 3W6MA 1PX3A 1VB9A 1QVBA 2WC4A 3DYOA 4HA3A 2CBUA 3DX0A 5A6LA 4GQQA 2DIJA 4CD8A 4M81A 2CYGA 2PBOA 3AYSA 1X1NA 3W29A 3LPPA 4TVCA 1AQ0A 1MVYA 1XSJA 5E70A 1OGSA 3G6LA 1KCKA 1HJXA 1W2PA 1TUXA 2C0HA 4J27A 4H41A 1JZ5A 4D6HA 2OSWA 4YN5A 4U2ZA 3W53A 2BS9A 2ZX8A 3AIWA 3VTRA 1JGIA 1ZBVA 5A8PA 2VURA 2V3DA 3RO8A 3T0BA 2XPKA 2CBIA 3MUY1 1ESWA 1E4MM 1UG6A 2VZUA 5A94A 4K68A 4D6IA 3L2LA 5LA1A 4MPKA 3FHQA 3ARSA 1MFUA 1UH4A 2J7FA 2XSBA 3EBVA 3TTQA 1G9HA 3EMZA 4KH2A 4QAWA 5I5RA 3IANA 1V6YA 1DTUA 4JCLA 5A8OA 5A1AA 4OJYA 9CGTA 3B8SA 3RIKA 1EOKA 1JF6A 1J0ZA 4ATDA 2ZX9A 4BA0A 1IZKA 3WDHA 3VGEA 1W3KA 2VX7A 3T2OA 1KFWA 3FAXA 4OUEA 4WSKA 1LG1A 1WAWA 5CLWA 1EOMA 2DDXA 2D20A 3ALGA 3WENA 4W7VA 3DX3A 4W8LA 2BHYA 2O9TA 4F8XA 3WH5A 4MNMA 3ZJ6A 4B16A 1XV8A 1JD7A 3VDBA 3DX1A 3GBDA 3GNOA 4JAWA 2CCRA 3GDBA 3CZGA 2IXUA 1KXVA 3FXYA 4W89A 1E43A 1UQZA 2CXGA 4LYRA 2F8QA 3MMWA 3T09A 1G5AA 1UR8A 1B2YA 1Q6CA 3PZ9A 1CPUA 3WFZA 4TOQA 4AZ7A 2E40A 3THCA 3IJ7A 3VX1A 3M46A 1W2VA 4JL1A 1HJQA 1R7AA 3AHXA 4JL2A 3K46A 1UD5A 2D0HA 4CD5A 1KGXA 2VO5A 3U57A 3I3EA 3NDZA 1CXEA 2WLYA 1K9TA 3TTOA 4U5IA 2CKRA 2QMKA 5CLTA 1Q6EA 3GZAA 3HG3A 1J18A 1GHRA 4FLSA 1HKKA 5D9MA 5DT5A 1XD1A 3ZMRA 4DO4A 4UFLA 3EJSA 1W1TA 4RE4A 3ZOAA 4YHEA 4ZENA 1YHTA 4Q22A 3IJ8A 2X09A 2VMFA 1GOWA 1QHZA 1DWJM 2V38A 2BY2A 3WY2A 4B9ZA 2YFNA 5BCAA 3VGGA 1OD8A 3LRMA 2Y8VA 3WMCA 5I6SA 3AOFA 1MQRA 5IXEA 3ARZA 2ZUUA 3CZEA 2EPMX 3W27A 3L4XA 1UUQA 1PS3A 4H7VA 1JNEA 1E3ZA 3AS3A 3SCVA 2OYMA 1CENA 1XSIA 2EEXA 2CHOA 1BFNA 2YA1A 2WSKA 1HKMA 3SUTA 4XX6A 1ISVA 3SEPA 1E5JA 3GNPA 4GI6A 3MSDA 3IGUA 1DWGM 1H4PA 4A3HA 4H8HA 2GJXB 3W26A 5CSUA 5CSYA 4MB3A 4IPNB 2VCAA 2WLZA 1FHLA 3VDAA 1SMAA 4GO9A 1B3ZA 3MS8A 2VX5A 3AZTA 2WAGA 4E2OA 3A4WA 2YIHA 2XYLA 3CHEA 4J3XA 1Z32X 4P7RA 5A6MA 1RP8A 3BSGA 4QLLA 2X2IA 3OZPA 4W88A 1LG2A 2FH8A 2WCSA 4HMCA 3CUHA 2E3ZA 4ACZB 4NX0A 4FLQA 1CGUA 1GVYA 4W7WA 1ISZA 2X05A 1UKTA 3DECA 3BAWA 5JBFA 1H49A 3BAJA 1GOQA 1CGXA 1Q4NX 3AS1A 2D24A 2XVLA 2W67A 1QI3A 1V6VA 4XB3A 3VDHA 1QNSA 4BS0A 1TR1A 2WC3A 4XV0A 1XRVA 2VUYA 4JKKA 4FNQA 3TTSA 1EO7A 3GXFA 4FNTA 2PB1A 2DSWA 2UY3A 3THDA 4F79A 3BAKA 4PMOA 3ARYA 1TQSA 1TVNA 3LX9A 2FDMA 4LPCA 3BXWA 3ARUA 1VEMA 1RP9A 2BVDA 3ZO9A 3CMGA 3ZT6A 5A8MA 1PX4A 3W24A 3CPUA 1CEOA 3A6OA 4QLJA 4CN4A 1X6NA 4P8WA 1LL7A 1AQMA 1MXDA 2ZXDA 1CXHA 2XGIA 2WNWA 1C8XA 2WANA 3S6TA 3CUJA 5BWFA 2D73A 3S5ZA 4EK7A 1UYQA 1O7DC 5DEZA 3IK2A 3AIVA 2Y8KA 2PC8A 3VGFA 4FNSA 4MJ2A 4BQ4A 1DWAM 2CNCA 3D5HA 1DEDA 5DT7A 5FKYA 1CGTA 2W5FA 4TXEA 4W93A 1OGBA 2YOCA 4J3SA 1W3HA 1CZ1A 4UZSA 3KZSA 4D6JA 1HKIA 2D2OA 4E8DA 1ZJBA 2YA2A 2XSAA 4ACYA 1KBKA 4QLKA 4R27A 3VSUA 1VFFA 2AOSA 2O9RA 4XZWA 1M01A 2XVNA 2YDSA 2J74A 4AZCA 3ARWA 3HN3A 4CCEA 3ARXA 1ZBWA 3WNMA 1V0NA 2JE8A 1FFRA 5JIWA 1MW0A 2VR5A 4JZ5A 2GVYA 5HOSA 2PWGA 4MDOA 2VTFA 3BUPA 3WD1A 1KGWA 2JEPA 2GSJA 3B9EA 5I0DA 2EPLX 2Z1KA 2ZUWA 3UG5A 5CGTA 2BVYA 3WH7A 3WBAA 3PBGA 1F4AA 2NT0A 1WZKA 4TTUA 3O6AA 5D9NA 2ZX5A 1R87A 2VVNA 3PZIA 2W62A 2WZHA 3ARVA 2DT0A 2WKLA 1OCQA 1GUVA 1UD3A 3S5YA 4P8UA 3IAQA 1TE1A 1R46A 3POHA 4NI3A 3VIIA 3KL3A 3VM7A 3OGVA 3QGVA 2ESCA 3JUGA 3GBEA 3WUFA 2XWDA 4GKLA 2ZOXA 2WHKA 2WM0A 4C7DA 2YL9A 1U2YA 3CZSA 2E0PA 2VRJA 1GW1A 1UD6A 3OLGA 4CD7A 4L4OA 2VC9A 4HZ8A 1J0YA 3CUFA 1RD6A 3L4WA 2MANA 5JUVA 3VSTA 3N9KA 2WSPA 4W8BA 2IUZA 4UQCA 1HX0A 3PTMA 5CPQA 2CHNA 3H55A 1H3GA 3WY4A 2YDRA 1QW9A 3PTKA 1RPKA 2ZX6A 1R86A 4PEEA 1CGWA 1D2KA 3AICA 7TAAA 3AI0A 5GQBA 1EDGA 2WMKA 3DX4A 6CGTA 4AIUA 3WKZA 1TFVA 2WVTA 5BRQA 3DYPA 3E1F1 3PZOA 4AMWA 1JZ7A 2C7FA 1VBUA 3N04A 2JIWA 1UOKA 1NWUA 3CZJA 1CGVA 1W9XA 5D9OA 1KXQA 2E4TA 1U33A 3ZQ9A 1WCGA 4AZBA 3F5KA 4Q7NA 1JDCA 2W92A 1UKPA 4AZCB 1DWFM 2A3EA 2CPUA 4V27A 4HU0A 2VZOA 2D3LA 3WQ6A 3A4XA 4NSBA 3SCQA 3ZM8A 4PSRA 2E9BA 1E4IA 1CXKA 2ZUNA 1TZ7A 1JL8A 3WSUA 3GXNA 1CXFA 3BAYA 1PZ2A 1J10A 2UY5A 1GHSA 3CLWA 1JDAA 1XH0A 1D3CA 2YKKA 4YPJA 1A47A 3A22A 2WMFA 1IV8A 5FD0A 3HG5A 4DUVA 2XGBA 1E1EA 3CC1A 2JFEX 2XG9A 1CLVA 4C7GA 4PSPA 1K9DA 1ODZA 2PF0A 1WO2A 3MUZ1 1ZJAA 3RJYA 4UCFA 1FOBA 2OWCA 2WBKA 1GQKA 3VVGA 2A3CA 4XUYA 2BXZA 1HN1A 4IISA 4EAMA 1H09A 4LXFA 4S3KA 2GJRA 4OGZA 5CPSA 4EKJA 4RE2A 4CU6A 1OT2A 1JIBA 3VILA 3ARRA 2Y2WA 3CZKA 4ZEPA 3AIEA 4AY1A 1E56A 3RCNA 3HG2A 2FHFA 3F4VA 3PZTA 4WSJA 3LXCA 3OBAA 2JIEA 1TQVA 3K8LA 4CN1A 2OYKA 3OZOA 1NOUA 3CGTA 3U5UA 4GZIA 2JEQA 3I3BA 1NWTA 3WELA 1BSIA 3BCFA 3L4YA 2YBUA 1HT6A 1J0HA 6A3HA 4UFMA 2BY0A 2CKSA 1NARA 2D22A 1M03A 1XYFA 3OLDA 4CU7A 1UZ4A 1HL8A 4JHOA 5C71A 1ZB5A 1QX1A 2ZUMA 2VNCA 2XVKA 2WBGA 1JYVA 4D1IA 5BXRA 5AC5A 4PYSA 3W81A 1SZNA 3WD2A 2XFFA 1IZJA 1V3KA 3HMCA 2OSXA 4Z2JA 1BAGA 1IT0A 1KBBA 3GXTA 3MI6A 2CIPA 3L2MA 1QHOA 8CGTA 4TX6A 3WEZA 2YBTA 1E6NA 1UR1A 4PBGA 3VMPA 3HZ3A 1US2A 3A4AA 1EDQA 4DWSA 1J0JA 4BQ2A 2WXDM 1GOOA 1JFHA 4GPNA 1WNOA 1OT1A 3CMJA 2OYLA 5BXTA 1ITCA 1V3LA 2FYVA 3BLPX 4BQ3A 3CTTA 1UR9A 1V02E 1N82A 3EDEA 4R5EA 3NSXA 2V3FA 1HKJA 5HPCA 1V02A 4F9JA 1GOMA 7CGTA 1O7AA 4KGJA 1NWSA 1JXKA 1GCYA 3FAWA 4EANA 1UKQA 5ABHA 3BAIA 2IXVA 1K9FA 1ZS2A 3DHUA 4Z2IA 1BLIA 3EDDA 3IJ9A 2FH6A 3G6MA 7A3HA 2G3MA 3FY1A 2J7CA 1OINA 2QMJA 5A2CA 1ECEA 1KR0A 3EMQA 2W4XA 1XC6A 4MNLA 3UESA 2DQXA 1AQHA 4BZYA 4J28A 4Y7EA 4QCFA
chains in the Genus database with same CATH superfamily
3C08L 3FK3A 1SHXA 3SIMA 2BVQA 4U3HA 2EYSA 2DY2A 3QDMB 3DUSB 3OSVA 3GFUA 3MRFB 3UZQA 3V0EA 1YEYA 4AH2A 3ICJA 4RNJA 4NF7A 4H25B 1SJXA 4RBPH 3BURA 1NKRA 3FTWA 3HZVB 2WC7A 4WUKL 4A66A 4DK6A 4L65A 3NIDE 4UM8A 3D0VA 4Z3EA 1BGGA 1XCFA 2I9UA 1ZT1B 3BMWA 3UBGA 3V3WA 2XACC 3DVNA 3VI4E 1MCNA 5DRWA 2IQTA 2WZPA 4ATWA 1CYWA 5HYEA 3TJLA 4DJDC 4YSAA 3GZKA 2HVNA 1GSKA 2E3VA 3N9GH 3DV4A 5B7EA 3SOBH 4UC5A 1Z9SB 1H8NA 1FL3A 3NFNB 3VFTB 3C09C 5B39G 3TPUB 4H4NA 5AENA 1XIHA 3V18A 1ZJIA 3ZLGA 2NY7H 4HJUA 1RK0A 2W07A 1AQKL 4JS7A 4NQDD 4OCXL 4PYHA 4YHZH 1S5NA 3AYTA 1DE4A 1UB5A 2K4WA 1HIZA 3X1FA 3C0LA 2XQBL 1XGUA 4R97B 3KVQA 4BWLA 4XO7A 3LIUA 4LPXA 2DYPA 4FEZA 3A9IA 1G7LA 1H8SA 1VCAA 2BNQA 2Z35B 3HAEA 3DK0A 3I50H 1S5HB 3V52L 4DZ8B 3EOLA 3V95A 1X9UA 2Y1HA 4HA0A 2VO8A 2NNAB 4GYPA 4FN0A 4DELA 3ABSA 2WB5A 2HRPH 1L6WA 3OAUH 3NOEA 5L2KE 3OKLA 2A7BA 4PJIA 4YSQA 5DO8A 2YD7A 4U1IA 1JMXA 4MQTB 3FQWA 1P5VA 3RPBA 5I8CB 4LVDA 5AZ1A 5E9DD 5DZPA 3WH6A 4I5BA 2ADJA 3AQDA 1YEFH 4U1JA 1I60A 1QDSA 1XFBA 2VM4A 2UY2A 3J27A 3VMOA 4ZMQA 2RTTA 2REQA 1JGDB 4FZ8L 3QUZA 4K3EH 1RHHB 3GWJA 2KH2B 3GMMB 1RPQA 3SYCA 1EP1A 3W1TA 5J5DA 3QKZA 1YN6B 3ZR5A 5IFAH 2BX5A 4O2EA 4DKEH 1KFLA 2CIKA 4EI0A 1XIBA 4PJCA 3E6EA 4RR4A 5LQBL 3DENA 4YCOA 2APBA 4FYRA 2QHRH 1H60A 3QXTA 3B7RL 1NBZB 3OB0K 4O02L 2ZCHL 5F96H 1N6QL 2YCLB 3FNDA 3CE1A 3H2CA 4X5WA 3QDME 4X61A 4OGYL 4TX8A 1I9RL 1BZDA 3CDGB 5TQ0H 2Z1WA 2DBJA 5MENA 4BCYA 1L3WA 2RALA 2B59B 4TQIA 3ZN6A 1FVPA 1WQ5A 1OE1A 2YLLA 3K8KA 3HFTA 1XGRA 2H32H 3LZQA 1TETL 2X1TA 3HPSA 4DYKA 3TEUA 2DZUA 1FBIH 4JIPA 4MJHA 4E8GA 3VGBA 2OMZA 3NQFA 2ICEB 3VZYA 3TYDA 3ZQWA 3JV4A 1EHAA 2VLLA 4C4BA 2NNXA 1OC5A 5IQ9A 4ZD3H 3QQ3B 1FWSA 1CECA 4WDTA 3BKJH 3LPGA 4DNMA 2NQCA 3PDGA 4MWFB 4QNPE 1M2OA 4MJ6B 3QW3A 2V0TA 5DK3A 5IIEA 1TV8A 1WCQA 1KTBA 4RWYL 1EA0A 3KP0A 1ZT7B 4P7OA 1MJ8H 4X63A 3GMQA 3MGAA 4GXFA 3S8WA 3L4TA 3LN9A 2J72A 2YD8A 3VW3L 3MV8A 1GW9A 3K4DA 2GPZA 2NZ9C 2PO6B 4OZHE 2QIIA 4TQ8A 2XUWA 5J1TC 3VIGA 3C6LD 4Y2OA 3S6OA 1E5AA 4PJ8A 3PF3A 3W72A 4L37A 3QEHB 2W0UA 2XYCA 3MREB 3NCBB 5IGXL 2EKJA 5T5FA 2IPJA 1L5GA 3DRTA 1CL7L 2OTWA 1UH3A 1WPCA 1P5UC 2EUZA 4KK8C 1LM1A 3WF1A 3NDYA 4AAJA 5SWQB 1NCAH 1RZ8A 1S7RB 2P5EB 4FEIA 4LHUG 3VQMA 2NRDA 2QKIB 3L5XL 4OUUB 1VIWA 4HOZA 3VD1A 1R5IA 2N7AA 3WJLC 4GYKA 4RV3A 3MLWH 3BW3A 3DGGA 2BOCB 1K4HA 1QASA 3BKCL 4DP9X 1V93A 3K1GA 4AUBA 4P2QA 1JK8A 1K5NA 4LBAA 1OQXA 1PEZA 3NIGB 4N9CA 3G6AA 4H9MA 2A9MH 3MCG1 4NFBA 1CTOA 4HEMA 4DZBA 2O9PA 3PK7A 3VFWA 4XZBA 1KWGA 2J66A 2JXMB 3B7UX 1SO6A 4L29A 4M3JA 1VYPX 3VOJA 1XGUB 3I2CL 3ZRCC 1MQQA 3CPGA 3QAQA 4FXGA 3V6OC 4FQIL 1BG9A 1AZ2A 2BS8A 4PGEA 1LOLA 3SB0A 4C4KT 3ZHKA 1A6AB 4QMEA 1G9NL 5DRXA 5KYNA 3P2TA 1RULL 5ECGA 5GS3A 1A65A 2O92A 4LVAA 1NSNH 4EIUA 3LXAA 2SFPA 5TQ2L 1GYVA 1L0PA 1OCWH 2AEOA 2VDMH 1QNOA 2DUAA 3E0VA 2W0FB 3M0JA 2BSRB 4ELKB 3MSYA 3RRAA 4YJ5A 4NCC2 1E71M 5AAWA 1XGTB 3TZFA 3ISRA 4WIQA 5IEHB 3A13A 3FSTA 4PY8J 3ZL2A 4EZKA 4PJAE 3TEYA 1ZLSL 1BGAA 3GB6A 4JNZA 1R47A 1JFQH 2RA1A 4NRZA 1TQWA 4N9GB 4WQOA 5JPMA 2X12A 4QRUA 4YDKH 5DRNA 4HZLB 2CBVA 4UTAH 4G9DA 3Q6FA 3DG6A 3KLQA 5JPMB 3WLPA 1BTCA 4XP5L 2BP0A 3VKKA 2J6XA 4F7TB 4KPHL 2QEJA 3PS7A 3CC5A 1XLAA 2DIEA 5AZ0A 5FOOA 3OHMB 2IBZX 3WO3B 1OD9A 4JFED 2EH8H 4V1DA 1ZIAA 4Y2DC 5HGBB 1ODAA 3N18A 3T6CA 3R7QA 1G9MH 1QI5A 2Z7WA 1EH9A 2EDMA 1DBAH 2KKQA 4LSBA 3NZ8A 2YD3A 5FK9B 5T3ZE 5JW5A 4TMCA 2FIKB 3NAAL 3O07A 3CU7A 4QPEA 2FWSA 4QFUA 3MV8B 4KOCA 1CDJA 3BSZA 3GTHA 4JFDD 4FQLH 4M8VA 1T20A 2VQUA 4XR8C 2BNRB 3GYCA 1BXVA 3V52H 1ZCOA 5GSRA 3P4MA 4O5LL 4MZRA 3FSVA 5C0EB 3NP3A 3NCOA 4NUGH 5K9XA 1F8MA 4TNVF 3NQMA 1QRNB 1EXGA 2CLRB 4M7LH 4YNYB 1RZKC 1CJYA 4X60A 4PR5B 4MLIA 4NQEE 1XYBA 4LCIL 1KZYA 5FM5O 1L2UA 3TX9A 2HVOA 3HE6A 4ODTH 5DZOA 5G5DA 2XN9B 3IJ6A 1RALA 2OLHA 4FNRA 4ZPTB 2DQEL 1IGML 3PAVA 2E6JA 1FWTA 1X8CA 1UYWL 3EX4A 1ZTVA 3TV3L 4DKEL 2B0MA 3TIMA 2Z8VC 4BHYA 4JKMA 1Z0NA 5I16B 2E9WA 1FUNA 4J8RA 3IAPA 1C8YA 1LROA 3G24A 1J0IA 5FFLA 3X11B 3W1PA 1KEML 1UD2A 1PZ3A 3LG3A 3ELQA 3B0XA 1V55B 1KQZA 4PJEE 5DRZA 2J8OA 3D39D 4AV5A 1OD0A 3H0TB 1YPZA 2ZAIA 3WKNA 1YTDA 1E4XH 1YRKA 4HH9B 1KFCA 3B37A 1E42A 5I5JA 2X1IA 1FBIL 2GK2A 3MRJA 5K1NA 3LNHA 4LBRA 2VFGA 2XUCA 4MB1A 5EWIH 1IGYB 5IR1B 5CEWA 3CIAA 4XAZA 3OB8A 2A6KB 3L5LA 3TH2T 1OGPA 3BPNB 3R12A 1RK7A 2HN7A 4YHLL 5A16A 3SUWA 5TH2A 2J7EA 2HS8A 3F64A 1OKEA 2D0FA 1UT9A 2CIIB 1JPFB 2UXFA 4YDJA 2C3VB 3SBWC 4Q4OA 1WOAA 5FAJA 4EPDC 1EWHA 3VWKD 3T2PA 4NN5B 2FWOB 3OA5A 4FKEA 4MA1B 4WRHA 2ZVRA 4BHUI 1W72H 5H8DA 4HCLA 1AGFB 2WW8A 4DWHA 4HOXA 4X2RA 4JJ5B 3N85L 3IFNL 1WFMA 1Y0LA 4GKNB 2WUBH 2VZTA 1QTPA 2OWWA 3X13B 1G9NC 3BXNA 3CXDH 4IICA 3DGRA 2VR4A 3CFKB 3ZVHA 1LYQA 4PMEA 1PYWB 3D07A 4NT6B 5REQA 4LLMB 2ISFA 4X0NA 3MSRA 1XQKA 3UR2A 1TDQA 3I65A 3UR8A 4BK8A 4MCYB 4CU8A 1X6LA 4JPQA 1HVXA 1ZEAL 5A6AA 2WQRA 1HH6A 3DX8B 4ZAKD 5I0XA 3C6LC 2OMVB 5FYLH 4K3JL 4QG6A 5AYBA 1F13A 3CBRA 4JO5A 1E6OH 5GRUH 6REQA 5KS9E 4N68A 5IHZB 4ZMVA 1KBPA 2VXTH 4LQ1A 4KI1A 3W88A 3QV9A 5CBBA 1SMDA 2Y85A 4A35A 2GSGA 1H7OA 2ENJA 1S7TA 1FLRL 5E5MA 4ML4A 4D8LA 2Y6TE 2PYED 3MRIB 5E5CA 5FSEC 1QHPA 1TZOA 3LXBA 2BW5A 1UWEL 5EEXA 2ZP0T 2WSQA 5U7SA 2H7WA 3OJVC 4QD2E 1BXBA 4Y9EA 3JWOH 2HBXA 4QQUA 2J56A 4U7KA 4WFFE 5MEND 1H1ZA 4PMUA 3L81A 1O4UA 4S3GA 1EL3A 1J05A 1FNEB 1I3GL 4KMTL 3MPGA 4LARL 5LN8A 1OCWL 3HE7C 1N8OE 4BA8A 3MJ8A 3H7BA 3E6HB 4KZEL 3N1GC 3E8UL 3WTTA 2BIIA 5SWSE 4AGOA 3KVPA 1KKRA 4Y2NA 1AR1D 1LNUA 4A37A 4JJ5A 2CWXA 4NNBA 4HKBB 3R58A 3KYNB 4WF7A 1KNOA 4AENB 1J93A 5CQ1A 2FZDA 1CICB 2CKBH 1WCBB 3LSCA 4HJTA 5LGKA 1PEWA 4IHOB 4UUJA 3LZRA 3LMJL 3S5LA 1X97A 4PMXA 2VB5A 4IKKA 1KTLA 5ITFB 5HSFA 2KL6A 3B9KA 5AECA 2E6DA 3GAKA 4N8CL 2O5YL 1FWWA 4NUQA 2A77L 3CV5A 3RG1C 5IFJB 3N4FA 1HXYB 3PXLA 1AANA 1LDSA 4AZ8A 3AY4C 4DW2H 4J39A 3O9WA 3RM8A 2B2XH 3VWJB 2E28A 4G1NA 3BO8B 3PJNA 3TVMD 3B05A 4A2DA 3QV7A 5CMAB 1UD8A 1P7QA 4Z2LA 2X70B 1CZ8H 2YAEA 4S0TD 5CEZH 3D4YA 3BHBA 1OSPH 1LRNA 1GA2A 1R3TA 3ZMNA 2CO7B 4JY4A 3DJRA 4NKOA 4NAMA 3B2DC 4MCZB 5BXFB 4KO9A 5DEGB 2BSTA 1GGBL 3LNMA 4M6VA 2WVUA 3F85A 3T05A 2FX9H 1YLBB 4AH7A 3U30C 1W32A 5A69A 1I1YB 1V3JA 1MJJA 2BSDA 4ZO7A 2EVJA 3BYTA 1OXYA 2ARWA 4OCYL 2PS2A 1NH6A 3DHMA 4PV1C 1Q72H 1CGYA 3AUJA 4OVXA 4G2AA 3G5XA 1MUCA 1CFSB 2ICEC 1Q9WA 3MNMA 2BZDA 5EIQA 2X7WA 2JKNA 4JDEA 2X0SA 1MW3A 4NRSA 3WK1A 5EN3A 1XLMA 2Q87A 4Y5XB 2R29L 2NWSA 3GPSA 1H7NA 1I3RA 4PJDE 5D6DA 4JIRA 4AWSA 1DR9A 1BBDL 4L8BB 2VC2H 4OLYL 2MKWA 3SDXA 4ABVA 1E0VA 5LXXA 1AKJA 2W94A 5DJXA 4DKFL 4CGTA 3WTVA 2DQEH 3H8AA 2EUVA 2E1WA 5DY3A 2H90A 1MAML 2Q6WB 2HTKD 3R2GA 1JCJA 1XH1A 2VWEE 4HNLA 3K4ZA 4APQC 3TV3H 3AS0A 2BZ7A 3IU4H 3EIFA 4KRMB 2A3LA 3FCTA 1UQYA 1KTCA 3H4HA 1T4KB 2H6OA 3CSFA 4HBCL 4H8UA 4OTXH 3NJHA 4R26H 3BVTA 3U4AA 2B08A 2GIMA 4R7XA 4PUMA 3ATFA 1U2HA 4JHZA 4OLWL 3IXTB 3ZZQA 1RA5A 4FR6A 4ZQNA 3CVCA 1XB8A 2HWGA 4X4XB 1EAOA 1FORH 1XLDA 3N13A 3X12B 2BS71 1J9CT 1J5HA 3GF8A 1RHFA 4UAOB 3FB5A 3CIQA 3BUIA 3GSVA 3M1ZA 2G4FA 4IP5A 5E1GA 1M65A 1FCQA 5EO1A 1TJXA 3TR2A 1Z9OA 1IQDB 3BG3A 1KC7A 3HPJA 2OMAA 3PQYE 1QPNA 2EG8A 3SSZA 4UQAA 2VGBA 4I8DA 2DDQL 4NXSA 5EZLB 3T2QA 2P42B 3UMTA 3BUDA 2LU3A 2F6KA 3MRIA 2XU2A 1VBGA 3HIJA 3O06A 1DIDA 4E3TA 3S35X 4BKLB 1TV5A 3MJYA 4PY7A 1A8ZA 3DMMA 2ZXQA 3O2WH 1FZJA 1S78D 1IX2A 4L23A 4QGYA 2R9HC 5DJYA 1OGGA 3LMZA 3MCKA 1OADA 5ISZA 3CN1A 3QYSA 3FJ6A 2MOQA 4LSQH 2EVHA 3MLRH 5KSUB 4GW4A 4K07A 2VDNL 1DSYA 1U8KB 5J06A 1U3ZA 4RA3A 1J2WA 1D9KD 4OI7A 4HNCA 3WQ4A 4HJGA 1AZCA 4PJ9D 4IIQA 5ETUB 2ENSA 1DFXA 1FVCA 5B8CB 2Q8ZA 3L95A 1IGIH 3H9SB 2WUBL 3JR2A 3WLKX 1HOCA 4NC1E 3STLB 3BUYA 4MNKA 3B43A 5F1SA 1XH2A 4ABUA 1ZVNA 1F4HA 3A3HA 3KOYA 2IADB 2E7DA 3AWFA 2A73A 4QSFA 1SVDA 4W86A 2EIZB 4WFFD 5D96B 5MENE 2D2HA 1X5LA 2ZWZA 4YGVB 2MPAL 4ONGL 3TC9A 3WMQA 3Q2LA 1ZWIB 4DPBX 4XIAA 4IX2A 1UVQA 2ZXCA 3M86A 4PRAB 2DT3A 2GTQA 3W7EA 4REQB 4R7NA 3QCTH 3HQPA 4OOZA 5GRJH 4NP9A 3APTA 1WFUA 5IFHH 5AVNA 5KBLA 5F7YC 4FABL 3B9DA 1YEIH 3ARPA 1FWHC 5CKGA 4JIHA 3DWTA 3LN4B 5JIKA 1PF3A 3DSFH 2WO3B 5C0BB 2RGMA 4EPSA 1U8LB 5I79A 2OL3B 4OSUL 1O1HA 4AXWA 2J78A 4UMCA 5I2IB 1ILUA 1FNGA 1KGCE 2FATL 1S7UB 3QFJB 1BFOB 3T6XA 2K78A 1J0KA 3R0DA 3HG4A 3QORA 5HAOA 2J27A 2ZSWA 4XHJC 1HWHB 4DYJA 2A99A 2CJSA 3TTEA 2XNAA 3HLAA 1N10A 4WEEA 5I0VA 1TJMA 1K77A 1BVLB 2ZSWB 3MODL 5C2UB 2YQ3A 3LNDA 1UR0A 1DIKA 3KL5A 3KDNA 2WXIA 4UZGA 3QHMA 1NFAA 3JT2A 2CKBB 2EPKX 5D05A 4TTDD 3NGFA 1ZALA 4LYQA 4FDWA 5I1AA 3B8VA 1SPDA 5EU5B 4BSWA 1HEHC 4DEWA 3CUGA 2PR9A 3IWPA 4IIZA 2A21A 3QIBB 1FNAA 4G6ML 3WSQH 4MFHA 4GMSH 4DTGL 5FL1A 1Z5HA 3QNYB 4WLCA 3RE0A 3CMOL 4BFJA 2AKRB 3CBWA 3N41B 1L9NA 4A8LA 3TJPA 3EDJA 3RZCB 5HP5A 3BP7A 3Q65A 5I3DA 3P9MA 5EU4A 4GXPA 3QEQE 5HYSG 4R84A 4Q6IA 4FFWD 2EACA 3GBMH 2TRSA 2WMIB 4XH2A 4RVBA 4N0FA 1SEBA 4ADIA 1TU2B 2I5YL 4ZBCA 2GSIB 1JS4A 1R0MA 3BKYL 1BVKB 1PHWA 4R7JA 3VXMD 3QAZB 2HG0A 4FQCH 3VCLA 1EJXC 3FJNA 4OZGB 3CN2A 3KLAA 1H15B 3K4AA 5D70L 4IRJB 1OG0A 2CR0A 2X6VA 3LKNB 3UBHA 3MFFA 2BASA 1RY8A 4N8VA 5HGAA 5G2NA 2B4CL 4UNUA 3WLBB 2JGYA 3STLA 2YGOA 1KM5A 4K8RL 3ZTDC 1H2JA 2M83A 2J3SA 3CIVA 3P4OB 4I5BB 1JXJA 2VRAA 4U1JB 3S96B 4DOHE 1HL5A 2EE2A 5BZDA 4ZO8A 5J7CC 2VC2L 2NNCA 2W59A 1PLGH 4Y7OC 2YMXH 3QG7H 2IFFL 4U6HB 4F57H 5B1BB 4MSSA 1YYCA 1NUFA 1CLXA 1NBVH 5IJCC 1R85A 3W2LA 3CH1A 3F6LA 4OFKA 2FGWL 1HP4A 1NDYA 4HA4A 2X1XR 3FKUS 1YMYA 5JMUA 4KU1A 4A22A 4LX4A 2FGLA 3BW4A 4MCZA 5BXFA 4YXKH 2OXNA 1QABA 3TO4C 4O17A 4K9EL 4FERA 5IUSA 1J4EA 4HCIA 1NDMB 3DAQA 4E9QA 4AXWB 1V0MA 2AANA 4X6EB 5ECJE 5D09A 1UZ6F 3O4OC 5F3HB 2PDFA 5HMSA 5AAWC 1SOQA 4OZ4A 3RJQB 4S1QL 4EXAA 3RA7L 4QP0A 1FYTA 1HSAB 4I3RL 2V5TA 2FJSA 2OMWA 4LPYA 4AMAA 1G6RB 1CFTB 3RIFF 2WCAA 2VWSA 4Z8FH 4WV1C 3IFOB 2IMMA 4EUPH 1KM3A 3MP4A 2EVFA 3WS6A 3U7VA 4G7SB 5C8BB 5EMUA 4CMMA 4X6CA 1DBBL 4DRSA 1BYPA 1NBQA 4JQ4A 1CK0L 3IFOA 1O6IA 2BHZA 5FLUA 1RSCA 2JQZA 4AK1A 2LE9A 4X6CB 1C5DA 5CFAA 1JCNA 3PJSB 1E4NA 1GONA 1LP9F 3L3OB 2HX7A 4NKMA 3MXWH 1WV7T 1OLZA 4PM1A 5E2TH 5HI3D 2DZPA 4R9XA 5ACLA 2EZ0D 5CPLA 1ETZA 2Z34A 2F54B 4XPFH 2NSQA 5CU9A 2Y06H 2BERA 3HJZA 3PWPB 1Y18B 2DH2A 1D7FA 3ULSB 3ITYA 4NAFB 1A14L 4HP5A 3NIFE 3X12A 5KBKA 5D7SH 3JTBA 3KHQA 2XFYA 1MDRA 3H9HB 4E41B 1GK8A 1UW9A 4FO4A 4LFHG 4YHPA 5C08A 3AUOA 1BZQK 4QKXB 2A9BA 4ETYA 3L17A 3MX0A 4K94L 4LP4A 4Z7QE 4M4RB 2BHUA 5DGRA 2XM2A 3F5JA 4N22A 3HGRA 5CPOA 1JZHA 4P9MH 4R0LC 4L1DA 4P5MA 2YMTA 4LB3A 1ZVSB 1JZEA 2CR3A 4PIBA 3WMSA 5HVHB 2MPAH 4ONGH 3U6RB 5C0BE 1AOZA 1IAOB 3DVGA 2AQVA 5D6CB 3E9AA 3BLBA 4LEFA 4AY8A 3AW5A 3Q5TA 4RMWA 5C6TH 1AQDA 2DJUA 4CVXB 2OMUA 2R0LH 1T2JA 2R2HB 3KLLA 1NQBA 2ZG3A 4MJ6A 2LGNA 3IE9A 4OLXL 4OZIB 1A22B 1T1YA 4GEIA 4L9LA 4Y9FA 5I19L 2O26U 4C8XA 1XF2B 3LN5A 3SBRA 3AY4A 1G4PA 2EJAA 1RUQL 4B5XA 2C9PA 1CFQA 2X6MA 1H0DB 5M5DA 1R3HB 1HHGB 2Y36H 1MCQA 4H2HA 1U91A 4Y96A 1CDBA 1IGCH 3VCLB 2YYUA 4L9DA 3T0DA 4IP4A 4HN4A 3GKZA 2E9IA 1V3HA 4IGMA 2OSYA 3MV7E 5E8NA 2K6WA 1HKVA 4UT9A 4EBQH 3DFTA 1ASOA 2ITDA 2X1OA 4K8HA 3PSVA 4AXNA 3IJHA 3LQMA 3T9PA 1IBGL 2ZZ2A 2Z31A 1WVZA 3L6FA 1QD0A 1UXWB 4FX5A 4R2GC 3VE0A 2GDVA 1CICC 2VKXA 1W5QA 4XNDA 1E70M 2X1UA 2XH7A 4ZMTA 5FEPA 3SURA 1A6UL 2ANUA 1GYUA 2AZAA 4NDMA 5CD5C 3P3RA 1FFTB 2OZ3A 5E6YA 4ZUTB 1A4MA 4G6MH 4DTGH 4AD1A 1G6RL 2FB4H 3BPLC 4H2CA 5IBUB 2BY3A 4ZQKA 4UDTA 4LLVA 3U7WL 1UBSA 4M6UA 4MADA 1UWYA 3TBVB 1IC5H 1BVNT 2ZKXA 5EU7E 5DXXA 1AQDB 1EJUC 3OKLB 4IGSA 3KWSA 3LHTA 4D0DA 3LU2A 2D3JA 1W9PA 3FN9A 3E2QA 1R7OA 5K9KA 4F2UA 3BX7C 4JMNA 1BV8A 3H3PH 1A9BB 5T3ZH 3ZRFC 5L6UA 3GSUA 3O9NA 3JV5A 1QYGH 1MHPH 1G7MB 1YN7B 1CBGA 2ZZ6A 4ZFFA 4K7YA 1YKWA 1MWAH 2GKIA 5GSRB 3Q37A 2NQDA 3N14A 3DX9A 5D9SB 3QS3A 4WJ5B 3T2LA 4PWHA 5FOBA 4W9CC 4GX8A 1IEHA 5AB9A 4GVIA 3F7JA 3LRLA 4X7DC 2Q8AH 1AZVA 1WBXB 4QRSB 1H0GA 1HTIA 2NUXA 4HF5H 1F3WA 5I1IL 1SNRA 2ZPKH 1C5DB 2VSMB 4QRUB 4Z78B 3IGAB 4LL9A 2A74A 4Y16B 4CAGA 4N6QA 5D2NE 1MCFA 3WI9A 5C7XH 2WBJA 4X99A 1TLMA 4RDBA 5I02A 4HS8L 4R96B 3SE4A 4BK5A 1GPOL 2QQ6A 2ZADA 3P5ZA 2FJFA 5GS1C 1ICTA 5BROA 2CO6B 1K4CB 4AYMC 5C70A 2WMHA 5A6TC 3Q6FB 2BOCA 3GVQA 5HHMB 2H2SC 3KPLB 1BAFL 3UAJD 2FCBA 5DZ9A 3SE3A 4ELMF 5BUGA 1RZJH 4ONHB 4DO5A 4P4KD 4ECLA 1VYSX 5CCKH 4YSUA 4YLWA 5J0BA 3QFDA 4AC2A 1HILB 3F3HA 1TO3A 3TBSA 3L4VA 4B5WA 4NBXB 2KZWA 4N2DA 3QGAC 1F3JA 1GZPA 5F6IC 3OVUB 4ETQB 1LE9B 5KVFE 5CLZA 3GFXA 5JIPA 2FZ9A 4HHAA 1XT5A 5IZ7A 3QQ1A 4ZE5A 3STPA 3W1ZA 3WQ8A 1P1XA 4Q9BA 1SW0A 2WZMA 3V4BA 3EO1B 1KJ3H 2R69A 2GJJA 1HNYA 2YUVA 4CJ1A 1PFOA 1G0XA 4DJDA 1QZNA 5E1AB 2QVMA 1PAMA 1IO4C 1T4WA 4KQ0A 4AMXA 2X4UA 3LLDA 1V7NL 4M51A 1ND0B 4LRNL 5ADOH 1I0DA 4N1CA 4LBSA 4GZJA 2BLEA 3D52A 4L3ED 3DEQA 4ZX6A 4ELMB 1QRQA 3WJXA 1D5RA 5ALCL 2Q86B 2O6DA 1H9VA 2Y70A 4KX7A 4Z3GA 3WDPP 4N87A 2EH7H 3SQOL 2WMJA 4JTQA 4M0XA 4XZHA 5GVJA 3TNOA 3VCNA 4FJZA 1ERNA 2BY1A 4BK9A 5CZKA 1PJWA 2K1MA 4N3UA 5E1QA 3RF9A 1FH5H 1IBDA 3ULVF 1G1CA 3IVSA 1FP9A 4AL8H 1X1OA 2GPTA 4LASH 2XVBA 2G9HB 3HUJE 2X0HA 3DO3A 4H04A 5I06A 2PW1B 1OIMA 4DUOA 1TZGH 2ZCKL 2V9UA 1QUNB 1YY8B 4G80B 5D7JD 4M48H 3ZDXF 4FTVB 4W84A 3LKSB 3MRCB 5J56B 3OF6D 1XKYA 1WAAF 3M7SA 1HYSC 3L8QA 4BQ9A 2NW2A 3CFQA 4OQTH 2WINB 3C9NB 6PAZA 1KB5A 1NMAH 1TG8A 4GAJL 2QV4A 3WF2A 5F2GA 4CBZA 5I30L 3HURA 4RDYA 5EMLA 1DJSA 2A2QT 1D2OA 4IRSB 4XGZB 5HGDA 4OD1L 5FO8B 1KB5B 1H5VA 4DXKA 1ED3A 2RDTA 3ZK0A 3TIEA 3GHTA 2OFJA 3OZYA 3HS0C 2OW6A 2FQGA 4GINA 3ISWA 4YNYA 6TAAA 5HVFB 4P5UA 4D8PA 5EPDA 3RTQC 4U31A 3TIEB 5KVEL 1VERA 2TRYA 4NRYB 4FCHA 2F7QA 5IOBA 3UJSA 4NN7B 1TSRA 4JCWA 1EBPA 4YHIB 4H9UA 5T1KB 2FMNA 2VXVL 4KJYB 1QSFB 3PZUA 4ZFMA 3GY1A 5DCEA 2YGPA 3RQ3A 3H42H 4BQBA 1Q6OA 3VM5A 2QUMA 1IBGH 3BLDA 1QU4A 2OCZA 2CGZA 3LKOA 4PCNA 1PY4A 3TA3A 4KRTA 1ZGLB 1RA0A 4U6VL 2JWYA 4H9XA 2OMYA 1PZDA 1JYWA 5EY5A 2DICA 3ERPA 3V1HA 3EWZA 2G95A 2E7MA 4LEBA 4HAFA 2JCCE 2VMEA 4J1OA 3TC6A 2VR8A 2OG9A 3RX2A 4FTDA 1K2DB 1T41A 3SDCB 4J23A 4AZ8B 4JM2C 2DPEA 2JKWA 2BSSB 2X1WL 4M1GL 2WINA 3C9NA 3IETB 4XC3H 3X1EA 3T0AA 2COVD 1HZLA 2CA4A 4W8AA 4BUGA 2R7EA 5KANI 3DTXB 3CDZB 1RVFH 4R2GD 4TLUA 3ME3A 3NAVA 1FLRH 3GMNB 4I18C 4GXWA 3PPGA 4NT0A 2W9EH 1V3MA 1BQHA 1ND0A 2WUCH 1B0IA 1UWEH 3A3XA 1MJ7H 2LAAA 3M6DA 4KVNL 5E8NB 2X16A 3SCNA 1OAKL 3B5GA 4WWPA 2C71A 4DP7X 1NCIA 1PW3A 3PFRA 1MHPL 4S39A 1UENA 2L04A 4GP8B 2G5BB 5HA7A 1EK3A 2ZWNA 1T8QA 4QGCA 4AKQA 3GJEA 3WN6A 3JV6A 5IWLC 3ABZA 5FEBA 4DNHA 4HUUA 3BVUA 3K4WA 5CN2A 3RWHA 4LUJA 3EPMA 1UM6H 1YLVA 3KEHA 2VLKE 3FTGA 3EOEA 4E0CA 5AYIA 4XAKE 4FQJH 4G8FB 5DMIL 3FU7B 1E67A 2A4ZA 2J5LB 5D2LE 1JZ8A 5IROD 1EGZA 1ITXA 5I1IH 4QCEA 1QOPA 1G0YR 3X1NA 3BVVA 4G6AC 2KQNA 2WB7A 4F58H 4YHYB 5I75C 3DIPA 1E3FA 4G43A 2ZWYA 4B3VA 4KQNA 2XH2A 3VFNA 4QBXA 4PMVA 4GT0A 1WX0A 3NPZB 1OTUC 2BHFA 3HC0B 4G43B 4H7CA 2ZKYA 2XICA 2DTSA 1EEXA 1A2YA 2Q6ZA 3QPKA 4N0RA 4OF6A 5E6UB 4NL1A 3CFDB 1QLFB 4MMZB 4WJEA 3O6LL 4JTRA 4P57A 1A0DA 5CZTA 5FF3A 3W5NA 1JXFA 1XW8A 3EJRA 1BAFH 1A7QL 1V51A 4N9OB 4FNPA 3HG1A 4UQ2B 4PIRF 5MP6H 1X7QA 2H3DA 5LIKX 1RFDH 1XLEA 2WQAA 3TE9A 3AB0B 1ZV2A 4LIQH 2I1OA 5IK3B 3QZWB 5G4WA 3MV01 3K2IA 4NPYB 1B0GB 5FOJA 4CW1A 1GGBH 3NCJH 5FOBB 2JKPA 5GNXA 4AIXA 3WBWA 2H41A 1H7XA 3W2MA 2D7MA 3Q1SH 1FE8L 4WV1B 1JGEA 4GAAA 2B14A 5EFIA 3RL1B 3B8YA 1E4KC 2BIMA 3AJXA 3W6LA 1W0WB 3L45A 4QCIA 2O93L 1OARH 3T77B 1KJ3L 4K38A 1Y07A 3SO3B 3W2DL 5JDSB 3SCSA 3FO9B 1BFVL 1RI8A 3SIKA 2WBJB 4X99B 3MRHB 4PTUA 2YC1B 3WXVL 2PF6A 4LNRA 3DBNA 4IHBA 2XJ7A 3W7LA 4G7VH 4JQ3A 1FVEB 1UWGL 1B0RB 3QVAA 2E9MA 1QBBA 2V5DA 3PAUA 2D2CC 3D51A 4KRNA 1TJ1A 4L8SB 3SCWA 3TFCA 4F9PA 3QHOA 5AOKA 5EUKB 3H53A 1L6YA 4GQBA 5HUOA 5KETA 1OAXH 2CWRA 2L7JA 1IL1A 3GQFA 3QNFA 3SQOH 4FLOA 3ZZLA 1DWIM 3CSPA 3BIBX 1AODA 3UGEA 2X53A 3GDCA 1S3TC 4PJ6A 4UFKA 2V7HB 3IDNB 3RVVD 3N0AA 4P59L 4HIHA 3TBBA 3P0WA 1E27B 2N7BA 1GZJA 2WLKA 4MMWA 4JTGA 3VFRB 1EC8A 2ZCKH 2WPGA 3RUGA 3IGFA 2YUZA 3FO1B 3K2MC 1E65A 3BHBB 4N2IA 4I1RA 1J5IA 1L8PA 1FCCA 4OGAC 4HGXA 5FCUL 4HJEA 4OV5B 1OL0A 2GJPA 5F7EH 4P0DA 1MI5B 3HE6C 4PMDA 2F5BL 4YQXL 1F5ZA 2E6YA 3HPLA 2P44B 2NXYB 1UP3A 3HFFA 4HPOH 1URLA 1XF0A 4ZOCA 4JYEA 3ERXA 4UYPA 2X4PA 1H3WM 3QQDB 4G8GA 4BM7A 3C8FA 3DHDA 1KZQA 3APFA 1F4WH 2OJZL 2YEVB 3D69B 4ISVB 4JVWA 4M7ZB 4N4YB 5LGJA 1MNUL 4ZYKB 5IF0B 2CBJA 3QXUA 1PQZA 1UASA 4FIRA 3KOZA 2WYIA 2RHGA 4AIOA 5LKNA 4AYBA 5HJDA 2YPLD 1MCRA 4JRYB 2JF1A 4FQHA 4LAJH 1QNPA 4P7QA 1U58A 2VGIA 3FCSB 2E27H 1OW0C 4OAWB 3AAZA 3SPGA 4D3CH 1X4ZA 2CXKA 2XM1A 2IANA 4IIEA 3U7BA 2UY4A 1F42A 3MJ8B 3U9UB 3W74A 2VR7A 1UOZA 4G1EA 3RFZA 3NZ8B 4B0MB 1XSOA 4AZIA 1FWXA 1M7IB 3L7FB 1IKOP 5D2YA 4GCXA 1EXHA 4LO9A 3ET9F 2C79A 3ETTA 3XINA 1Z42A 2I5GA 1G7QB 1W91A 2UY6B 4YZFF 1QR1A 1U3JA 3H2PA 5I23A 3W22A 5LXEA 3CXHK 5LA0A 3SDAD 1S8DA 3B7TA 1JZ4A 3IIXA 3E9UA 3IJYB 2PI6A 3BC9A 1SXCA 2CDGB 1HS6A 3MJ6A 1W72B 1QKZL 2H3XC 3A67H 3O4LE 3ZY7A 3O45B 3ZSTA 5JQ6L 2QQKL 3C6SA 2VUNA 3UBPC 3WD3A 2V4LA 5D32A 5EZOH 1S9XA 3LHAA 4DN4H 4QXVA 4N2AA 3HC3H 3O45A 5AG9A 4WUUE 1J5OH 1HSBB 2AABL 2HJFA 8PAZA 3L3DB 5SWSD 5SWZA 2ODHA 3WE6A 1LMKA 2H32B 4PJ7F 3V5FA 3ARBA 4H88L 3E8VA 3GSRB 3OGOE 4LEQA 3EW3B 4KVNH 4P3DB 4DO7A 2DQMA 2CMRL 1UHVA 2IAMA 2JFCA 4PV8B 1KCUH 2VXQA 5DUJA 2L5HA 4HJFA 5CSZB 4RDWA 4H9VA 5DT1L 3WN5C 3VIPA 4PRBA 4LT9A 4GUFA 4ZL1A 1J12A 3RTQD 3CFKA 1P1VA 2IPKA 2IANB 3NSDA 4B7IA 5PAZA 2WIIA 1YECH 5E0CA 5E7FA 1PIGA 4Q8NA 3NEXA 3MN8A 4FQJL 1P6WA 5E6SB 2ZFAA 2P5WD 1Q94B 1CT8A 4OQVA 4RK8A 5M94B 2ITCB 3G0SA 5GS0D 1M1BA 3RVUC 5D2WA 5D7HA 3VXPB 4JPVL 2ZXAA 5BWAA 4O11A 5DX7A 2J5LC 2EDRA 4F9DA 4L61A 3B2MA 4TNGA 1ID2A 4YSPA 4EVNA 4GIOA 4PMQA 5FEXA 3QG6A 3V4VL 1HVQA 5G4HC 3LEYH 2XTLA 1A0CA 3NIYA 3SCRA 4KXZH 2Q3XA 3OG6B 4GBUA 2VLRE 3U4BH 3AMKA 4XWGL 1N70A 5GGVY 5J3HC 5CF3A 1D5ZA 3BH8B 3BZ5A 4I88A 5E08L 3EFOB 5EL1A 2JCCB 1MH5A 4J6RH 1SEBB 2G9KA 1MFMA 4CMHC 2E76C 4NN7C 3PHSA 3X2QB 1QZ1A 3PNUA 4N2YA 5DY2A 1TJGL 4OGXH 4GKZA 4YN3A 4HLEA 2QADB 3W76A 2ZZ1A 4B5NA 1GYLA 5I6XC 5MEOB 4GKZB 3OIHA 1JWMB 4NENA 2O56A 2HQAA 4TPRL 3FXGA 2JIXD 3C5SB 2CLVA 5EDSA 3KW3A 1S7UA 3QFJA 4OM1L 4F1SA 4OZHB 1IGTA 3LYRA 5EEZA 1UZ1A 2PW2B 4LAQL 4FQXD 4J2QA 2O5ZH 3ES6A 4BE6A 3BSZL 4BWTA 1JNJA 2Y7EA 5CAYB 2G2RB 2RACA 5F7KC 1G7JB 2E25A 2NTFA 1TEGA 4IBYA 4GG6F 1NBCA 2J47A 3MDWA 1A5FL 2DQGL 3F84A 4KXAA 4XBPA 2DRUA 5L4MA 2JJTC 3ALWA 4P46A 4F9LC 2OP4H 5KYXA 4OH2A 4W85A 2WTRB 3KS5A 4XNQA 3FDWA 4ZTEA 4N1HB 1I9IH 1X5JA 4K8RD 5T1MB 1KLFB 1VZGA 2QPUA 4E42B 5BV7C 1OAXL 5IROA 1XC4A 3MJMA 1QI2A 1XD0A 4NYYA 4AQ8C 3IXAB 2PXYA 4AV0A 1LT8A 4F92B 3W1LA 3B3BA 3EB3A 3MU7A 2C4XA 2EYTA 2PWFA 3IXTA 4PG2A 4ZOBA 4DVBA 1OY0A 4L5FE 2M1KA 1G9EA 3TJEH 1LHZA 1KCVH 1WFTA 7PTDA 1S5IH 3VD3A 5JTWA 3S0CA 1BVNP 2FSDA 1X5XA 2ZNWA 2FBJL 3LZNA 1SHWA 2WO4A 5DVPA 1BVZA 5MENB 1KD0A 3D3VE 1HJWA 2RHEA 2VRKA 2X9YA 4AWEA 3QUMA 5CSBA 3MRDB 1FYTD 2VELA 1C12B 4A3QA 2O1AA 5I66A 4PBEA 2E8YA 1IKNC 1W8NA 3H3KA 3VD0A 2A7PA 1XM3A 2GFBA 2V0AA 4QDGA 1F4YL 1FWRA 3MV7D 2EECA 5CILL 2GGGA 2OR2A 3J2PA 3EOTH 4M82A 2DW6A 3ARGC 3VDCA 2EIEA 1BWKA 1V4YA 2J7HA 2POTA 1RJYB 3HHMA 1T1YB 4L9LB 4KKXA 3QBUA 2H32A 1G6VK 3NSJA 1NGPH 3I6GB 4PJIB 3S46A 1D7BA 2DM2A 4OZHA 2R0WL 2VLRB 1OZTG 2UZYA 3LDBC 4G70B 3CX5J 2XZQH 3MCKB 1FN4B 4F8OA 2BSLA 3R5EA 1CL7I 1AMKA 3V6ZA 3GS4A 4GYFA 3EDKA 4ZQPA 1KF9B 5GS0H 2VWTA 2Z26A 3TC3A 3CQIA 5K39B 4UMSA 3MI2A 1QFEA 4UR8A 3A3YB 1VGEL 3DIDA 5LIYX 4CNPA 3VWJD 1A6WH 3HW7A 4D6CA 4IIQB 2WMGA 1AO7E 2R59A 2KI6A 4KKAD 3MCMA 1FP8A 5FYLE 4UWQB 2ZA2A 4NOFA 4XVJH 4CQCA 2GQHA 3OMAB 4ELKA 1H9DA 4PAZA 5EEUA 4L4VD 1DQVA 4TSBL 4NAFA 3DDGA 3AWEA 5I2UA 4H0HB 4HU4A 1RZKH 2YKLH 2B5IB 4IRZL 2R2EB 2XDFA 1X5KA 2PDQA 3VQ1C 3W1RA 1SZEA 3LM7A 4I4WA 2PUQT 3NACL 5DJ8B 1UWQA 4QDPA 1V8HA 4ATLA 4GOSA 4ANWA 4NN6B 1C5BL 3MSPA 4QSHA 1E9OA 1QKZH 3A67L 5K5YA 4JR5A 2IWEA 2JK2A 3RUBL 2BP8B 2AJUH 2WTPA 2WHVA 2QQKH 1CG9B 2WLLB 4N2BA 4Y4FB 2CO6A 5I1LA 5I1GL 2DY3A 2WC4A 5IBTL 5D5ME 3BJTA 4LVGA 4J6IA 2ACRA 2CBUA 4Z3TA 2C3GA 5FW8A 4PGCB 1QSEA 2Z93B 5A6LA 4RSVA 3TW6A 5GZOD 2MSPA 4XX1E 4E41E 1Q66A 3MRFA 1INEH 3KCOA 1MFDH 1ME7A 3KX6A 1PNDA 4DP8X 2VLRA 1R1CA 2NY5L 3I6KB 3LPPA 2VAAA 2EEAA 5F2LA 3SGJA 1OGSA 1ORSA 3G6LA 1IGCL 4ZFFB 3NOYA 3I75A 2I60H 5DMGD 4Y89A 1QWGA 5CZSA 1FVCB 4GG8A 4J27A 3UIYA 3B8TA 1DQLL 4HT1L 2C9UA 2XIDA 2NXHA 3NCFB 2OSWA 3RIAF 2ZZ4A 4I0PB 1RUML 1SFDA 2KDYA 4U4IA 4K7FA 4RGNE 2OO6A 3BD3A 2ZX8A 3FB5B 1W15A 5DCCA 1SZRA 4IGNA 3O3DA 2CRYA 4RMVA 1IR1A 4M3PA 1Z5LA 3SN1A 4X9BA 1ZBVA 1TITA 2E5EA 3V9CA 2BCKA 4HK3J 3N4EA 2XWXA 1NDWA 1TMHA 1HKLH 3S35H 4Y16C 2OL3H 1DQMH 5I9QC 2YS4A 2CBIA 2C9QA 4U6HA 5I71C 3UWEA 4HC1A 3RKPA 3N2BA 4UDTB 4DQWA 4GQPH 4MPKA 2FB4L 3ARSA 2XSBA 5AOIA 4HIPA 3V4VH 3TTQA 4GUJA 1PTAA 4F3HA 3GSNL 4QAWA 3L5HA 3WKMH 4P49A 4DESA 3KJ4C 2D4FA 4PG9A 4PJDA 4I18B 4XWGH 5FM5M 2PZNA 1E51A 1GZHC 4C55A 4ZZ9A 3FX4A 1BG1A 5A1AA 2B16A 4UYQA 2R0KH 3O8XC 3OKEB 4NS0A 5C9JB 3D0CA 3US0A 5D8JL 1TX0A 4XSLA 4IGHA 1F9CA 4OLUH 4WU5A 1NGXB 1XIDA 1YRRA 2PLCA 5LNWA 3LHYA 3K5SA 5HI3C 4C56A 4G8IB 3H9SD 2BMBA 4LCYB 3OTRA 4PA8A 1KGIA 1KYDA 4GO6B 1NY1A 4D2NA 2AW2A 2CIKB 2P8MB 4JY6A 1IZKA 7FABH 1YEGH 3N1PC 1W3KA 4Z6AT 5J4MA 5L88H 1ZLPA 2AL1A 2AKZA 4OUEA 5IQNA 4N6EA 4PB9L 3P9WB 4PYGA 4U4BA 4HF5L 2VC7A 1GTFA 1MCIA 4O00A 4NKIH 1T03H 4IUOA 3UPWA 4NO5A 3VXOA 1U2CA 4QEHA 3LKQA 3QIUB 5JW3H 5F1UA 1RKRA 4M1CC 4FG6C 5HY9A 3ALGA 3WENA 3EPOA 5E4EB 5FGSA 2HK0A 2HMIC 4FXKA 3DX3A 4W7VA 1CUOA 2BHYA 2QVTA 4LU5H 4U7MA 3JWOC 4Y2DB 4YAQA 5CPNA 1IAOA 3C5JA 3DVGB 2QCDA 2I7OA 5JR1L 3LCXA 1DUYA 3BJLA 2UVFA 2R2BA 3CAWA 1RUSA 1EIXA 3UTTA 3ZE0F 3LZ5A 4LDLB 1VPXA 4Y9BA 4N28A 3GNOA 4H0LC 3ITLA 4YVNA 2QGYA 3R43A 4JAWA 2A38A 1F73A 2ZRXA 1PB0A 4HPNA 3V75A 1YDOA 1KXVA 3PJTA 1V7ML 3M8OL 1NU5A 3NPVA 1E43A 3NOIA 2CCLA 1ZP3A 3T09A 2F8QA 4LIQE 3MMWA 3GTIA 3VI2A 4PGEB 1CFNA 4LT7A 1UR8A 5CFHA 1B2YA 1CBJA 2H47C 1PV8A 3D46A 3PZ9A 1CPUA 1FNSL 5DJ2A 5DI8A 3QZWG 4TOQA 4H9ZA 4GB9A 3ZUCA 2H26B 3THCA 3IJ7A 2X4NA 3SE9L 2WWMC 3MQTA 5T1JA 4MZ1A 5L6YL 2H26A 1FAIH 2QVIA 4JL1A 4GUHA 1P4BH 1NDZA 4OJDH 2NQ3A 3M0MA 1A49A 4MWAA 2APWA 3QSKB 2FDSA 4U1NB 4UNVA 3QFEA 3VGAC 4JDVB 1SXAA 5J6GB 1Q3NA 2O7QA 1WDAA 5L2JA 4MS6A 5DVMA 1R5IB 4OZIF 3U57A 1HCZA 2O5XH 4GQ9H 1OAYH 1CXEA 3RZWA 3S0PA 1R5VA 2BFVH 2B8OT 2RGSA 2QMKA 3LH2H 4R7LA 5AYYA 4JANA 4XVJL 4TX9A 4YPGA 5I73B 4XAPA 1U41A 3FUKA 3IPFA 4GRMB 3EG9A 4ZCWA 3T55A 5BRBA 4ZXBD 1WEJL 1XD1A 4HWBL 4IU3A 4LASL 1NFDF 4NT6A 3WN5B 3EJSA 2ESVA 1RUPL 2J21A 4AY0A 1SFLA 3KBJA 3LM3A 4UFLA 2J6EH 4X5RA 3U2IA 2A6DA 3ZOAA 4M93B 1KTNA 3RVWD 4H0IA 4YHEA 3ZDXB 4F3FB 3GWQA 1YHTA 2BNUB 1C5BH 2QSVA 1LT7A 1MZRA 5E4AA 5EOQH 1UOLA 4RZ4A 1V27A 3A4DA 4E0RB 2VMFA 3T8QA 5I6OA 1N7ML 4LNYA 5LHDA 4RRPA 1DWJM 4PUNA 2A6KA 4M7ZC 5E99L 4B9ZA 4B2DD 5L9FA 1AZNA 1CN4A 5EKYA 5MERA 3P4OA 3S96A 3ZDYE 5BCAA 2ISDA 1XGPB 1CE6B 5D1XA 4LB4A 1SJEA 1RLDA 1DJXA 5I00A 4MAYD 5IXEA 3B0UX 3ARZA 3ULUE 4QOKA 3RR1A 4HQQH 5HGDB 5FO8A 3LQAH 1FDYA 3Q2CA 2ZUUA 5DMJB 2DJ4A 4YVVA 5AUMA 5A16B 2EPMX 3ZLHA 2WYHA 4PLJC 5GGTA 4DOHB 4BKTC 4OF5A 1CR9H 2KUTA 2HWZH 2PETA 4H7VA 3T0VA 3FRPB 2PKDA 1N2RB 1KUMA 3FUMA 1RUAL 3MMEA 4J8QA 3U0PA 3K2GA 1IC4L 2VXVH 3DOIA 3EYSL 3EFFA 5JNYA 1CENA 3SCVA 3ZR4A 4FNLL 3VU1A 3SI9A 1F3TA 4WO0A 3EWYA 2FWOA 2XA8L 1XBZA 5C0IB 4WXZA 4R3SA 5HGGS 1T0MB 4XXWA 1DUZA 1WK0A 4G8AC 1A3QA 1HKMA 5I3FA 2XWCA 2R15A 2VDKB 1GL4B 3SEPA 3VFSB 2ISWA 4J3OG 4Z78A 1E5JA 4GI6A 3LK6A 3VFOA 4MAYC 3GPEA 2Y7LA 3O6FA 2PAJA 3MSDA 3DETC 4BR1A 4EXQA 5LHFA 1TOXA 4JZNB 1DWGM 4R9OA 2RH9A 4HFUL 2FQEA 2ESVD 4HEPA 4IK7A 4XVEA 3V7MA 1PG7W 2OK0L 1AIFB 4ZQKB 1M71B 2NQLA 4UT6L 2E7CA 1FV1A 1J88A 5G4NA 4IPNB 2WLZA 3NTCH 1I8IB 5AVXB 5XINA 3VDAA 4JYFA 1U8PB 1WA0X 4ABWA 1A3RL 3VOHA 1O5QA 2P53A 3NL6A 3MS8A 1MHHB 2BH0A 1WDWA 1VADA 3AZTA 1RK6A 2YIHA 3L1FA 2DVXA 1JUFB 3FQXA 3A3WA 2R0KL 2FWUA 3UTZA 4LLQA 5IMOA 2XYLA 4YSCA 2ZYFA 5ILTH 3WG6A 5A6MA 4QLJA 2VL5A 3NFPA 1F3JB 1A5NC 4O02B 1A5CA 3AALA 5D7JB 3H9HA 1LG2A 2HNHA 4KY1H 2FH8A 2ACUA 3KP1A 4N85A 3R11A 4JQ1A 3GKWL 4ACZB 3SQMA 4X5WB 4R0LB 4ZUVA 1UB3A 1KIRA 1S78C 1XIGA 3LN3A 3TNMA 3I6SA 4JGUA 4IIGA 4A3RA 4PGBA 4W7WA 1AD9B 1XL6A 3RWJB 3R6IA 1ISZA 4XCCH 2X05A 1EUTA 1B0RA 1A6ZA 3ARGA 3OX8B 1URZA 4NKIL 1T03L 3R10A 4NRZB 5EBWB 2OXHB 3T8XA 2VHLA 4A2HA 3VFSA 2FX8H 3ZYZA 5C0CE 1NCNA 1GOQA 5HK4A 1Q4NX 4QOKE 1D2PA 5IW1A 2PSNA 3AS1A 3LGEA 3S83A 4DF1A 3UYOD 3N41F 5AW1B 3QUYA 3FC8A 4C6MA 4A6YL 1J8RA 2XVLA 5I1DB 3L3OC 4C83B 2BB0A 1QNSA 5D1QB 2YYTA 4BINA 3HNTL 4X98B 1TR1A 2Q7NA 3HI5H 2WC3A 1UT1A 1WWWX 2FT6A 2AGJL 2WQDA 5IK3A 4XV0A 3SBFA 1SJHB 4GEJA 4JKKA 4FNQA 2I9EA 1EO7A 2PB1A 2D7PA 1MY5A 2DSWA 1IUZA 4A2FA 3GLZA 3D08A 2ZA3A 4BSVA 2NYYC 3DJZA 3LAFA 3MBED 2FVKA 4P5KB 3QWRD 5DD1L 3VI3F 1DBKL 3GIVA 1U8JB 3ULVD 1A02N 3D25B 1TJIL 2GGHA 3AT8A 1TTRA 2W65A 3ZDZE 1AKPA 1UADC 1EAPA 3GMRA 4ZUWA 3CLEL 2BVDA 1XXDC 3SE9H 4HYWA 4JQ2A 1BFVH 4HSCX 2HTMA 3CMGA 4YDNA 5A8MA 4O2FA 1DO5A 5D96C 3MV9A 4G9FD 1C1EH 4Y90A 5BO0D 2DWDB 1YDVA 1SPQA 2E5CA 3MTXA 1R2SA 2IW0A 9RUBA 4DGVH 4RZBA 1MXDA 2EDDA 1JK8B 3MLSL 2XGIA 3QMSA 4IG2B 2WNWA 3S6TA 5D2NB 2A0NA 4H6KA 5ITBH 4YDMA 5F44A 2GGEA 2VXQL 3N73A 1O7DC 3CK0H 3UZVB 3GUTB 4MF4A 4WK0B 1GHFL 3MRKB 4TR9A 1QLEL 4H6QA 1T40A 2WBXA 3QJHA 3HNSH 3VGFA 1XMWA 3KYMB 5F8QC 3IDGB 3QO1A 3ZYJA 4A6YA 3MJ7A 1YVLA 5T33H 3D5HA 2ZZ7A 3OVGA 1DBJL 4HGMA 5DT7A 1CGTA 5LDUA 4P61A 2PO6C 4O54A 2AK1L 1ZK9A 2ED8A 4R90L 3HI1B 5AVZB 4A2MA 2TSYA 3PUGA 4UBPC 3TXZA 5EH1A 1W8GA 2ERJC 1CZ1A 3KZSA 3NG3A 4XCFH 4GY1A 3HPAA 3KHDA 1HKIA 3MXVH 4K7PY 3MGTA 3MUGB 2HN7B 2O6CA 3O2DA 3FSAA 3RNKB 1P48A 4C57C 2YA2A 1VZWA 2OPJA 3FJ4A 3LBOA 1KBKA 4Y16D 2AAVA 3QJRB 4A7SA 2PP0A 4FS9A 4OCRL 4XZ9A 4Z7UF 1LP9A 4KFNA 1Q5MA 2V17L 4R27A 3C2VA 3ZGHA 2FLBT 2X40A 1DVFB 1J79A 4JHAH 1Q9WB 2PDHA 1IJ9A 2XVNA 3STEA 4Z7NB 4RMBA 2YDSA 5CO1A 1EEPA 5GJSH 1VFHA 4TSCL 1DE6A 4QWWD 4L4TE 1HEZA 1SYVB 3U2JA 3V0WL 5FJTA 3QORB 2P0OA 1G4TA 3ILQD 3CL6A 3ARWA 1UATA 3ESUF 4WEMB 5AG8A 2XA8H 3ARXA 3OKNA 4JB9H 4LSVH 4XAWL 1EJ8A 5D1QA 3BEVA 4B0MM 1P0NA 3L1OL 2VFIA 3WNMA 1V0NA 3DI0A 4P9HH 2JQMA 3CXFA 1ZSDB 4U1HB 3NQAA 3P14A 1YJDH 4LY4A 4WI3A 3SADA 2FK9A 2VZ1A 4P2RD 3C75A 1HAWA 3M5ZA 4Z7WA 4YTRA 5M2FX 5EA0H 2KC0A 1M6OA 4M1DH 4W9FC 5ISZD 3D3VB 4GQGA 2OA9A 3GLAA 1IFHL 4MDOA 2VTFA 3FRPG 3SGDH 1EAQA 3NZUA 1KLZA 2IMRA 3LB0A 4XPGH 5K7JA 1J8SA 3JWNE 3WD1A 2WXLA 3FOMB 1YDNA 4KT2A 3C60D 3ME0A 4IMEA 5E5UB 2Z6JA 2YCIX 1ZWIA 1UA6L 4F8LA 2BOBB 1RH8A 2JEPA 3TN3A 4PPTA 3B9EA 5E8PA 2V2TA 2FBRA 5DR5L 3FT4A 3VI4F 1D5IL 3N1FC 4Y19E 4BJHA 5HQEA 3BQUB 5CGTA 3W70A 4R7DB 3QWNA 4R4BA 1WXJA 2W07B 2E75C 1F4AA 2BSBA 5C0CD 2OKMA 4J1UA 1J05B 5CCZA 1ZS8B 4L6OA 4O1EA 4G5ZH 2OTUB 1Q9OB 5HANA 3SFKA 1E5ZA 1TTGA 3GKWH 3WE1A 1G7LB 1N3NA 2BNQB 3MYJA 1IWBA 4G56A 2C1PA 3S1VA 4CEUC 5KANG 5I2IA 4JN2B 5KJRL 2WZHA 2DJLA 1I85C 3P4NA 4DNLA 3N9SA 2PLMA 2ADIB 2ARJA 1HI6A 4O16A 3WQOA 3W11D 3ORJA 2Y7OA 3QI9A 1IM3B 2MRYA 1XQLA 1Z69A 3RWDB 3I7RA 2X0WA 4TVPH 4OLVH 3EKZA 1WS8A 1R46A 4GFTB 4PWJA 6REQB 1BVLA 2UY7A 3KL3A