1KBBA

Mechanistic analyses of catalysis in human pancreatic alpha-amylase: detailed kinetic and structural studies of mutants of three conserved carboxylic acids
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQAVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE, PANCREATIC
publication title Mechanistic analyses of catalysis in human pancreatic alpha-amylase: detailed kinetic and structural studies of mutants of three conserved carboxylic acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kbbA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kbbA01
3L4UA 3N12A 2ZX6A 2XUCA 1HJUA 3M07A 4AIEA 1E0VA 2XIBA 1HL8A 3VVGA 1UQYA 2CERA 1OT2A 4UOQA 3WY1A 3PN8A 4HMDA 3EYPA 5BRPA 2VRKA 4UFKA 1KCLA 4F9JA 5HDRA 1GQKA 3UG3A 4P7RA 6TAAA 1QI4A 4E2OA 5GQBA 2HVMA 2X8RA 5M17A 1J0YA 5DO8A 4QLKA 2D0HA 2AOSA 1B90A 4Z2KA 7CGTA 3ARUA 2WVTA 2CKSA 1UD6A 2DSUA 4C7FA 4EANA 4UZUA 3MMUA 5A8MA 2J4GA 2D1ZA 3MS8A 1XSJA 1JZ4A 2X2IA 2D20A 2XVNA 5I5RA 4NZJA 2XTKA 2V3DA 4DO5A 2Y8VA 1DWHM 2QPUA 1LG1A 3OZOA 1TUXA 3H53A 1CWYA 4U2YA 1DWJM 3A3HA 5JBDA 3VO0A 1GOWA 5GNZA 3K8KA 4YN5A 3FY1A 3G6MA 3WH7A 4Z2HA 4MB1A 4JL1A 3WMBA 2E9MA 3SCTA 3ZOAA 1ISXA 3CZNA 1CGXA 3AOFA 4DUWA 3AIBA 1MXDA 4S3JA 1E73M 4P7QA 3AYRA 3CUFA 3RILA 1GOIA 2RGLA 5E1QA 3DDFA 2ZUWA 4P8VA 3O9NA 1U33A 4HA4A 4ACYA 4M80A 3BXWA 2ZX8A 3PTMA 4AD4A 2JF6A 3EDFA 1EA9C 1R47A 3BAYA 1H2JA 1G1YA 3SUVA 2XSBA 4AZCB 1VJZA 1E15A 4JFVA 2FHBA 2VVNA 1EO5A 1R34A 4QFUA 3VDCA 4UQEA 3D50A 3VM7A 2WAGA 1K9DA 1M53A 3WDPP 3PZVA 4UNIA 3BVXA 3VU2A 3W24A 4OJYA 2GK1B 2J7GA 3W37A 1JI2A 1ZBWA 1WPCA 1CGUA 3WDIA 4IPNB 1BLIA 4NF7A 4A4AA 1G0CA 3GXNA 3HG2A 1UKSA 1Z32X 2GJPA 5FL1A 3DX2A 1JZ7A 4FF5A 2XFYA 1DWFM 4H8VA 1E4IA 1FP8A 1QW8A 2EEXA 1UR4A 2G3MA 1UR1A 1CGWA 3BCFA 4AD3A 2WZIA 1O7DC 4TVCA 3BAIA 4J3TA 4TVDA 1A47A 5HBFA 3EJRA 5BXPA 5A6KA 4NXKA 5F7UA 3VPLA 1XH2A 1IZKA 3WH5A 2Y5EA 1LL7A 5DEZA 3N04A 3VGGA 2E40A 3WNPA 4WIWA 4EE9A 1EHAA 4AYGA 4JIEA 4HOZA 3IAPA 1CZ1A 3VGHA 3AJ7A 1GOQA 3BC9A 1UASA 2J62A 4CN1A 2YOCA 1E6ZA 3UERA 2DDXA 1JXJA 2ZX5A 1UR2A 2CEQA 1W3HA 3L4YA 2X09A 1K9FA 4HPGA 1WP6A 4WKAA 1Q6FA 2F7OA 1S46A 5EMYA 5CLWA 4OZOA 3WEMA 3UESA 1Q6GA 4AZCA 2ZE0A 1E9LA 2WHMA 3O6AA 4WF7A 5IXEA 1W32A 3WQ4A 1C93A 4H2CA 2XM1A 4NX0A 1OD0A 1QHOA 1G5AA 1I1XA 4UTFA 2DSVA 4M1RA 3NYDA 1D2KA 3WNOA 2BVYA 3PBGA 1GPFA 4F66A 3VX0A 4AZ5A 3U7BA 1TA3B 1UOKA 3U5YA 1E6QM 3D4ZA 2WLYA 5TD4A 3I3BA 1TMQA 5HPCA 1MW3A 1C8YA 4IPLA 1JD9A 2ZUUA 1KQYA 2RGMA 3K1DA 3PTKA 1HJVA 2NSXA 4E4PA 2EACA 4AISA 3OB8A 1NP2A 4LXFA 3U7VA 1JZ5A 1SZNA 5A8QA 2F18A 2GVYA 1NARA 4W5ZA 1QHZA 4JCMA 2CCRA 4DUXA 4W85A 1V3HA 2D23A 2VL4A 3VD3A 1UD3A 2BXYA 4YPJA 2EO7A 3SCPA 1EOKA 5IHSA 4MB5A 3OA5A 5JIPA 1ESWA 4P8XA 4W7WA 3HG3A 3WH8A 1DTUA 2PBOA 3CZ8A 3WL1A 3D5HA 1W9XA 4HPHA 3W27A 4CD7A 1CXEA 2J8FA 1EDGA 2JFEX 2VCCA 1Q6EA 1MW1A 3ZSSA 2YL9A 1OIFA 2WM0A 3IAQA 1E3XA 4PMYA 5BROA 3WENA 3GNRA 4EK7A 1E4MM 4GZIA 4PUDA 2CHNA 2VTFA 1JYWA 2CBIA 4DWSC 1E1FA 4PSPA 1NOWA 4JHZA 3WUBA 1ISZA 1BYDA 1QNQA 3BAJA 2X2YA 3RPMA 3UG5A 4M29A 4PTWA 2CNCA 1QNPA 4PMUA 4CGTA 4UOZA 1TCMA 1FFRA 4CVWA 1KGUA 1GOMA 2XG9A 3QR3A 5JBEA 2ZWZA 1QWNA 1W1PA 5IFPA 5CSUA 2PWGA 2GJRA 1EXPA 2WHKA 4QAWA 3GZAA 4ACZA 4JFUA 4MB3A 1R86A 5A6BA 1AMYA 5FD0A 2F61A 4QLLA 2XGIA 4CCCA 2CESA 2D0GA 3O2LA 3TONA 3DYMA 4PMXA 4BCEA 1EH9A 2Y4SA 4PSRA 2VR4A 4UQ9A 1XH0A 1GHRA 1G94A 2J7HA 3KLKA 2VRJA 3CTTA 1IZJA 4GKLA 2IXUA 4D6HA 1J10A 4KMQA 5A2BA 4GPNA 2X2JA 1IT0A 3WD0A 5I23A 4HU8A 2YBUA 2WMGA 4TUFA 1NM9A 4JL2A 2EPLX 1CXFA 1BPLB 1NQ6A 3RM9A 3WELA 3CMGA 2WANA 5I3DA 3GXFA 3TV8A 2O9RA 3L4WA 2W67A 3LRMA 1UD4A 1TZ7A 3WQWA 3W82A 3ZR5A 2ZUTA 4CD6A 3HN3A 1E55A 4ZXOA 1B9ZA 1XCXA 1V0LA 4ZENA 3A23A 5FIPA 3EJPA 3VGDA 3JUGA 1HP5A 1JNEA 2GSJA 3W29A 1ODUA 3VIKA 3AISA 4TX6A 3CUHA 1OD8A 1UA7A 3LRLA 2GDVA 3TTOA 3WF3A 5JBFA 3WUGA 5C71A 1BYAA 1J18A 3VNYA 4ATLA 1PEZA 5M03A 2BVDA 1ISYA 4GZJA 1ZJBA 2ZUSA 1R46A 3WY4A 5IHRA 4UZSA 2WB5A 1UZ4A 5BCAA 1ITXA 1JZ6A 1JYVA 2GFTA 3BLBA 4WSKA 1KFWA 2C0HA 2WHLA 4D72A 4W86A 4Y7EA 3N11A 1X6LA 1FH8A 2CHOA 2XWEA 2J25A 4A3YA 3D3AA 5I79A 2VJXA 1DWIM 4PMQA 2ZWYA 4WSJA 3T0BA 2JALA 4B9YA 2BY0A 2OWXA 3MANA 4PTVA 1V6WA 3WH9A 5CPTA 4FLRA 1GVYA 4AIUA 3KEHA 3LX9A 4M24A 2ZUVA 4NRRA 1XD0A 3MV01 3N18A 4F9DA 3HJEA 3ZT6A 1M04A 4U3CA 1HVXA 4DO6A 2WW5A 5AC4A 3ZJ6A 3WDQA 1W9DM 2VQUA 5A95A 1UUQA 2Y24A 3AS2A 2XVGA 4D6JA 3WBEA 1UWSA 3CIVA 4V27A 1ZBKA 2YBTA 5A8OA 4PN2A 4KGJA 1H4PA 2WVSA 1CNVA 2VX4A 2EPKX 3BAXA 3A22A 1PZ2A 2VMFA 3DDGA 1KQZA 2E9LA 3BUDA 3T2QA 3VTRA 4PEEA 4AZHA 1JAKA 3SUUA 1PJ9A 3CC1A 3AZTA 1NWRA 2VZOA 5CSYA 3AMCA 1JF5A 3UR7A 2XN2A 2F8QA 3LRKA 1JNDA 2PWHA 3VDHA 1JF6A 2VZTA 3LXAA 2C8NA 4W8LA 3SCUA 3EJUA 1WZAA 2ALWA 1UWTA 4AWEA 1UQZA 3OGSA 1PIGA 5DT5A 3MMWA 2EJ1A 3CHCA 2EPNA 2D2OA 5A2AA 2V38A 4D1IA 1E1EA 3AQUA 4PUEA 4CN6A 4B16A 1RPKA 6A3HA 5E0FA 4S3KA 3W0KA 1BHGA 3ARZA 3OZPA 1GONA 4OBSA 2WMJA 2X0HA 1JD7A 2Q8XA 2W63A 2YKKA 4Z2LA 5LA1A 1CLXA 4D6CA 2DH2A 2CYGA 3GH5A 3WEOA 5D9PA 1W1TA 1HNYA 3A4AA 3CUIA 1W1VA 1KWGA 5CGMA 5I6SA 3EDEA 4JFTA 1GJUA 4P8WA 3KE0A 3VIMA 1GOKA 3VIHA 3AHZA 2WCSA 1DEDA 3WNNA 3GXIA 1LQ0A 2XYLA 4OUEA 2BS9A 2J7DA 1KBBA 2ZXBA 3GBEA 1PZ3A 4W5UA 2XN1A 3D4YA 1H0GA 3ALFA 1DWAM 4AMWA 1JG9A 1QX1A 3GXDA 1E0WA 1E6XM 3VKKA 3DC0A 1E43A 1PAMA 3W25A 1G9HA 3NDYA 2J75A 4CCEA 4OGZA 4CU6A 1WDSA 3ZJ8A 3AXIA 3A4WA 1UR0A 3AZSA 1VAHA 2J7FA 3FAWA 1VFFA 1HJWA 4HA1A 1KTBA 3BLPX 4JFSA 3G6LA 5A69A 2OW7A 1QI3A 4CU8A 1BGAA 4ZEPA 4M81A 1OSEA 4AMXA 2W66A 1TE1A 3CHEA 3PZTA 1B3YA 4XZBA 2YJQA 5CPQA 3KWXA 3PZUA 1U30A 1UH2A 1JI1A 2WSKA 1N82A 1C90A 3K4AA 4XUYA 3ZM8A 5KEZA 1HVQA 1I1WA 1DHKA 4JKLA 2YDRA 2X1IA 4PMDA 2FH6A 4AD2A 1GHSA 1LLOA 2G3JA 1FHDA 3VD5A 3AFBA 1QI0A 3S5YA 2VCAA 2DQXA 3WUFA 1B3VA 5A6SA 4N0RA 4CD8A 3L2MA 2BVTA 3CH9A 4BF7A 4LQ1A 1VFMA 2OSXA 4HZ6A 5LA0A 2ZICA 1G01A 1HP4A 4ZXLA 5I0DA 1V3KA 4PMZA 1B3XA 3W53A 1MWOA 2OYLA 3W6MA 4ATWA 1K9TA 3AHVA 3LPOA 1RP9A 3THDA 2DSZA 3NCOA 3B9EA 3NSNA 3GH4A 3W28A 4DWSD 2J7EA 1JDDA 1XCWA 5GPRA 2OLHA 4W7VA 1O6IA 1L0PA 3TTYA 1E5JA 1RH9A 2VC9A 4HMCA 2WHJA 1VIWA 3VGEA 1LF1A 1OCQA 1WE5A 3K8LA 1BG9A 4BQ2A 1NWTA 4IUGA 1OT1A 4J28A 5FKYA 1W9PA 2GJXA 1ZBVA 1CXHA 1LWHA 3MKKA 5CZKA 2YA2A 2B31A 3PZ9A 3CUGA 2G3NA 1BYBA 3CBWA 3ARWA 3VIPA 4GI9A 1LL6A 1OIMA 1HKJA 3ARSA 4U3AA 1VEMA 4PMVA 1HKMA 1JZ8A 3L4TA 4XV0A 3WNKA 2PF0A 1TFVA 4GQQA 1GZJA 2VZSA 2XFFA 3QGVA 1E6SM 1LG2A 3T09A 3HMCA 3CGTA 4XZWA 4PCSA 4BQ3A 3OLGA 1BTCA 2W61A 3FHQA 4D1JA 4AD1A 4FNUA 1BFNA 1H41A 4H7VA 3M46A 3OLEA 5I24A 5E70A 3VM5A 5D9NA 3FNDA 3WIJA 1WAWA 4PMRA 1ZL1A 4JAWA 3BUPA 3CZKA 1QW9A 3RMEA 1HTYA 3WD2A 4U33A 1AQHA 2CIPA 1OWQA 3VDAA 3TP4A 5HOSA 1BVNP 2YA1A 2GUYA 5ABEA 3GM8A 2J7CA 2Z1KA 2PWFA 5JIWA 2J74A 2WCGA 4IISA 3BGAA 5IDIA 1Y7VA 3N1AA 1ZBCA 1W91A 2YL6A 3VIGA 3SUSA 1OGGA 1QOXA 3NUKA 3MUIA 4ACZB 2VRQA 4JZ5A 2WKLA 4AY1A 1CIUA 1UKTA 1BSIA 5A3HA 4HMEA 3EMZA 1MQQA 1WDQA 1TQUA 3I3EA 2WWCA 1EO7A 2J78A 3BH4A 4CCDA 2J8GA 3K46A 3VIJA 4GQRA 4WK9A 3W81A 4NI3A 2Y8KA 1EDTA 3MUAA 3MUY1 3A21A 2G8ZA 1V03A 1H5VA 3A24A 4XX6A 3RO8A 5A94A 3QOMA 4PTXA 2WMFA 1XSKA 1HXJA 4LYRA 1W3KA 2DEPA 5M3WA 3B9DA 3OLDA 4TVUA 3ARVA 4E8DA 3BVUA 1CECA 2X05A 2ZX9A 1ISWA 2CETA 3RIKA 4JKMA 2WWDA 3WNLA 2W92A 5BXSA 4Z2GA 1VEPA 5HXMA 1K9EA 1UHVA 3ARYA 2WC4A 5HNNA 1K6AA 4PYSA 3UR8A 5A6MA 5CQ1A 1QI5A 1UYQA 2WMKA 1UKPA 5CG0A 5ECUA 5BYWA 1JL8A 1B3WA 1V3IA 1IV8A 5GNYA 1JXKA 4AZ6A 3CZEA 4EKJA 2WNWA 3PZNA 3AIQA 2X0YA 1QWUA 1R33A 4FMVA 1KXHA 3NIYA 3EMQA 4TTGA 2A3BA 4LYPA 3KL3A 4D6DA 2CPUA 1ZU8A 1FHLA 4CD4A 1KBKA 1C91A 3AS3A 3N9KA 5DT7A 1VF8A 2HISA 1KB3A 3DECA 3KL0A 4MAVA 4FLOA 2ZOXA 3WKZA 5AC5A 2FGLA 2EPOA 1BYCA 1UWIA 1WDRA 1XHGA 1HT6A 2VZUA 3SEPA 3K4DA 1XC6A 3WFZA 2O9PA 4HU0A 2YFOA 4KH2A 4J3WA 3WD3A 1MVYA 3T08A 2BV9A 1W9VA 1BQCA 3AIUA 1UA3A 5M5DA 3W6LA 2E8YA 4QLJA 3BSGA 3KL5A 2D73A 5DF0A 4AXNA 3VILA 3GH7A 1U2YA 2E9BA 2O9OA 2EPMX 3SUWA 2BNJA 5E6ZA 1X1NA 3IGUA 1GNXA 2XM2A 4KGLA 2EQDA 3LPGA 3OBAA 1RD6A 3ZSTA 2A3HA 1E72M 3ZR6A 5A8NA 3ECQA 1A3HA 3AXXA 1XRVA 1PX8A 2JEQA 2WMHA 3NJ3A 4AZIA 5DFAA 1V0NA 4F79A 3PHAA 1E3ZA 2NW0A 1WZMA 2F7PA 3UCQA 3DHPA 2XN0A 2BHYA 1YQ2A 3BCDA 2VR5A 1HF6A 5AY7A 1W3LA 3TA9A 3DX1A 1BG4A 3UEQA 3QHOA 4B9ZA 1M03A 3N17A 3SIMA 2JIEA 1OBAA 5E09A 3RCNA 1D7FA 4LYQA 1BAGA 4AIOA 4UFJA 1QVBA 2G41A 1NWSA 1CENA 1XYFA 1VBRA 2O9TA 1WO2A 2OWCA 1KR1A 4MPKA 1QBAA 4QCFA 3EMCA 1JIBA 3KLLA 1W9UA 2ZUMA 1PPIA 5JUVA 2XVLA 3VGBA 2YLAA 1JYNA 1OB0A 2YDQA 1EHNA 3AS0A 3BUQA 4MJ4A 2DT1A 4B3KA 3GNOA 4KRUA 1KCKA 1J0KA 3HZ3A 3BAKA 2D3NA 3BSHA 4LX4A 4OOUA 3ARRA 2DT0A 3AMGA 3TTQA 4W88A 4W8BA 1GQIA 2VCBA 1XD1A 1W2PA 3W38A 1PIFA 4CKQA 1O7AA 1PS3A 5FOOA 2FE0A 4WKFA 4P7OA 4RL3A 1V02A 2DPEA 3H54A 4DM1A 4W87A 1WB0A 2WBGA 3DHUA 1JZ2A 1WZKA 4L4PA 3MI6A 4W8AA 4U5IA 2WVVA 4RE2A 4NZCA 1M7XA 4UFHA 5I78A 3CHFA 4GZEA 2DH3A 1CXIA 4MB4A 1BVZA 1HX0A 3WL0A 4R5EA 3ZT5A 1OINA 2O92A 3AICA 3BVVA 2PC8A 1E6PA 4DO4A 3VMNA 4GI6A 3AHYA 4X0NA 1DWGM 4M82A 4JHOA 4OIFA 1US3A 2CXGA 4D71A 2D3LA 1VFOA 4N42A 4FK9A 2CBUA 1CBGA 3MSDA 3NSXA 2VZVA 4HZ8A 2Z1SA 3POHA 1V6XA 5EFFA 3EJSA 2VOTA 3UETA 4W84A 5A6AA 2OSWA 2VQTA 2MANA 4CD5A 1TQWA 3AIEA 4DM2A 1QHPA 4ZE4A 5ABFA 1WDPA 4E8CA 1MW2A 2QMKA 4PRWA 4BS0A 1E4NA 3AMLA 1NWUA 1V0KA 2AMGA 1V6UA 1EOMA 4MDPA 5A1AA 2DT2A 1J11A 1VBUA 2GDUA 2PI6A 1F4AA 2XSAA 4JFWA 3DX0A 2BY3A 2IXVA 1HJXA 4PMNA 2C7FA 3A5VA 1L8NA 2DGAA 3VMPA 4NZFA 5KZ6A 2AAAA 1MXGA 2UY4A 3WF2A 4ZFMA 1XGZA 1QNOA 2DT3A 3DX3A 3AHTA 1M01A 1E6NA 4AYSA 1EQPA 1H11A 1ITCA 4WLCA 1E70M 1J0IA 2WVUA 3AROA 4RE4A 2VX6A 3HG5A 4UCFA 2VUYA 2V3GA 1CGTA 3T0DA 3GDBA 3SCVA 3QOKA 4FNTA 4P7NA 1UWRA 1E56A 1F4HA 1MFVA 4PTMA 2V5CA 3LPPA 3MU7A 1XH1A 2WPGA 3WH6A 1CDGA 4LGXA 5CPSA 3CPUA 1GW1A 4AEFA 2OSYA 1P6WA 4U2ZA 1UKOA 4CU7A 3L4VA 1R7AA 2XGBA 1UD2A 1AQMA 1JFHA 3BVWA 1WCGA 2GJXB 3OIHA 3L4XA 4QCEA 3VD4A 5ABHA 2VT0A 3IANA 1W3JA 4MNJA 3IK2A 4OKDA 4YHGA 1E4LA 2FH8A 7A3HA 3AIVA 2EXOA 2FGZA 3AZRA 4ML4A 3M6DA 1CGYA 3IJ7A 1JZ3A 1TVPA 4TTUA 1ISVA 2ZIDA 1J9YA 1NOFA 1MQRA 4H04A 3SCSA 4Z2IA 2TAAA 4AEEA 3PTQA 3HU7A 1VJSA 2ZXDA 1HL9A 3A6OA 4X0VA 5EB8A 4DWSA 1AVAA 1ZB5A 1XSIA 3ZT7A 2A3EA 4HZ7A 1W1YA 3AHXA 1V3LA 4AZ7A 4C7GA 2J79A 3AIRA 3VD7A 1YHTA 1J01A 1QBBA 3EJTA 1KXQA 4FNRA 1WZLA 2J47A 4NSBA 2XVKA 4NRSA 5A6LA 5IFTA 1CTNA 1B3ZA 4GIAA 3OGRA 1R75A 1B2YA 3FW6A 1HJQA 3FN9A 4C7DA 4V2XA 2X2HA 2JEPA 2F1BA 3SCNA 3WF0A 4UQAA 1NH6A 2A3AA 3WDRA 1UWQA 1KTCA 3F5KA 4Q7NA 4QP0A 3AMKA 4JCLA 5D8ZA 3PZMA 3VSVA 7TAAA 5D9MA 3T2OA 1UD8A 1C8XA 1GQJA 3WY3A 3E1F1 1MQPA 3F5JA 6CGTA 1Q4NX 2WXDM 3APGA 1HXKA 1MYRA 3GYCA 2UY3A 2V5DA 8CGTA 1CGVA 1EIBA 2WKGA 1UR8A 1ZJAA 1TQTA 1UG6A 4ZE5A 3GXPA 2WZEA 5EFDA 3CMJA 1C92A 3A47A 4KRTA 1KR0A 2FHCA 3PZQA 3NSMA 1R8LA 3ZJKA 2E4TA 3BMWA 4W93A 3CHDA 4MNKA 1KXVA 1CXLA 3WY2A 1VENA 2VI0A 1C7SA 1SFSA 1QPKA 4D6FA 4BZYA 3GXTA 3VSTA 1W9BM 2FDMA 2FYVA 1TR1A 2F7RA 5LA2A 2VX7A 3F4VA 3WN6A 4UFMA 3WD4A 1SR0A 3TOPA 1GOOA 1TQVA 1HKIA 2QMJA 1FH9A 5FL0A 1CXKA 5E0CA 1RP8A 4W89A 2NT1A 1UH4A 2XWDA 3N15A 3H55A 2BXZA 1TVNA 2IGTA 3IJ9A 5FCZA 1CPUA 1ZS2A 4GO9A 5D8WA 3VIOA 3WUEA 1LJYA 2OWWA 1JDAA 2EABA 2WBKA 3IJ8A 3DX4A 5HPOA 3VSUA 3ARXA 1TQSA 3UG4A 3AXHA 3L2LA 4D6IA 5BWFA 3MMDA 3POCA 1JFXA 1JAEA 3VUPA 5GNXA 1TG7A 4KWUA 3ZJ7A 1KGWA 2QF8A 1CEOA 4GI8A 3BVTA 1SMDA 1T0OA 1H1NA 2F2HA 3PZOA 2YIHA 3WFLA 1I75A 3CV5A 3AI0A 1D3CA 4FNQA 1JDCA 3WQVA 3EDDA 3BAWA 3LXCA 4FNSA 3EDKA 3L4ZA 2GK1A 3FXYA 3QHNA 2ZX7A 1E0XA 2BHZA 2W5FA 2PBGA 1Q6DA 3F5LA 4DUVA 1QI2A 3PZIA 2Y2WA 2YLLA 2QPSA 2E3ZA 3M7SA 3GXMA 1R87A 2XPKA 2DSWA 4HOXA 3RDKA 5LYRA 2WYSA 4MNMA 3J7HA 5CLTA 1J12A 3DYOA 3CZJA 2UY5A 4AZGA 2ESCA 2ZUNA 5D9OA 1JYXA 2VVSA 3N13A 5CXPA 2QHAA 4R27A 3FAXA 3VIIA 3A4XA 5A6JA 4OBRA 3BMVA 4WKHA 1HIZA 4P8UA 4AZBA 2J77A 3WEZA 5CJ5A 4X9YA 3CO4A 2OYKA 5DMYA 2OW6A 4U31A 3VNZA 3T0AA 3WDHA 1V3JA 4F8XA 1PBGA 1FOBA 1R85A 1V6YA 1GORA 2A3CA 3WMSA 2PWEA 1KWKA 1Q6CA 2WSPA 3VDBA 1H49A 1E6RA 2UWFA 1AQ0A 3ZO9A 3S5ZA 3HG4A 1UZ1A 1UD5A 4B15A 9CGTA 3NDZA 2JF7A 3THCA 3CLWA 4GO8A 1GJWA 5EBAA 4BA0A 4UQBA 8A3HA 1E5NA 3D51A 4MJ2A 2F1AA 1UH3A 1E71M 4QDMA 2ZXQA 1GQLA 2WC3A 4CVUA 1VRXA 5CGTA 1LL4A 4P7LA 2J7BA 1EDQA 5E6YA 2BHUA 4V28A 4MAZA 2CKRA 3WNMA 4BQ5A 4U5KA 1C7TA 5BXTA 2XHYA 4D6EA 3VGFA 1OGSA 1CYGA 1TA3A 3WMCA 3MUZ1 3AIWA 3VINA 4UR9A 3WDJA 1OGBA 4HP5A 4FLQA 1V08A 2WC7A 3SCRA 4M56A 4J7RA 4D6GA 3W4RA 1NP0A 4XB3A 1V0MA 2VURA 2DIEA 2BY1A 3K8MA 4CN4A 1GUVA 4UQCA 4LPCA 3W26A 3WD1A 1PX3A 3WQ5A 1FH7A 3GNPA 2XVPA 1QNSA 4RE3A 1UR9A 4YHEA 4WJXA 5C8BB 3WBAA 2D22A 4K68A 2WVVB 1MW0A 2E8ZA 1WKYA 1ECEA 2VX5A 4EAMA 3VX1A 2D0FA 3ARPA 3AYSA 4W7UA 5A6BD 4AMCA 1DP0A 2G4FA 1UKQA 2D24A 1WNOA 1KGXA 4PMOA 1SYTA 1QNRA 1XV8A 2W4XA 4J27A 2VNCA 3WF4A 3SCOA 1MFUA 1H3GA 2VO5A 3T2PA 2YA0A 3MV11 2IUZA 4MADA 5D4YA 4M8UA 2XJ7A 4URIA 3S6TA 1H0IA 2F7QA 1J0ZA 1JGIA 4GXPA 2OYMA 2PWDA 1E40A 1KXTA 1HKKA 3ALGA 4H41A 2EADA 3RJYA 4JKKA 1CLVA 3GBDA 5ABFB 4GINA 4L4OA 1BF2A 1UWUA 3BUIA 4UFIA 1B1YA 2DSKA 1FFQA 3GTNA 2WZHA 5BXRA 3RM8A 2ZXAA 2V3EA 1B30A 2CITA 2YL8A 4H8HA 4BQ4A 2WLZA 3AMDA 2NT0A 1EQCA 2WMIB 3U57A 4FLSA 5A8PA 4HOWA 3LMYA 2V3FA 4Q22A 4J3SA 3ZMRA 5I77A 3ZQ9A 1VEOA 1GCYA 1SMAA 3CZLA 3AS1A 1V3MA 4MTVA 1V6VA 4AD5A 3SURA 4UOJA 3BLKA 2DIJA 4OOZA 3VIFA 2UY2A 3PZGA 3RJXA 4HA3A 4PCTA 4J3VA 4HTYA 3CZGA 3WQ6A 2JIWA 2JE8A 4H8UA 4CUCA 2BY2A 3D52A 3EJQA 4TOQA 2EAEA 3SCWA 2QV4A 4TX8A 4AD0A 4UFLA 3RM4A 1OM0A 2EBNA 3I3DA 4TXEA 5I2UA 4NXSA 2QLYA 1GVIA 1H09A 3VD9A 5A2CA 2WCAA 4A3HA 1J0JA 1PX4A 2CBJA 3LXBA 3FHAA 3KZSA 3CUJA 4J3XA 3OGVA 3MSGA 2W91A 3U5UA 1EGZA 1HN1A 2G3IA 4PBGA 1X6NA 2CBVA 3S2CA 3B9AA 4AC1X 3LPFA 2PB1A 3QHMA 3WQ8A 1XYZA 2FHFA 1HWWA 3WSUA 1LWJA 4FNPA 1US2A 3WF1A 1J0HA 4IM4A 1B0IA 3EBVA 5C70A 2XIIA 3MO4A 2YFNA 3ARQA 3TTSA 5BRQA 2XFRA 3OG2A 1C3FA 5AYIA 2WK2A 2YDSA 4Z2JA 1B31A 2E0PA 1BGGA 1FA2A 3SUTA 4ATDA 1VFUA 4DWSB 1NOUA 2YL5A 1HJSA 1ODZA 5AYBA 2WMIA 1C8QA 4MNLA 1W2VA 4B3LA 3B8SA 3ZIZA 1FP9A 3BUBA 2W62A 3VOCA 1V02E 3ARTA 4J3UA 3DYPA 2BFGA 1R7OA 4AW7A 4UQDA 5E9AA 3II1A 1VB9A 3SCQA 3OLIA 3VMOA 4MDOA 3EDJA 5ABGA 3CZSA
chains in the Genus database with same CATH superfamily
3APMA 4B3ZA 1RFDL 3OM3B 1A9BB 5IBUB 5HQEA 2CLOA 3VVGA 3MU3A 5EWIL 1U91B 3OGOE 2R0WL 4ONHA 5J6SA 3DIDA 3KPQB 4DN3L 3T7VA 2CKSA 2HH0L 2DEXX 1A6TA 2WB1A 4PP1C 4WNQB 1LO2L 4JHWH 5LJYH 2HFEB 4BH8A 2DV0A 1M1SA 3L9BA 5FSEC 2JI3A 3ZLFA 1QSED 1F6AB 4CL7A 2PRMA 3K8KA 4CC4C 3G6MA 4Z7NB 2QPDB 4CAGA 3WJWA 4UTHA 1NPUA 4HIIA 4GXUN 2ZCKL 4C1NB 3AOFA 3SIZA 3VC6A 3WFCH 5I8EA 5EMJA 1M7OA 1ML1A 3WJJC 1R1CA 4HUWA 5T1KA 4WEBL 3DOSB 1AJZA 1ACYH 2DMHA 2Y7LA 4XP4H 4ZMAT 1SR9A 2FEEL 3R1ZA 2VVNA 1QR1A 1OAJA 2WAGA 3WDPP 5IM7A 4FN0A 2Q3ZA 3F4NA 5E6IA 2YEQA 4A3RA 5JXAL 3NJXA 1HZKA 2W59A 1SSGA 4G6MH 1W0VB 3V6ZB 3RL2A 1XLAA 1MJ7H 3IDNB 1ROWA 1DLFL 2EEXA 1T2QL 3GLCA 3TYZA 2OX5B 43CAB 1RCQA 3LQAH 4TVDA 4Z1BA 2VERN 5KG9B 3RNQB 2LW3A 3BN9C 3JWDC 3Q5OA 4GT0A 5C0BB 5BZDB 3FOLB 1JXDA 3MRFA 1UR2A 1WP6A 3APDA 4JVUA 1OZTG 5E9DE 1YN7B 2J7LA 2ZE0A 3GNDA 3ULAB 1S6NA 2PDQA 2FSDA 3UGEA 2AJ3A 4RQQB 1XDLA 3IU3A 3MRBA 1DOSA 2C3XA 4U4MA 3A6BH 1Z5LA 4HALA 4G6AD 5D71H 3MJGX 3JXAA 4NX5A 3I3BA 5HPCA 3MHZA 1EZ2A 3HTLX 4ZQKA 5AWNL 3H23A 4I85A 2F15A 4EF8A 4JZNB 4GFTB 2GEQA 5T3XD 1FWIC 4WV1B 4WUUE 3B5TA 2K1MA 1A6ZA 3H85A 5HSFA 4JIPA 4NN5C 2NQHA 3QY6A 4JFFB 4QQUA 5C0DA 3SBPA 3LBCA 1DJXA 4LCWD 4RMUA 3H3PL 3QZWB 4N5EC 2VCCA 4JANB 5CP3A 3O6FA 4MNHA 5AVRB 2ZRVA 3LA4A 2BIHA 4XC1L 3N91A 3DMMC 1JHKH 3ZE0B 2DICA 1B88A 4I6KA 1GGOA 2YD1A 3W2NA 1QNQA 3GHTA 4H7ZA 1AANA 3CWNA 1H3TA 1GOMA 4Y7OC 2X41A 3T6ZA 1W1PA 2ARJQ 3E8UL 1UWAA 1LRTA 1A4MA 3GSOB 4XN4A 2VENA 4INFA 1KEMH 5KAQG 3OJ2C 3DYMA 3ZDWA 1EH9A 3CHQA 2O6EA 3MTWA 1XH0A 2APWA 3CTTA 3UACA 5HGDB 1EFXD 1YAZA 2VLRE 3W7KA 3QUZD 4XIMA 1T66D 2YBUA 2Q86B 3MN8A 4F57H 5GGVL 1WFNA 1NQ6A 4PY7B 4L8DB 2W3ZA 1NKOA 4Z18A 3GINA 1IC7H 1PFCA 3RWCA 4K39A 3IARA 3JUGA 1HP5A 2NR6C 1EGVA 3RDTA 4RGNE 1CF8H 3FTGA 5G1TA 1BCIA 3GDTA 5D72H 3HKZA 4WJKB 4Y7MA 1R46A 4PVNA 1MZYA 3VXTB 1R2SA 4WWNA 4PJGB 2EVJA 2Y62A 4JHWL 1NCOA 5HHQA 1ICSA 1NVMA 1B4KA 2Z7YA 3T0BA 3ZTEA 4GBDA 4KKXA 2R7EB 1A7RL 2IANB 1O5RA 3KYMA 3LX9A 3N43F 1MWAH 3K30A 2FWLB 1OCRB 4BF9A 3VOGA 2X40A 4PJ8C 3QAQA 5INCA 2J24A 3PL6D 3D2UB 4G42A 4WFEE 3SDCB 3UZXA 1ACYL 3MLXL 1XR9A 1JPEA 4LFYA 1JWSA 3XISA 3UP6A 1CR9H 3CFEB 4FQPA 3VH8A 2V5JA 4GIEA 4MJ6A 3APYA 5MERA 1IQWH 4P23A 4FJ6A 1MUJB 2P8PA 3LRKA 3OKEA 5AYYA 4M6NH 1NGQH 3ZE2F 2C3WA 4G6ML 1ZRQA 1RI8A 3BQUD 1WA3A 4U1GB 3RRXA 3HG1A 4PGDB 4K7PH 2HBVA 1VFTA 3LQAL 3ZYZA 2OT1A 1RPKA 6A3HA 4UMSA 4F2TA 1KBGH 4OBSA 4WY0F 3TU6A 3GO2A 3U6RB 2DLTA 4X7TA 2H3KA 4N2NA 2HVKA 4M6MH 2JGQA 3LUTA 3KE0A 5TJWK 1GOKA 3HR6A 4IX2A 2BS9A 4LO9A 2Z91A 4N0CC 4JPKH 2B4GA 3VKKA 2D3JA 1CT8B 5D71L 2R29A 5D32A 4IBQA 2IEPA 3O4LD 3FQNB 1OGAD 2W9EL 3QQNA 2R2EA 4E0RB 5E8NB 3W2MA 3S6CA 4DW2H 1WT5A 2A7PA 2KL6A 3HCVA 2BLFA 2H3DA 5AB1A 5LGHH 4ODWA 1WCQA 1OFAA 5CILH 3FGCA 1KTBA 4W1TA 4KJYA 4LVBA 1JZHA 6XIAA 2MEJB 2PTTB 3G5ZA 4LH8A 1TPEA 4JFOA 2HCZX 2HS8A 4UR7A 2VCAA 3CC5A 5F4WA 3L2MA 3E9AA 3OBEA 3APFA 3CH9A 5D30A 5FJRA 3MSYA 1SEBA 4LMQE 2UV8G 1XCTA 1KYOJ 1A5CA 3NCOA 1KZQA 3QDME 4I0KA 4GQPH 1TETH 5AOMA 1OTTD 3HRZC 4V15A 1SHXA 2DYRB 2Q8ZA 3GZ3A 5HDBE 2JQMA 1M3UA 4XO6A 1ZBVA 4U1IB 1PCXA 5DGRA 2G3NA 3FUFA 1HILB 4B90A 5SWSA 1S7VA 1ZDSA 1VEMA 4PMVA 4UNLA 3U7AA 4F57L 3RLSA 4JR5A 5KVFE 3WNKA 1J86A 5MHSE 1KBPA 2YAMA 4WGWB 3P3TA 3PRZA 2AKZA 1IC7L 4OF3A 3VFPB 4ZMWA 2X4NA 5KVEE 3RA7H 4NM8L 1HTYA 3USZA 1CF8L 4GNJA 2ACQA 5DFVD 5DEJA 4BI6A 1CDBA 2LLLA 1FRGH 3I6RA 1I1AC 2WLJA 4YK4B 1ZBCA 1HINH 4YSPA 4UCGA 1OFEA 3RP1A 1M9SA 4JFPA 4PWKA 4YEFA 3MRCA 4AY1A 1CIUA 1BSIA 1U3HD 3F4WA 2AQ2A 2PDBA 1E28A 1CD1B 1FLRL 2PP7A 4W9JC 1MWAL 1MH5B 4JDYA 1VBJA 1A1MB 3L3IB 2PABA 2EIMB 3QUMA 3GTIA 4RLDA 4UIOA 4X42A 4P46D 4DQOH 1QA9A 4J3OC 1DQLL 3EJYD 1P6BA 1K9EA 3KG5A 2Y22A 4IU3B 5DT1H 4Y4KD 5A6MA 3MNWB 3KLAA 2IGLA 2JKIS 4WHCA 1D8WA 5AAMA 2N56A 2XZQL 4G7QB 5CG0A 3S3DB 1CR9L 3L3HB 1D5XB 1VLIA 4LKXA 5AC7A 2WNWA 5ICZA 4I9XA 3S37X 1WC7B 1IQWL 3GG0A 4YTTA 2NX5A 1UT2A 4W9IC 4NNYA 4M6NL 3FYYA 1KBKA 5FUZH 1W0MA 3UTQB 1TTBA 3IMBA 5AZ0A 2CLKA 4H0LC 1HHGB 1XLDA 5F0PB 4AH2A 3ZLQC 4FR6A 3D5OF 1QBLL 2RDWA 1HOCB 2ZCGA 3WS6A 1KBGL 1QAPA 1W3TA 5C2UB 1S7RB 4PJBF 4Z1YA 5DF0A 2WXHA 5F2LA 3SQOH 2OCFD 4LEXH 2EPMX 4R5TA 3NEHA 1RSFA 4M6ML 4REQA 3K5SA 2WPBA 3ZZ1A 2ERJB 3RKDC 4AW4A 2LFEA 2CDEA 3VSQA 3H3KA 5DFAA 3UGVA 3UCQA 5DJ8A 1T96A 3W3OA 4JPKL 2XPGB 3ZYOA 5E94A 3UEQA 5AVTB 5DZPA 1YXYA 3CFBA 4AIOA 5TH2A 1VJIA 1QVBA 3VWJC 1XYFA 2H6OA 4JTTA 4DW2L 2BC4B 4EOUA 1Z1WA 5LGHL 4FJYA 3FT0A 5TK4A 2DW7A 2GEEA 1TTAA 2YLAA 3RIAF 4OKVA 1EUAA 2VN4A 3KWWB 4ZW5A 3T65B 4TX9A 4R7WA 3LU2A 4LX4A 2PXYB 4XPHL 3U36A 5F3HA 1IU1A 4Q6KA 4KKAC 1FI8C 5D5ME 3UT0A 1PTAA 1E6JH 2N4IA 4C59B 3DX6A 1ECQA 1XBDA 2WTOA 3HPJA 4HUKB 1KULA 5HGBB 4EN3C 4UFHA 1R9YA 5EIIA 3H2NA 2DJUA 3P77A 1SVCP 2FGBA 4DBUA 2FZ9A 1I7ZA 3L7RA 3K2GA 2W88A 3LI1A 5FJPA 2Q7YA 3QULB 2P0IA 3TOYA 1TETL 1HGWA 1WXYA 1BXUA 3MSDA 1V6XA 4FX7A 2B59A 3W11C 3RWDA 1KYAA 4M8RA 2XJLA 3O1NA 1M41A 2QMKA 2GAZA 4AL8H 4R90H 3LBOA 3FFCE 3DX0A 2B4CC 3RUBL 1KLGA 4PJXF 1PEWA 3WK1A 1XGZA 5CHNA 4LOUC 2HLAA 2AS5M 1J0IA 4KK9D 2WVUA 3LV6A 3HQ1A 3WQOA 5EIIG 4CNSA 3BYYA 4LSSH 1DJSA 2H2SD 2Z93A 4ZPTB 1JZIA 5HPMB 5PTDA 1FC2D 3P11H 1FRGL 2VN3A 3MO1B 2V2CA 4H26A 2PDNA 2P8BA 3MMTA 4ELMA 2Y1AA 1HINL 3WH6A 4K9EH 3CPUA 3BP6B 4QJ3B 5DHVA 4AEFA 3ZKXC 3NJKA 5EN2A 1UKOA 2NXGA 3HTWA 3BCJA 3NCWA 1I9JL 4XNXH 3LN4A 1NJ9A 4MNGA 3BVWA 4ENEC 2XINA 3A9IA 4BHYA 3LSOB 4QCEA 3VD4A 3ZDYF 3JVAA 3IANA 4Z1DA 1MG2C 3ULUE 2IKIA 4BCXA 2A83A 3B9KB 2ANUA 1JZ3A 4TTUA 3RZWA 4NJ9L 1KNWA 4HF5L 4DQOL 5EMUA 4WX2A 2ZXDA 1HL9A 1VFBA 4ZXBC 4MWFB 3CSYA 5DT1L 1W72H 3O8XC 3L9RB 3T77B 5KVDH 2J79A 1U92B 5T33H 4K7YA 4TVSa 3T4AB 5B21A 5BNKA 4IKKA 1KRAC 4XBJA 3L54A 4H0HB 5HHVH 1J6OA 3RGVC 5EU6D 2E75C 1UFUA 2EGZA 3SCNA 2QZ5A 1VBGA 2IOOA 5FUZL 2Q6ZA 3AMKA 2V2WB 1TJ0A 2BOGX 4R26H 3C60B 3E1F1 6CGTA 5HQMA 1IR2A 3V0IA 4LOFA 1BQGA 4AQZA 4MJJA 3JVGC 2VMCA 4M51A 1YX1A 2B1OA 4P04A 2XIJA 5J0BA 3GZOA 5JHAA 1X8FA 2A7NA 2E5CA 1LXMA 3CHDA 2ZYSA 3SQOL 3EH1A 2EEAA 1TPXB 2J2ZB 2KS0A 2VAAA 8PAZA 1YG9A 3G5XA 4P2RD 4B96A 3CAKA 1LTDA 5I1GH 2GJZA 4CEUC 1WUNT 4L9LB 4XBKA 1F4WH 4JM2A 3GG7A 3KOWA 3Q01A 4XMWA 3F2DA 4H44C 3RITA 2QR0A 1JNJA 3IJ9A 3B0YA 3LH9A 5IQ9A 2R51A 1JWMA 4HVBA 3HFML 1IGFH 4KZCA 2QFRA 1E7VA 2QF8A 4J2PA 3BXNB 4JRFA 2OLDA 1H1NA 4P5TD 4AB4A 1ZA3B 3KS5A 2NXZB 3WL9A 5EU4B 4XSLA 1C8VA 5I6NA 2PBGA 4NU7A 4FS9A 2Y2WA 2QPSA 1OYBA 3BWAA 1OADA 3LCWA 5LYRA 1RALA 2RFXA 3QVQA 5B22A 3DC8A 1E5CA 3DESA 4UINH 1A80A 4M1CC 3P0YH 2XDHA 4M8QB 4Q4SA 3V6OC 1E6JL 3CK0H 3EKCA 4LUIA 1P6AB 3EGDA 5EYWA 2BK8A 3NCCB 4TV6A 3R43A 4U1KA 4YTQA 2V68A 1MRCH 3LB0A 2BOLA 4GLRH 4U31A 1R85A 3W1TA 4K71B 3ZKNC 3GKWH 3S7GA 3DERA 4XKYA 3TQPA 4NRYB 1HJCA 3LMZA 4B15A 9CGTA 4TNGA 3CLWA 1SEQH 4G6FB 1PZ0A 4RMRA 1GQLA 4U1HA 5KAQF 4HETA 5E6YA 3UPMA 1CW2A 2FZ3A 1XEUA 4GC4A 5MHBA 3HRPA 4MWAC 1E5BA 3D0CA 5E4IA 4K7FB 4GAYB 4KMTL 3V5HA 4AL8L 4J7RA 2MQGA 3DG6A 4NERA 4YLCA 4JJ5A 1V0MA 3AXMA 3SI9A 4K94H 1MIEH 2X16A 1MCLA 4U49A 2ODHA 1DBJH 1FH7A 4IBLT 2CLIA 4L1WA 2O7SA 5DTFB 3HB3C 5I1IH 1ECEA 1U3NA 4UBDD 3VX1A 2R2HB 3ABZA 4GG9A 3DBXA 3P11L 1A4LA 2YGPA 4DKTA 2BNQD 2VNCA 3V8OA 2HMIC 1VD6A 3H4FA 2EDOA 4UILH 2A77L 3S6TA 3IJLA 1XF2B 4IFOA 4XNXL 1KXTA 4PTUB 1S5HB 4Q0XH 4NZ1A 1EP3A 3QCTL 1UM5H 5CJXA 3U1SH 2BNRD 2YQ3A 2ESVB 4LK4A 3WOVA 2WZHA 1S2TA 4PFMA 3V0FA 4M48H 3UTTB 5MEND 3OA3A 3OJDA 1CLYL 5I71B 4B5UA 1XDJA 2V2TA 2X4UA 4BQ4A 2WLZA 2YSSB 2WMIB 3T1GA 4Q22A 5T33L 2C1OA 5I77A 3JV6B 7REQA 2APXA 3WO4B 3OZLA 3PBVA 5KUKA 3QFEA 4DP9X 4WIQA 5HHVL 2OM5A 4BY3A 1ET7A 4X80H 3V75A 4I6VA 3OHIA 2OG9A 2OYPA 2V8MA 2JE8A 2J6EH 1A5NC 2Q6WB 1SDAB 3M7WA 3D52A 5HHMB 4L1DA 4N8PA 4R26L 4QXTB 3DLQR 4XMTA 4XVDA 3U9WA 4Y9OA 1T7YA 1KPRA 5H2BA 3U9UA 2PLKA 3D2TA 3LQZB 4QRRE 2Z64C 1UYWH 5MEQB 4WJ5A 1ZCCA 3BLIA 4MMZC 1JP5A 3ES6B 1XYZA 1FWWA 1CFVH 2V17H 5EOCL 5IB1B 2K4AA 3V4LA 2B7NA 1KFLA 5IROA 3NA4A 4K3EL 1B31A 4ATDA 4QNEA 4R7NB 4PWHA 1F4WL 4Z7VB 2OGJA 2W62A 1VPXA 4H1LH 2V7HB 1FYTE 1Q72H 1V8HA 1F1DA 2ITCA 1USQA 5ABGA 3QJVB 5KVEH 3VKDA 1IGFL 3D3VA 4IMKC 2K9UA 2A7BA 5HYJE 3R2GA 3B03A 4AQAB 5K69A 5K9CA 5T26A 1GQKA 5E51A 5GQBA 5IVNA 3JWNG 3EO1B 5CCKH 2WVTA 4MD4A 5CZVH 3SJ3A 4FF7A 4C7FA 3NWRA 3KLHD 3QNFA 3QKZA 5GRUH 4JFEE 4BFNA 1R4XA 2J8UE 3DJ9A 1EZLA 2C4FU 2QPUA 3IV8A 3P0YL 4C8XA 1TUXA 4QRSA 4H8NA 3IFPB 1HCVA 1O5PA 5GNZA 3WH7A 4BRJA 1IEBB 3RU8X 2ZRXA 2P5WD 1MRCL 4GZ7A 1AS7A 3F7KA 3NAVA 4ICMA 2EO1A 4Z7QB 2PCEA 5AC8A 3GKWL 3CUFA 4S2BA 3T9PA 4E5XA 2EE0A 5E1QA 4DWHA 4ADJA 3P9LA 1HG3A 3AB0B 3GRIA 5D2LE 2ZX8A 3FT1A 1L9RA 2JF6A 4U1LA 4HIEA 2SEBB 3VNJA 4BM7A 3GW0A 4HYWA 4A22A 2V2DA 2BTMA 3L1OL 2A73B 1EO5A 3ATYA 1T1YB 2F8XC 1F73A 1ZP3A 2KZHA 5AZ1A 4ETQA 5HVWA 4EUPH 3B9OA 4OQVA 3MWCA 1J1XH 1RUPH 2IBBA 4JS3A 4RFNC 1E4IA 3RVWC 2PTYA 3K6NA 3PGDA 1IEAA 1GKEA 2BVOB 3D4CA 1DBJL 4GW5A 2WZIA 2GJ6D 4J3TA 3S35L 3QFJD 3B1TA 2MWCA 5I1IL 4GVFA 3L0GA 2PEVA 3O4OC 1EHAA 5KJ4A 3NPSC 4LCSA 3AJ7A 2EDNA 3LCIA 3FBKA 5DQJB 3VI4A 2DDXA 1NC2D 4U1JB 2X09A 3S5SA 2QIIA 5D8JH 5IJVA 2IALB 2GITB 4UILL 2B20A 2YBVA 1GYNA 3BIKA 4GIPD 3T6CA 3TAOA 4YHML 5LKYA 1TUPA 3FB5B 3H12A 1OANA 3D4ZA 1OAYH 2FECI 2PYED 1UM5L 4RSVA 3N2JA 3GVWA 1U8LA 2WAQA 4HCDA 4WFFD 1D6VH 4TSCL 5HVHB 3GYEA 4M48L 4HIJB 4YMPA 1Q66A 2X1UA 4C5ZA 3HV8A 1MHHA 2YYTA 1Y6MR 2X0WA 2CKBH 3X14B 3V2AR 4YXGA 4QTHB 4PJIB 1E4XI 4TLUA 3WMPA 3UMTA 1SO6A 1A6VH 4MQ7A 2G2PA 1V4YA 2OFQA 3RMJA 4QKXB 5C1MB 4B2DA 1Z7JA 6FABH 3MLTA 1Y65A 2J6EL 1EXBA 3IAQA 5XIMA 3L5WA 3QS3A 1PVNA 3NXFA 4NIYE 4M5YL 1NOWA 4C55A 1RAKA 3GJFK 1DO5A 2G75B 4N9GA 4XP5L 2CM5A 3I75A 3IJYA 1UYWL 4V1DE 4AK2A 2XG9A 1C5DB 4R3SB 2PWGA 2NQ3A 4ACZA 1KPVB 1CFVL 3L0NA 1WBZB 2V17L 4FCAA 4G5ZH 3CWGA 5D09A 1PZ1A 4GSRA 3TA3D 4E9QA 5K33A 1FXPA 2R6OA 1HE8A 4GKLA 1I0BA 1FL6A 1OP4A 3VXPB 5A2BA 4C4KT 1FORL 1Y0LA 5I3HA 2H32A 1NM9A 4JL2A 4YHOH 4KRLB 3GMNB 2EPLX 1Q72L 7PTDA 5BWAA 2LAAA 3C5ZB 3EW3B 3K0YA 3W71A 2QJJA 5KVEL 3BV4A 3WLPA 4MVBC 3BZGA 4IS6B 3W82A 1GZHA 4CD6A 3HN3A 3MCNA 1IO4C 3TROA 1XCXA 1AKJD 1V0LA 2XIDA 1SUJA 5DMLA 2GSJA 1R5VA 3W29A 2X4RA 5HGAA 2ZWKA 3BPLC 1K70A 3O45A 1J18A 4ATLA 3VNYA 3DX5A 2Q9OA 5CZVL 4KI5F 1A7QL 2NSMA 1KFBA 4ILSA 1DR9A 1INEH 1KV7A 2WXGA 2NTSP 4HKPA 2H2PC 3GMMB 4O4YH 3ULUH 4PMQA 2JBMA 2ZWYA 2VO8A 2JALA 2YXXA 3UTOA 5EO1B 3BH9A 2PDPA 5GIRB 4X4KA 1XD0A 3FTWA 3MLZH 1DLHA 3ZJ6A 4OLVH 3DFTA 1AO7A 4XRCB 5LVEA 3ARFC 3MRRA 4NPYB 4AH7A 5HMFA 3FTUA 5EC2A 2WVSA 2GKIA 3BAXA 1BWWA 2D7MA 3SE4C 4LPTA 2E9LA 4JO3L 3RCYA 4WY0A 3ONBA 4AZHA 2X1WL 3URBA 3GRWA 3P3RA 1OPOA 3MV8A 4RGNC 2Q76A 4MMXC 4W8LA 1G7HB 2ZPKH 4MX7B 1ZDQA 5IHZA 2PAJA 1USZA 3L95A 4OQTA 3OGSA 1YEHL 4TULH 4S1DC 4MCNA 4K73A 2W5PA 2BSSA 4PUEA 4CN6A 3MJ9A 3UCRA 1H5YA 5E0FA 1QK0A 3IVKA 4FABH 3VXME 2JXMA 3ARZA 1GONA 3Q0HA 5DZOA 4C83B 4QOKB 3BO8B 2MQCA 4I4WA 3T6QC 1XH3A 5D8JL 4GKZA 4LVNC 4P8WA 2WCSA 3KGRA 4BH7A 4IGMA 1KBBA 5EUKB 1TSRA 4B50A 1DWAM 2F58H 5LXVA 1JGUH 3F65A 5GZND 1PAMA 3VFGH 1GKOA 1D6VL 5IMMA 4PY8I 2RQEA 4WHYH 2VUNA 3VFMA 1SUHA 2XN9B 1YADA 3TLQA 2WJFA 4WJG3 2PDKA 4FJZA 3IF1A 5CGBA 1M2VA 1QI3A 2CKBL 3C61A 3NEEA 5DJ0B 4OZ4A 1EJRC 3MZ2A 4E9TA 1C90A 3SPVA 4OIIH 4XXWC 1I1WA 4KVPA 1N67A 5I0XA 3MPCA 4QROA 3MJYA 4XN2A 3S5YA 4LQFH 1RH8A 3VE9A 1B3VA 4N0RA 4JYFA 3U0PA 3ASWA 3MA7B 4GRWB 5LA0A 2YXWA 3LS5L 4QIRA 1ORSB 5I6XC 3T8QA 1CLZH 4PR5B 4W4OA 4GXVH 5EGRA 1LEKB 4AWTA 2IXQB 1K6QL 3GH4A 4IHBA 1JDDA 1XCWA 2W38A 2OLHA 3V4PA 3LZ5A 4GFIA 1E5JA 5DJZA 2R1WA 1PLAA 1YAIA 1VIWA 1OOAA 2PPCA 3LQMA 2BNUB 3TXAA 3T81A 4R2GC 4AQ1A 1VYRA 2YA2A 2B31A 2W1NA 3TK7A 3CBWA 4MJIE 3MUCA 3VJ6A 4LF3B 1OAXH 1F8TH 2QTEA 1OD9A 1WFTA 4P3DA 1XRTA 4QRPE 3U3HA 1KGYE 2H9GB 3BPOB 4LY8A 1XB6A 3CGTA 5B3JE 1HEZB 4PCSA 2VXTH 1T5AA 3O6CA 5B8CB 3FKKA 3M9YA 1S78C 2J21A 3KDMB 4A21A 1WAWA 1AC6A 5D7EA 3VXSB 3PGCB 3W7RA 4BDVB 1E6OH 4YTRA 5D1ZC 3PNZA 2J7CA 2H0EA 2VDQB 3DRQB 4G7EA 3FT3A 4BEQA 1ZWIA 3PGFH 2R0WH 4OV6F 2HVNA 4BRVA 4JZ5A 5MEOA 4O4YL 4I0PC 3ULUL 4XNUL 4GH3A 3IXAB 1DO6A 1J6PA 2ITDA 4Q4EA 2CRYA 3ABGA 3Q8CA 3SFKA 2VB5A 1JQVA 3P4OB 5CD5D 2JI2A 2IPGA 3UCCA 4G1EB 3GD6A 5BOFA 2H0FA 4OLVL 4Z77A 4QIUA 4DP6X 1JVNA 5HJ3B 2J57A 2V81A 1NOLA 4UAOC 4E8DA 3QXWA 1Z6KA 3QPQD 2GFBA 1T22A 2WWDA 2P5EB 2YRPA 1N6QH 1HHKB 1LYXA 2CO1A 1DIKA 1JHLH 4FRWA 1B3WA 4X5XB 1NF0A 4IMAA 1I85A 4PRIA 1LO0H 4N20A 4F7MA 3QI9D 2PRHA 3VNDA 1KCUL 3BN3B 3M0HA 2Z7UA 1OYCA 2GY5A 2ZJSH 2G0WA 3TPUB 3D69B 4D6DA 2DTSA 3GU9A 3KPNA 3GMLA 3TR2A 2WLIA 1RZMA 2ZPKL 1ZT7B 3KL0A 4Q8UA 4TULL 3C6LD 2CW6A 1FDJA 4D0BB 4B3VA 1DANT 3HKFA 4LSBA 3WFZA 4HWNA 3Q3GB 3MWAA 3ZX1A 4LS0A 1BQLL 4XODA 2K8QA 1OP9A 4M6UA 5D2NC 2Z0BA 3SE3A 2JKLA 3GVQA 3VNKA 3CQHA 2FJUB 2O9OA 1EAOA 3QBTB 5ICYA 1I3UA 4U10A 3QUXB 2G2RB 3LPGA 1RD6A 3ZSTA 4JQAA 2XPYA 5AW5B 4HFWA 4J4KA 1SHSA 4D94A 1UR3M 1B4LA 2F58L 1X5HA 1JGUL 5FF6A 3KPRA 1S5TA 4IK6A 3SGUA 3IJDA 1FZJA 4JX6A 2BP8B 1XICA 3UWEA 4JHVA 4UTLA 3BOXA 1IGTA 4IH3A 1YRKA 3TH3T 3MZNA 4X6DE 2PPFA 4Y4HD 2CO6B 3G1YA 3VGBA 5I18H 3AS0A 4WDIB 3GJFH 5E6UB 2WZ6A 4JDEA 3AMGA 1AXTH 4C56E 5AWNH 1GQIA 1LT8A 1W8SA 4OIIL 4BK5A 2FD6H 2FE0A 3PDDA 1V02A 3STCA 3HPLB 2JMRA 1OK0A 1CUOA 2NY5C 4UNUA 1DXIA 1CLZL 4DGIL 1GGUA 3LLDA 3KW8A 5D9SB 3N3TA 3H3PH 4U6XB 1IJ9A 2WN3A 4GXVL 3SBWC 3IUHA 2NNCA 4RESB 2QJHA 4ZFGH 2A4AA 4I7WA 4K2UH 5D6CA 3QA3B 4OFIA 3S9DB 1CBGA 2PDLA 4KDVA 1DSFL 4NNPH 3UXDA 5C07D 2OSWA 3K3QA 3PY2A 3PANA 1PW3A 1F8TL 4E8CA 4K5NA 4O1BA 1TU2B 4JHUA 1NSJA 1WQVT 5T1LB 4LVHB 1J11A 1VBUA 5FO8B 5L6UA 4J3OH 3Q1EA 4RW5A 4EPDC 3GSUA 2VXTL 5EB9A 4NZFA 4C60A 3IXTB 2CNYA 3UDWC 2GIYA 4M7ZB 4HUXB 1ZLUK 2VLJE 1NWPA 1EQPA 7PAZA 3ULVE 1SDYA 4FIRA 4JRXD 4KRZA 3H2OA 1DV7A 2PO6B 1CGTA 1UZHA 1MFVA 4ML9A 3L5IA 3W9EB 3TURA 2JFCA 4PHXA 2BVUA 3PGFL 3HMWH 4LC8A 4O4WA 3ZFHA 1C12B 4IM8A 1MLBB 4US5D 5D7JC 2PFHA 3Q8FA 5T3ZD 5ABHA 3DEQA 4OT7A 3SJVE 3DPDA 1VIZA 2IIJA 4YHGA 3KPSA 1LOSA 3RVXD 1IIHA 2EXOA 2FTAA 5IQ7L 1W8EA 3IJ7A 3E6HB 4HZAA 5E00B 1HDMB 2LR4A 4RMQA 3VXUA 1R5IA 3A3WA 3NVQA 1ZB5A 1A7RH 4PGBA 3SN0A 3WUWG 1T8XA 3PQYE 4HZ7A 1N6QL 2QADC 3L16A 2PWVA 3IETA 3VD7A 4X4MA 1QBBA 1JHLL 1WZLA 1T99A 5F71A 5A6LA 2IKHA 3SR7A 5IB2A 1LO0L 3OGRA 3NPUA 1B2YA 4OVUA 1BGXL 1PD6A 3QV6A 5G5DB 3GNXA 2ZJSL 4XCNA 1N8ZB 5BXFA 3MLXH 3UR5A 1KB9J 3WDRA 3AVEA 3KMDA 2VLKD 5KSAC 2ZONA 5JZ7C 4AZUA 1PS9A 3KPLB 2WXDM 3E0LA 4QXUL 3M1BA 4DCQA 3A5FA 1A7OH 1CGVA 4DJFD 3ZDXE 4IMFA 3DV6B 4LLMA 3NDYE 3CMJA 5LAXA 4JGJA 2AV7A 2IPWA 4BFJA 2XWTB 4W93A 5DK0A 3TBSB 4G80A 2XBZA 5C0EA 1AS6A 1OARL 4ZQNA 1Q9WB 3ULUC 4NZUH 1Q9LB 2NNFA 4GFXA 4NI8A 4BZ1A 1T1ZA 1ES0B 4Y1AE 5FL0A 1CXKA 5E0CA 4PJCF 5E1IA 1RP8A 2JB5H 4BI5A 4AGQA 3GKZA 1CFMA 3U30C 2E47A 3UTSE 1DJGA 1D9KA 4D6IA 1I8LC 2IAMD 4JRYD 5FGRA 1MCBA 4TV5A 1JPGA 2YD9A 2YIHA 1AHWA 5F2MA 2R24A 2P10A 1IX2A 4D2NA 4NBYB 3LXCA 5I18L 2A6DB 1NA8A 3TN3A 3BZDA 1DFBH 3GUTA 2DSWA 3RDKA 4XBGA 2W9EH 3HFYA 1AXTL 4FAMA 1RJQA 3CJPA 3QSKB 3OF6D 2FD6L 2B4CH 4X50A 2X4QA 2FVLA 3VI4F 3BMVA 1KNOA 3ES8A 4G7VH 1DQQA 5BU6A 4FD0A 3WMSA 2JIXA 1Q6CA 4PJFE 1MVUA 4MA3A 2VFFA 3VNLA 5HDWA 3N3MA 2TRYA 4AV0A 4ZFGL 3ONCA 3KW3A 5F1IA 3C2VA 4K2UL 1EFXA 4BA0A 3HMXH 1F2XK 5CCJA 1L7IH 4MJ2A 2GG1A 3CQPA 4NNPL 1FWNA 1L9OA 4FXGB 4AITA 4BQ5A 5BXTA 5CPMA 1DE4A 4D6EA 1NBYB 3VINA 5F7NC 3ZXAC 4YHNA 3MI2A 1X7TA 3ALWA 3GJEA 3P4MA 4XVSH 1UJ3C 1DCLA 5K59F 4D9QD 2FBOJ 2YR1A 1BKSA 3QRBA 4CN4A 5FGBC 4UQCA 4OF8A 3GNPA 1DQXA 3VI3F 4YDJA 4R9XA 3TIDB 2OV0A 4OJFL 1O5QA 2X4TA 2CWXA 3L9EA 2IOIA 4OZGE 2B0MA 2VN6A 4EI6B 3FCUB 1SYTA 4EE2A 2XQ0A 3D0VB 5HI4D 5L2JB 4CQ8A 1J5OH 4GQZA 3HMWL 1JPFB 3UZVA 4NM8H 4ZOBA 3DTXA 3TEUA 3I4EA 5F0MB 2DQFB 4JNXA 3CDFA 4N2HA 2P42B 2EO9A 3NJJA 4HLZH 2UVFA 4F7CB 5I17B 5I6KA 3UAJC 1C08A 2ARWA 2BBFA 3PL6A 4Q8VA 1IL1B 1K3IA 4AM0A 2ZSWB 1CLVA 1MWAB 1BF2A 1ORQB 2W65A 4FPSA 1D6EA 1QXLA 3B7SA 4HG4K 3DAQA 4WVXA 3X11B 1T83C 3EKZA 2F53E 3T2LA 5I07A 1FLRH 3B37A 1R3KA 1RZJC 1S2WA 3GMQB 2CAKA 3LMYA 3TV3H 4IQLA 3CZLA 4N8VB 1ZGLA 1SOSA 2UY2A 4L56A 1DQLH 1K4DA 4UT6H 2NQJA 1P7KB 2NY1D 2Z3FA 4XP6H 4ZFCA 3TJHC 3LZRA 2XZQH 1F3DH 2AK4A 1OM0A 5FYKU 1A7OL 5E5UB 2WCAA 4G1MA 2A0LC 2AEQL 5GXBB 3QYQA 2ICEC 1HK6A 4H13C 1XZWA 5J1AA 1CICC 3L1EA 2BSCA 1N19A 3WQ8A 4R0LB 1PCSA 4N2OA 2W79A 3O9WC 4RDYA 5GHWL 1G0DA 4NZUL 2YFNA 5AYIA 3JTSB 3N40P 1QBLH 1BWMA 1RK0B 1HJSA 3L2IA 2D7TH 2K9FB 2R82A 4LDLB 1TJMA 2JB5L 4XWOD 1RZ8A 1ODAA 3ZVHA 3ZDZE 4PJEF 1VB9A 4BQ8A 3JYCA 3PNWA 4X4ZA 4WOZA 3CZSA 1XTMA 4PYHA 3CG8A 5IG7B 5BRZE 3UA3A 2MPVA 5HGHB 4UQ3B 4DZHA 5BRPA 1KCLA 4F9JA 1TTJA 3UJFA 2D0HA 2HKHL 3EOLA 4QT5B 2PS2A 2CJTA 1DFBL 2L0DA 3KBHE 4DKAA 2XWBA 4Q8WA 1JZ4A 5G2NA 1XIMA 5FCUL 1A4KA 1X7FA 2B4CL 4IBVA 3R13A 2QDHA 3KVJA 2MQ0A 3HGSA 4G7VL 4R96A 1S8DA 3S5LG 4UU9B 4XPHH 4YPGB 2YGOA 4B5EA 3FCBA 3AIBA 1RXOB 3QO0A 2KLSA 4FFVC 3QEQB 3H4GA 1HJBC 1NAL1 2OCZA 2MFNA 1B3OA 1A4AA 1BD2B 2ZQKA 1IE4A 3EYQC 1U5HA 4OF7A 1EA9C 1M68A 3HMXL 2D3VA 1L7IL 4J6IA 3HNSH 4LAMA 2ZKWA 4JFVA 5EUOE 1KIRB 3OKKB 4HIBA 1ZLUH 3KPPB 3BVXA 4OJYA 3W37A 1ZPLA 4DWDA 3BOFA 3GXNA 3IKCA 4LARL 4EVNB 2VN5A 3CH1B 1A3QA 3OXRA 2NY0C 4WO4D 4XVSL 2VLME 1JCJA 2P76A 3G6JF 2XIOA 1UR4A 4E41D 2G2NA 3U2JA 3RX4A 4TVCA 3FB6B 4P07A 1ONWA 3SECA 1OZUA 4HV8B 1YQVH 3PV7A 2EE9A 3ABMB 4RLIA 4BQ9A 4UT9A 4QI3A 5IBTH 2Y85A 2CEQA 1MCCA 1JS4A 1XG4A 3CQ0A 4JFXA 1J5OL 1E9LA 3RZCD 2FZBA 1NCIA 2LT9A 1W5OA 3W88A 4UTFA 2X6AA 3FNKA 5E9XA 4L6DA 1TCRA 4PGJA 2WLYA 3L66A 1D2OA 4EI5D 4LCQA 2JCWA 5ID1A 3V1PA 2WXQA 2A38A 3F2BA 2QGYA 2J43A 3WLTA 3BYTA 3LZNA 2ISDA 2YUWA 3MY9A 1H0DA 1VZIA 1NP2A 1I9JH 4FDWA 1QHZA 5EA0H 2ZP8A 3A12A 4F8OA 1I4FB 5SV3A 2XFWA 4H5SB 4XAWH 3SCPA 2XTJE 1A6UH 3TV3L 4TQ8A 3ZZSA 4WDWA 1VKXA 4NJ9H 3D5HA 4APXA 3W27A 4HF5H 1FDLL 1P6CA 5XIAA 4YOKA 4UT6L 4LPVA 4HPYH 1N8IA 1X5FA 1LTXA 4XP6L 4JGDA 4GZIA 2FQGA 5CEWA 3EKLA 4LBEA 4QHKJ 2EDLA 3LV5A 2C79A 2X2YA 1T5WA 5F9JB 1XGUB 4LS2A 2HCVA 3MKGA 2GBAA 1U58A 2BOBA 5JU6A 1OEZW 2XQYA 1Y6KR 1FE8L 1U6AL 4QCIA 5IFPA 1OF6A 4L4TB 1FUNA 1EXPA 2GK0A 3QIUB 5A6BA 4DY1A 1SM9A 5C08D 4OD2A 3WJLC 2NW2B 1ZE3C 1A14L 3FCSB 5B3NA 5ECVA 3S36H 3MO7A 1J10A 2D7TL 1L7TH 1L6YA 1FZMB 4JZOA 1QD0A 1CCWB 1CFQB 2BO0A 1ZV2A 2Y6TE 2WXOA 4TMBA 1AP2B 2HBXA 1NMCC 5HHPA 3WELA 2OXHA 1YN6A 1ERNA 4EF9A 1S5MA 4LP5A 4ZTXA 2ADJA 4UUIA 3U7YH 4NNCA 4TX6A 3L65A 1S1PA 5B7FA 1QUNA 3D0LA 3HFMH 3KOZA 1T6MA 3VKAA 1ULVA 3GMRB 2J1ZA 2RBLA 5BCAA 5IBXA 1L6XA 2E77A 1S2AA 1T4KB 2XQYG 2XH7A 4OCNC 3NZQA 4X5QA 2QHLA 1DEEA 1NCJA 3D3AA 2VXQH 4C6FA 1H8OA 1KIUB 2DQCH 5HHNB 3T71A 3KHJA 4YSEA 3E49A 5BQ7A 3QIBC 5CPTA 4FLRA 1R3WA 5I2IB 1Q65A 1AXSA 5FA4A 1ZLSL 3QH3B 2QSVA 2YAFA 2XVGA 1ADQH 2MHAA 4V27A 2D4DA 4KGJA 1MCRA 3WKMH 4UMGA 2A7RA 3HNSL 1ZOXA 1MVFA 3H7UA 3QWOB 1H8LA 3BUDA 1D5BB 3VTRA 3KVKA 5C2XA 1HHIB 4LCCA 5J6HA 1L0YA 2YEZA 2R0ZH 3KXFA 1P4IH 3AMCA 5JHDD 2HUEA 5T5FH 1H8NA 5KSBA 3SCUA 3EYOA 5TGBA 3S98A 3KNBB 3HAEB 4FG0A 1YMHB 1PIGA 1LQ2A 3FCGA 1KJVA 5A2AA 1SJBA 4KQNA 1P4UA 3RFZA 2WMPB 4KMTH 3WEXB 1JF1B 3HS0B 5FDWA 3EF7A 2QSQA 2Q8XA 3I85A 1YQVL 1YBQB 2X6MA 1Q7MA 4H9VA 5IBTL 3D34A 1OK6A 2OZ4L 4K8EA 1BZ7B 5FACA 5JW4R 1DEDA 4EWND 2WQRA 2GYSA 3EX3A 5BS0E 1KFKA 3B83A 2ZXBA 4JZJC 5DMNA 4L3CB 3QC3A 5G55A 1DBBH 1E2ZA 1EXUA 1G6RA 1E0WA 4MBOA 3QQWA 1JGEB 2WBJC 4QS6A 1D5MB 2O61B 3LSBA 3B0XA 2YZ1A 5F1NB 2X3AA 4E2VA 2BDNL 3PV6B 4X0KA 2A77H 3HE7D 3DENA 4GW1B 2VEMA 2YAHA 3VKBA 1GW0A 4GUCA 4R85A 1VFFA 5EA0L 1J5IA 4JNMA 1W72B 4YBLB 2EDWA 2OI9B 2YCIX 3QCTH 4HIPA 3B3IB 4XAWL 2HFFA 2AV1B 4BE5A 4FI4A 1A6UL 3KWXA 4G2AA 4BKSC 1CLYH 6REQA 2FH6A 2E4FA 4HPYL 1K77A 2XI9A 5LCVL 3U4EB 4M9PA 2BERA 4ZFZB 4FQHA 4KDTA 2DLGA 5DD1L 1MWOA 2EUWA 1DDHB 1W16A 4GRLB 2DSZA 3W72A 3NSNA 4NKMA 4DWSD 4YDVA 1Z9PA 3GHPA 1E8YA 5A43C 2ZTJA 4XMUA 1DZ0A 2NDGA 1F4YH 4KTGA 3KVMA 1J9RA 5CZKA 3GSXB 5CCZA 1K5NA 3S36L 5E23A 4AT6A 2EF9A 4LUTB 1L7TL 4QHLB 4HWBA 4P5TA 2C26A 3K72B 4MY8A 5U4NA 3ALPA 1R0AH 1VGEH 5EOCH 2VDOL 5EU9A 3MRHA 2IF7A 1JK9A 4XZWA 3CLEL 4K3EH 4Z7OB 2QBWA 2OMYB 1BFNA 3P93A 3V7AE 2JJVA 4H7VA 4E5TA 1REQB 2ZDSA 5I74B 2JCCF 2H3XC 1G43A 4PJ7E 3U7YL 1W5MA 3IMTA 3CZKA 1OY0A 5INDB 5HWJA 3DOPA 4POUB 1CFSA 3UO8B 2GUYA 2LU5A 5B4MC 4CVXB 1BX2B 2GGIA 3N1AA 2VMDA 1KLFA 1AZBA 3QXTA 3FJ4A 3MUIA 2VXQL 2DQCL 5A3HA 2BGNE 3LZOA 4OFDA 2IGFH 4CDGC 2Z34A 4NI3A 1H3PL 2MRYA 3A24A 3L7FA 2J4WL 2EILB 3GTVA 3FT2A 1ADQL 5FA3A 4V1XA 1ISWA 3G0SA 5BXSA 2VJ8A 3BT2L 3KEDA 3WKML 3CVHA 3GSNB 4B9GA 1K6AA 2C9AA 3TTEA 2NTFA 1O12A 3BUYA 2C1PA 2VC2H 2PZ0A 3LGGA 3EOBA 5DMGC 4AY7A 5ICUA 4M03A 1NGWA 4DK6A 7XIMA 3B5HA 2R0ZL 3DH7A 5BJTA 1P4IL 1J8HD 4OF6A 4QRUA 1O75A 3TWAA 3S8FB 5I66B 5T5FL 1ZU8A 3AS3A 1C91A 3DECA 5E2JA 3L1OH 5I16A 3MQIA 3NQ6A 5DQ9B 3WLSA 4F0LA 2XWJA 3L3OB 2FBRA 3E74A 2YFOA 3KYNB 3ZUCA 4JBRA 4RRPM 2J44A 3PWNB 2PTXA 1V7AA 1QNZL 4G8GA 3E6FB 4I48B 1X1NA 3S35H 2EQDA 4NN6C 1GMEA 1KIQB 2BNRA 1JCVA 1YEEH 4ZOEA 5FDYA 1BQUA 3OGCA 3RUGB 1I1FA 4XXDA 2HK0A 4MA1C 1DBBL 1TJHL 5I9QC 3BQ6A 1S7UA 3T3MF 1M03A 2EYSA 4I5RA 1OZQA 4F8LA 1JPHA 2WWKT 1ED3A 3MB9A 2IWFA 1C29A 5C0CA 2JH2A 1TXKA 3TNMB 1S7TB 4ANWA 3IGFA 1KR1A 2QKIC 3OWEA 5EOTB 3ARGA 4YHMH 2QSCH 2Z31C 4ODUA 2YDQA 4JAMB 3LVEA 6PAZA 3E9TA 1MI5D 2DT1A 4KRUA 3SGEH 2G3ZA 2GSIB 4MF4A 1U8CB 4TSCH 2Z6IA 3V0TA 1JULA 4NUWA 3ZU8A 2J71A 4K15A 4L5FE 2WQSA 1QPOA 2WBGA 3BPCA 3VRJB 1MNZA 1KLUA 4YDKL 2R69H 4NYLB 3KCPA 4LF2A 3F83A 3SRKA 2RH9A 4IICA 3CDZB 3PWPA 1KN2L 4HCHA 3AICA 1IWBA 4M61A 1PG7X 3IIVA 3HOGA 4D7PA 3LCLA 3VRIA 4PV9A 1NBCA 1VFOA 1YW1A 2P49B 4M5YH 5B1AB 3NSXA 1YLBB 1F4YL 4HGXA 4XP5H 1RU9H 2B9BA 4WWKC 4IGBD 4ZE4A 1NFBA 2CUAA 4BS0A 1DANU 4H1LB 4TTDC 4B9KC 1SQ7A 1SU5A 1R0AL 1T0MB 1VGEL 4IIEA 4EIZC 2C7FA 4AHQA 3H7BB 3ICJA 4EZLA 1CL7I 3DVNB 4PGEA 5KVFH 4ZFMA 4PJDE 5IK3B 2AMXA 2BP0A 4JKNA 5IMLA 3QDJB 5LGYA 1HHHB 4WLCA 1FORH 4YHIA 4Y2WA 4HIQA 4NENA 1NPNA 1UVQA 4FG6D 1EGJA 3B7TA 1BZDA 1JHTA 4KV5E 4P4KB 2V3GA 3B8UA 2F54B 3ZQXA 2Y25A 2ZG3A 3QNXA 3TXVA 2P5WA 2ATKB 1G7QA 1XH1A 2WPGA 4MUPA 1YMMD 2RA1A 3WLBA 1X5AA 4NDMB 4FQLL 2ZUQC 3C2EA 1P43A 2I1OA 1OG6A 2GC7C 2QUUA 3U83A 2IGFL 3JV4A 1A7QH 1KB5L 1OP3H 5FYKD 3X1NA 1QFWI 4LSDA 3AZRA 5IQOA 4CA4A 2O6DA 3QWNA 5JIIA 1FNHA 1O6SA 1S9YB 3VA2C 3RRAA 4JIRA 2BP5M 1POJA 4BSVB 3VFWA 5D70L 3AIRA 3VD0A 4L64A 2VC2L 4NRSA 3OAUL 4EUPB 1IAMA 4L1GA 5ANME 4BI7A 1OFBA 1KACB 5F7FA 4RAHA 3RGHA 5SWUA 3F5KA 4PJCA 4YSSA 3RIFF 5ADOL 4JO3H 3N4AA 2Z1WA 4DP1X 1IXQA 4ZUWB 3C6SA 4F93B 2WKGA 3KCLA 3GXPA 3A47A 1IIKA 2CZVA 2OPJA 3P2DA 4HIHB 2OR8A 2MMXA 3PZQA 1YEHH 4Z0BH 3FU0A 4F37F 1ZS8A 4BZYA 7TIMA 4N9CA 4JTCA 3MV9B 3F6JA 3ISRA 3AAZA 2NY5H 1FH9A 1VHCA 1YEEL 1ZS2A 5J5DA 4H6RA 3RWGB 1ZVSB 2EICA 1T5XB 2PC4A 2DUAA 3AXHA 2JQAA 3PWVB 4JVWA 1JFXA 1HXMA 5IIEA 4MAYC 4A8NA 1YZZA 1T0OA 4ZYKB 1E5AA 4NHVA 3AI0A 4GQBA 5JOPE 3K0WA 2AGTA 2Y3NA 1U8IB 2QSCL 1O5DT 3EDKA 3EBAA 3FXYA 2CKBB 3LKPB 5LIXX 3LSCA 2H0JA 4UC5A 4QMEA 4CNIB 5EV7A 2KHAA 3ILQC 3VTMA 4EJ1C 3BIBX 1RZIB 3FJNA 2NLYA 3DK2A 1XLFA 2FKPA 2OB3A 1OVDA 3FO2A 1GSMA 2BMKA 3TW9A 4LSQH 4P8UA 3I9IA 4XZLX 2R69L 3T0AA 3ZTJG 3GNMH 2WSPA 4KFZC 3GSWA 3EXLA 3AAMA 4PLJC 2MCAA 3O0FA 3I74A 1B6DA 3VI3A 3CU2A 3V0AC 2VABA 4KTDH 2AZUA 2F1AA 1QG3A 4I2XB 3LS5H 2ZXQA 2WC3A 2H3NA 1OFQA 2PW1A 5JW5B 5C0BD 4IIHA 4L29A 1C7TA 1RU9L 1X9RA 1SFJA 1K6QH 1T03L 1H6EA 1NTDA 3HC0B 4M56A 4ORIA 3PWJB 3GFYA 1N6UA 2FB2A 4JPWH 5BVPL 4LUJA 2BY1A 4XMLL 3RL1A 2WO5A 4RE3A 4ZQCA 5KVFL 4YHEA 3X1FA 2YAEA 2X6VA 2CO7A 4F8NA 4RGMC 5DXXA 5LBSL 1HL4A 1KBIA 1QNRA 1BOYA 3LKNB 3SDAB 1MFUA 1H3GA 4H6EA 2RGSA 4WCYL 4OAWA 4FG2A 2IUZA 4X7FC 3GK0A 4JDTL 1FVDA 3H9SE 4NQSB 5FJUA 1DVTA 2VL5B 5CC6A 4MPQA 1N7KA 1XGPA 2AXGB 4XD4A 1Z5HA 3I6GA 1DVFC 1KFGA 2FJSA 4YZFF 2QJMA 3RM8A 4XNUH 4WK2B 4LANA 3HE6A 2YL8A 3LGDA 3STPA 2EJAA 3BSZA 1XYAA 1I8IA 5FM5M 1S5VA 5A8PA 4R8WH 4JFDE 4ZUVB 1GZPA 1OT4A 4E2BA 2ODIA 3RX9A 4NQCA 4WTXA 4OOZA 5FGCE 2V2XB 1ANUA 3FCTA 4GQGA 4UTWC 1AD9B 3SDDC 5CWSB 3L1GA 1FZKB 3DG7A 2EAEA 3NG3A 3MYJA 3SZKC 1COBA 2JJTA 4PJEA 1ZAIA 3FO9A 1Q8JA 5LHEA 1KCUH 1AHKA 1DDTA 3W9DB 4NN5B 3BW4A 4HNTA 1UPMB 2RAGA 3S2CA 2AQPA 2JK5B 4Z0BL 1PKMA 1W6LA 1FNAA 5LXXA 3EBVA 4NJIA 2WK2A 4PJ9B 3DMMB 1A6PA 2NY5L 5GZNA 1HQRB 4HU3A 1BQLH 3GDMA 5B1JA 2HA1A 3VOIA 4O0QA 3CSTA 1X4ZA 1IAKA 3ARTA 3H70A 2OTWB 5IDZA 1BF6A 4QHPA 1OD7A 1E0VA 3TFBA 1JCXA 2XIBA 4Y9FA 3U2ZA 2UZYB 5KSBF 2HAZA 3IWUA 5K5YA 3K2IA 5HDRA 3QAZC 2C9SA 2B1AH 1J0YA 2AOSA 5TDPA 3ARUA 1DVUA 3CVDA 4AGOA 1U1JA 2R8WA 3MS8A 4A7UA 1U83A 2D20A 3GDCA 4LBSA 5FB8B 1TREA 5B1BB 2Y8VA 3VAEA 4DLFA 4JY6B 1ZLPA 5A3ID 2UY7A 4LSQL 2IH3B 1ZPUA 3WTWA 1AJ7H 3LN5B 3D39E 4GT7A 4JL1A 3WMBA 3L17A 4ATTA 1XR8B 3DGBA 3WKPA 3LEVL 2OMVB 3GNML 1UT1A 1E73M 3KJ6L 1P1VA 1B3IA 3HZKB 3IDJA 3BZ4A 3G6JA 3RTQD 5G4OA 5C6TL 4HA4A 3MLSL 4F2EA 3BXWA 1RZGA 3H7VA 2YBRB 3IJEA 4KTDL 1ONQB 1ZANH 2E7CA 4P5MB 5K39B 2O7QA 3MBEB 4DGIH 3VDCA 1T6WA 2BWGA 2OU4A 2QDVA 4LSPL 1MFAH 5DMJB 4LASH 4GMTL 3X3FL 1WUZA 4OIBA 5JQ9A 1ICTA 2HPOA 5FL1A 1DSFH 2FL5B 4PJ8B 4JPWL 3RVUC 1XF4A 4FEMA 3FUNA 1X44A 2G3MA 1O5XA 1R5WA 1RZJH 4F2FA 3UJEA 4PVMA 5C0IB 2YW4A 2PGRA 4WIWA 3PR2A 1E51A 2YB1A 1CZ1A 2L8AA 1K1DA 4Z7UA 4PW9A 4WW1A 3ZE1F 1ZEAL 2KPWA 4OZOA 5EBLA 3JR2A 4UTCA 3D09A 3WYRA 1FZOB 3FQUB 3QDHA 5DHMC 4ASTA 4YHKL 2X0SA 4LOVA 4NX0A 5JPMC 4NCC1 2QDWA 1FO0A 3WNOA 4IW4C 3MQTA 1P0KA 4ZS7L 2ENQA 2HN7B 2IQTA 1IGYB 2QDDA 1JD9A 4UTTC 2F1EA 4R7DA 5CF3A 3U25A 1TPDA 4TIMA 4L7ZA 4JTHA 4P4RA 1RBLA 5LHFA 4HGKC 3ESMA 5G2HA 2DKMA 1AQKL 5GZOA 1GK8A 4RDWA 1UD3A 5IHSA 4N6EA 1BQSA 1ZCOA 1GGTA 2K3HA 3GS7A 5BU9A 4R8WL 5IQ7H 3WMQA 2XVBA 3CZ8A 4WWOA 4HPHA 5C0AB 5I1DA 4XX1G 2HTKD 1XIWA 4DOHE 4QM1A 3HNVH 1BZOA 1MCFA 2O4MA 4PMYA 4C54A 3T0WA 4PSPA 3W83A 5L2KA 3WUBA 1BGXH 3TM6A 1W5QA 4IGNA 3LB6D 3PC0A 4CGTA 4MA7L 4G11A 4YBQD 3G1FA 2INEA 5D7LA 1M2OA 2A6NA 2QVKA 3CXOA 1NGYB 4QXUH 5BOOA 1I7TA 3DOHA 1NDVA 3AITA 3UIZA 2Y4SA 4MKSA 1SLVA 4F9PA 2X2JA 4CJ1A 3WD0A 4KQ0A 2Q10A 4IFKA 4CNOA 1OARH 4HQQL 4AG4H 1LUCA 3CMGA 3MUGB 3U1PA 2XTJC 4FQXC 5HI3C 2OX1A 1A6WH 4B7LA 1B9ZA 4N1EA 3HRZB 2EIDA 2WWOA 1K03A 4C6QA 3TN0A 3D08A 3OPSA 5DSCB 3OC8A 4K8RL 2B1AL 2DQTL 3TTOA 3WF3A 1D5ZB 3GJFB 2EDFA 3FTSA 1WITA 1JFQH 4PRPB 4OZFG 4UZSA 1TF4A 3T55A 1KFWA 2WHLA 4W86A 4Z0JA 5F7BA 4A3YA 1UXSB 4PB3A 3OPUA 1AJ7L 2H9AA 4QGCA 5ERWA 5REQB 3V5DA 4S2SA 1QRNE 1MFEH 4WHBA 4XAKE 1QZNA 1YEFH 5IW1B 4U3CA 3Q37A 3VUSA 4A7QA 4PJ5D 1I1AB 3WDQA 5A95A 3IJQA 3ZKQD 2XXCB 1BZQK 5AUMB 5C07A 3CX5K 2QELA 3WBEA 4LV9A 4LAQL 1JPSH 4TN9A 1FRBA 1ZANL 5GSVA 5FK9A 5C09A 1SJCA 2D7QA 4NC1E 1DXEA 5AB9A 3TVMA 5IVXE 1Q7ZA 2CLLA 1B5TA 1MFAL 4LASL 4AY0A 2AQVA 1OQXA 3R8QA 3F7LA 5E0QA 1LROA 3LNGA 4HSNA 3VDHA 5FUCE 3T1FB 4DJDC 2V9RA 4AX7A 5FCSH 6TIMA 5E2UH 3ORJA 1IAII 1DJZA 3LDBC 2EJ1A 5E95B 4CQ9A 1CVSC 4K7PX 5IF0A 1RZJL 1P7TB 4WY7H 3ME0B 3V0EA 2OP4H 4Y9AA 2EVIA 2V33A 1JD7A 4I13B 4UDUA 4OF5A 4AIXA 3H2FA 3GH5A 3CL6A 4I9JA 4BK4A 3BJFA 3WUWA 1U8OA 3GFUA 1IM9D 1GJUA 4O57A 2FDBP 4OJFH 3VAVA 3TWCH 1WLHA 4H88L 1BEXA 5DA4A 4U3SB 5DX7A 3ALFA 1QSEA 1RZKC 2NV1A