1KBBA

Mechanistic analyses of catalysis in human pancreatic alpha-amylase: detailed kinetic and structural studies of mutants of three conserved carboxylic acids
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQAVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALPHA-AMYLASE, PANCREATIC
publication title Mechanistic analyses of catalysis in human pancreatic alpha-amylase: detailed kinetic and structural studies of mutants of three conserved carboxylic acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kbbA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kbbA01
4EK7A 4UCFA 4CGTA 3IK2A 4QCFA 4GQRA 3CUGA 1VFFA 2WMFA 3DX3A 4Z2HA 3GBDA 3VGEA 1JF5A 2WMIB 1QI3A 4W84A 5EMYA 4PUDA 1UH4A 1FHDA 3PZNA 4H2CA 1R46A 1HJXA 1QI0A 3EJTA 2V3EA 1MW2A 3FXYA 1E6PA 4B3KA 2VCAA 3AIEA 1W9XA 5HXMA 1M03A 2WBKA 1VB9A 4MNJA 1JD9A 4DUWA 5ECUA 2JEPA 1DWAM 3GNPA 4WK9A 4P8UA 1BPLB 1RH9A 1G5AA 2J7CA 3EDKA 3SIMA 2PBGA 4OKDA 3EYPA 1CNVA 4AZCA 3VIOA 2GDUA 3WNPA 2WB5A 3VSUA 4JKKA 1ODUA 1TR1A 1ZL1A 3VVGA 3WD4A 2ZX5A 5JBFA 1H2JA 1NQ6A 3BCFA 1JG9A 1CXIA 3PTKA 3CLWA 1EHAA 4AD2A 3AHTA 2V3FA 1ZJBA 4W8BA 3KL0A 1KFWA 4MAZA 1UWQA 3AS3A 5CPTA 3NYDA 1UHVA 2GJPA 1B3ZA 4PMNA 1DEDA 4D6IA 3PZOA 4D71A 1EO5A 2XTKA 3U5YA 2X2HA 4W89A 2VTFA 4BQ5A 8CGTA 4U2YA 3AROA 4BQ2A 1MW3A 1HVQA 4UFIA 4PCSA 3VDBA 2XHYA 5IHRA 2D22A 2NW0A 1C8XA 3W6LA 1UKPA 3K8MA 2YDRA 4Z2KA 3D4YA 4PMOA 3RO8A 3G6MA 5IXEA 3U57A 1MQQA 1W1PA 4PSRA 4S3JA 3GNOA 4UFJA 1E1EA 1OD0A 3DYMA 3HJEA 3WEOA 1XD0A 1DWGM 2CBIA 1VRXA 3SCRA 4CCEA 5HPCA 3AIRA 3WL0A 2GDVA 3GXIA 2EXOA 4JHZA 1W1YA 1Q4NX 3TTSA 1ISYA 1JXJA 4ML4A 3WMCA 2F7QA 1CECA 4U5IA 3W24A 2F7OA 3VMNA 2FGLA 2TAAA 1R87A 1XRVA 1V3MA 2DQXA 2O9TA 3T09A 5IFPA 2WVUA 1UR9A 5I23A 3OGVA 2XVPA 2WYSA 2WHKA 4GZJA 1QX1A 3T2PA 2VR4A 2WMHA 2W4XA 4IUGA 3MMUA 3AIBA 3ARUA 3L2MA 1BYDA 5DFAA 1AVAA 2OLHA 2WC4A 4OBRA 3S5YA 3OGRA 1U2YA 2OWWA 3MUY1 5FCZA 4W86A 4MNMA 4MDOA 4QLLA 4P7LA 1JZ7A 3O9NA 3WH9A 3ZMRA 4HA1A 1VJZA 4UTFA 3DHUA 1MYRA 3AHYA 1HP5A 5I77A 1JIBA 3VPLA 4C7GA 4AWEA 2BFGA 4D6CA 2UY3A 3K4DA 2VI0A 5A6AA 1HKJA 4WSKA 1ZBWA 3CZJA 4UFLA 1UZ4A 4GO9A 2VURA 4WLCA 4JFSA 4ZXLA 3AS1A 3JUGA 2ZICA 2W66A 2WAGA 4W7UA 2WKLA 2J7GA 4GZEA 4TTGA 2PF0A 3WD1A 4J3SA 5GQBA 4W8LA 5D9NA 1UR1A 1R47A 4AW7A 3POCA 3WELA 1UR2A 1C92A 3CUJA 4FK9A 3N04A 2ZWZA 3CBWA 2NSXA 4WKAA 5CLTA 3B9AA 4HA3A 2BVTA 2V38A 1TQTA 4TTUA 3BAWA 3GXNA 1E56A 3O2LA 1D3CA 3UERA 2QPUA 2XSBA 4M80A 3CZSA 2EPKX 3MS8A 2IXUA 4PMZA 4YPJA 4PMDA 5LA1A 1KCKA 3GXPA 2VRQA 3A5VA 3GH7A 2DSZA 5M17A 2ZOXA 3S2CA 3K46A 1CLXA 2DSVA 4AD3A 4UZUA 4D6GA 1V3KA 4NXSA 3CUIA 1UA7A 3EJPA 1J0KA 3VILA 4PMQA 3BCDA 1JXKA 5A3HA 2QV4A 2EO7A 3EDFA 3SUTA 3RILA 3U7VA 4LX4A 1EQCA 4MDPA 5AC5A 5AYBA 3D4ZA 1KBKA 5A2BA 2BY1A 3NSXA 2Z1SA 5I6SA 4GQQA 4JHOA 3ZOAA 1DWJM 1E0VA 2CYGA 3K4AA 1UUQA 3PZVA 1VJSA 3EDDA 2WC7A 4HZ8A 1OINA 4MNLA 1E9LA 4H41A 1UD8A 1W91A 5HOSA 4J7RA 1ECEA 4NF7A 2GJRA 3WY2A 1WDPA 1XYFA 3MMDA 5GPRA 5A95A 4M56A 4U5KA 1GNXA 5CGTA 3WH5A 1W9UA 2JFEX 3THDA 3PZQA 1CGYA 3WKZA 2EAEA 3AS2A 3AIWA 3IAQA 1D7FA 3SUWA 3RCNA 2OYKA 2GUYA 4A3YA 1PIGA 1QVBA 4QCEA 2PI6A 3OLGA 4ZEPA 2BY3A 1ZJAA 1HT6A 2ZXQA 1E15A 3CO4A 3WNOA 4CD5A 1W9PA 4MNKA 2CCRA 1E5NA 5CPQA 4ACYA 2VQUA 4LQ1A 3SCOA 2PWEA 2CEQA 4AZGA 4IISA 2O9RA 4FNQA 2WMIA 1H5VA 3KZSA 4F9DA 2EABA 1UD6A 4H8UA 2FE0A 3W4RA 1QPKA 3VGBA 1JNDA 2XFRA 5I79A 2ZUVA 1HVXA 2VVSA 3W37A 4ATLA 3UG5A 3AIUA 1TVNA 4NI3A 1X6LA 4W88A 3EBVA 1LG2A 1K9FA 4BCEA 3FNDA 1ZBKA 3ARQA 3VX1A 5A8OA 3N11A 2VT0A 5A8NA 1E6NA 1US2A 2UY5A 4HMDA 4PTXA 4AMXA 4BF7A 5JBEA 4FLSA 3B9EA 1V6XA 4MB1A 2X8RA 2CETA 1WDQA 1CDGA 3WUEA 5HPOA 1UKOA 3MU7A 4WKHA 4HOZA 5DEZA 2FH8A 3WD2A 3AMGA 3PZGA 5M5DA 2C8NA 4GO8A 1WNOA 3WY3A 3WDIA 2VNCA 1M01A 3ZJKA 4TXEA 1V3LA 2D3NA 2EPOA 4CN6A 1OT1A 4LYRA 3VM5A 1LWJA 1TQVA 1I75A 3T0DA 4J28A 2Y5EA 4BA0A 3WMBA 3K1DA 2GSJA 2YDQA 3FHAA 1J01A 4RE3A 4RE2A 2J7BA 4GI6A 2CITA 3AHXA 1E4NA 2J8FA 1JAEA 2XN1A 4P8VA 2VQTA 3VINA 4UZSA 3MUZ1 1UQYA 1QNRA 3LPGA 1GZJA 3W0KA 1CYGA 2EACA 5TD4A 4PTMA 5E0CA 2JIEA 4K68A 4HOXA 4KRUA 3BVXA 3N18A 5BXRA 4W7WA 4S3KA 2YBUA 4JIEA 3ZO9A 2OYLA 4D1JA 3K8KA 1GOMA 1G94A 3WN6A 1TUXA 5M3WA 5FOOA 2ZWYA 2WSPA 2QF8A 2WHMA 1B0IA 2WMGA 3NSNA 1G9HA 3WNLA 1J0ZA 1K9TA 4OGZA 1D2KA 4ZXOA 3S6TA 1PBGA 2A3HA 4P8XA 3T2QA 1HX0A 1OB0A 1WAWA 4AD4A 2XGIA 4YHEA 2D73A 3N17A 3HG4A 1J11A 2WVSA 1KR0A 4YHGA 4QLJA 3W6MA 3WNMA 1WZKA 1H49A 2G3IA 3SCSA 2WVTA 1HNYA 4UQ9A 2PB1A 3WMSA 1CBGA 3ZT6A 3M7SA 2EQDA 3DDFA 3RM4A 1UG6A 4J3VA 4AMWA 5FL0A 5E9AA 1UWIA 1C8YA 5D9PA 3VO0A 3FAWA 3U7BA 3NCOA 3B9DA 3SUVA 2W91A 4PYSA 4D1IA 1XD1A 4B9ZA 4PBGA 2WK2A 3IAPA 2ZUTA 4MB3A 1Q6DA 3SCTA 3GM8A 1VAHA 1V03A 1JNEA 4FLOA 1B3YA 4W7VA 1GQLA 1SYTA 3BLKA 1BGGA 1LLOA 3DECA 2E0PA 3IJ8A 2AAAA 2HISA 4MB4A 2G3NA 3DHPA 4DO6A 4AZBA 3AFBA 2WVVB 3VGGA 4Y7EA 4ZENA 2XIBA 1V3HA 1QW9A 4BQ4A 5F7UA 1U33A 1UD5A 5BCAA 1GJUA 3AOFA 4B3LA 2BY2A 4HZ7A 5A8MA 1W9BM 2J62A 1HJVA 1KXQA 3SCPA 3BAXA 3WDJA 2X2IA 1NARA 2D3LA 1TQUA 1OGBA 2X1IA 3ALGA 2AMGA 5E70A 2D0HA 1H41A 1IZKA 5ABEA 3QOKA 1AQHA 2Y8KA 1UASA 3EJQA 4HPHA 1JI1A 4JL2A 2YOCA 5BROA 3KL5A 2FDMA 4DO5A 1R85A 1DP0A 3CZNA 2E9BA 7CGTA 1QBAA 1H1NA 1X6NA 5A94A 3ZR6A 3PZIA 2V3DA 1SR0A 4TOQA 1B9ZA 1E71M 1QOXA 4AIUA 4M1RA 2EADA 2WNWA 3H54A 4E8DA 1JYNA 3AXHA 3NJ3A 2CIPA 3OA5A 1BHGA 3DX4A 4JFVA 4X0VA 3VIKA 1KTCA 2DEPA 5I0DA 5I3DA 3RM9A 3AMCA 1BLIA 3WF1A 4KWUA 1E0XA 5KZ6A 2VZUA 5LA2A 1E55A 4QLKA 2J7DA 3WH7A 4PMUA 2DT1A 3WEMA 3WL1A 1WZLA 4J3UA 3MUAA 2QMJA 4DUVA 1BVZA 1O7AA 1WB0A 2OWCA 4NRRA 1PX3A 4R5EA 3BUDA 1OM0A 1G1YA 4OOUA 4M8UA 3VX0A 4BQ3A 1V0LA 3VIHA 2WMJA 4FLRA 2PWFA 1HL8A 1GONA 1MXDA 1NM9A 4F66A 1VFUA 5C71A 1KGXA 3CTTA 4B9YA 3II1A 3BAYA 2CBVA 4OZOA 5ABFA 1DWIM 2X2JA 2YFNA 4HPGA 1CGVA 1OT2A 1HN1A 1KQYA 2PWHA 3ZT7A 4HZ6A 4LYQA 1VBRA 3H53A 2MANA 4FNUA 3KE0A 4D6EA 1ZS2A 4DWSC 3L4XA 4MAVA 3DYPA 3UG4A 2F61A 3OGSA 1TG7A 4HTYA 4PTWA 3TTYA 1CGWA 3HU7A 1SFSA 2XG9A 5M03A 1TVPA 3UG3A 2D1ZA 1KB3A 1W2VA 1MW0A 2D0FA 4Q22A 1V6WA 1HJSA 4TUFA 2J79A 3D50A 3NDYA 3KLLA 3BUQA 4P7RA 1CGTA 4TVDA 3E1F1 4AD0A 1JGIA 3LX9A 4ZFMA 4W85A 2E3ZA 1EDGA 1JDCA 1GOKA 4GINA 5BWFA 1ZB5A 4PSPA 2ZX9A 1BSIA 1QI4A 4DWSB 1XH0A 3B8SA 3CMGA 3WENA 3RMEA 3ZM8A 2XN0A 3A22A 4DWSD 3N9KA 1OBAA 2AOSA 1C7SA 2J7HA 3H55A 4F79A 1ISZA 2D20A 3CZEA 2VJXA 1SZNA 2WZHA 1H4PA 5A2CA 5BYWA 1LWHA 4X9YA 2JEQA 3WDRA 2OSWA 5JBDA 3S5ZA 2YBTA 4GKLA 1NWUA 1BG9A 3BUBA 5D4YA 2G3MA 4CD6A 1B90A 3VD7A 3A23A 2WW5A 4LYPA 3CUFA 3VD4A 2F18A 4L4OA 2GJXB 2BVYA 1LL6A 3AJ7A 5CZKA 3T2OA 4UNIA 3FY1A 4NZFA 4WJXA 4EAMA 3VKKA 1V3JA 1HJQA 2ZUUA 3RPMA 2G41A 3A3HA 1TQWA 1GW1A 2EPNA 2ZE0A 2Y4SA 1EDTA 2WLYA 1R7OA 5A6MA 1TE1A 2XVLA 4W5ZA 1R75A 2YKKA 1B31A 1M7XA 2X0HA 1I1XA 3ZJ7A 4EE9A 2VUYA 1FH8A 2XPKA 1J0IA 3L4VA 1V6UA 3BUPA 2BXYA 3VU2A 4GXPA 4JFTA 2RGLA 3BVVA 2DPEA 3MSGA 1QNSA 1XV8A 5A8QA 4AZ7A 2ZXAA 3DX1A 3OLDA 1Z32X 1MVYA 4Z2IA 2JALA 2ZX6A 4ATDA 1JZ2A 4HMCA 3QOMA 1X1NA 2QMKA 4W93A 3PHAA 1W9VA 4TX8A 1VFMA 1UR8A 2BHZA 4HU8A 4FF5A 4NZJA 2CPUA 5A8PA 4IM4A 2BXZA 2XJ7A 4P8WA 1NOWA 3M07A 2HVMA 3WDQA 1GUVA 2Y24A 1C91A 1MFVA 1A3HA 4PMXA 5D8WA 3BH4A 4U31A 2EJ1A 2J7EA 1QW8A 1Q6GA 2QLYA 2J78A 1G01A 2YL8A 2V3GA 1XYZA 4JKLA 1V08A 3WY4A 4AZIA 3WQ5A 3K8LA 3O6AA 1V3IA 5I2UA 3WH6A 1GORA 3N13A 1V02A 4CU8A 3RDKA 1XSKA 3QHMA 1LJYA 2ZUMA 2WVVA 4AZ6A 4C7FA 5ABHA 2NT1A 3TTOA 4JKMA 2C7FA 4D6HA 2CXGA 1F4AA 2VCCA 5FIPA 2YJQA 3VGFA 4PMYA 3WSUA 2OYMA 1NP2A 1JFXA 3VTRA 5JIPA 4FNPA 1JDDA 3SCQA 3ARVA 2G4FA 1E40A 1M04A 1GVIA 3A4AA 4KGLA 2C0HA 3APGA 4MADA 4JCMA 1AMYA 2WC3A 1KGWA 3KWXA 3TONA 1YHTA 2F7PA 2XN2A 3SCWA 2W67A 1MW1A 2IUZA 3A6OA 1BYBA 2DSKA 3ZT5A 1PX8A 3BC9A 1WDRA 1BQCA 4JFUA 4JAWA 1HP4A 3UEQA 2VC9A 4W8AA 3L4ZA 5DMYA 4F9JA 1B30A 2ZX7A 1BYCA 2OSXA 3AISA 2J8GA 3BUIA 5FD0A 4AISA 2X0YA 3AMLA 1CGUA 3HG5A 1SMAA 2XVNA 1FP8A 1HIZA 4DM2A 4J3TA 3WD0A 1E72M 3QHOA 5HNNA 1JZ5A 1FH7A 2F1BA 1E5JA 1ZBCA 1R86A 4PMVA 3HN3A 2ZUWA 3VIGA 2DIEA 1Q6FA 4UFMA 4Z2LA 4AXNA 1A47A 4EKJA 3AZTA 4H8HA 1JZ3A 1IV8A 3TV8A 3EDEA 5I24A 1KR1A 1CIUA 1LL4A 3LRLA 2GVYA 5CLWA 1W1TA 3VIMA 3AIQA 1MXGA 1PPIA 1GVYA 5AYIA 3GH4A 5GNZA 2XWDA 1RPKA 1BFNA 3LXCA 3AYSA 3AS0A 4U3AA 3OG2A 1CZ1A 2JF7A 1QI2A 1BG4A 1NOFA 2ZIDA 1QHPA 1E1FA 3F5LA 1C8QA 2D24A 3UESA 1EOKA 4V2XA 3OLEA 1LQ0A 1UKTA 1XH1A 1I1WA 2G8ZA 1V6VA 1VBUA 3SURA 1V02E 4QDMA 4AIEA 4AYSA 1KTBA 5CPSA 3SEPA 3QHNA 2RGMA 2WPGA 1J0YA 3VIPA 3GBEA 4CUCA 1CXKA 2VZVA 2VX4A 3HG2A 4OIFA 3AI0A 1EGZA 5CJ5A 3CHDA 4DUXA 2WZIA 4J3XA 3A47A 3VD5A 5I5RA 1TQSA 2VVNA 3AIVA 1UR0A 2XM1A 1US3A 3FAXA 4XX6A 1NH6A 4MTVA 3UCQA 4MJ4A 5E6YA 3PTQA 4JL1A 3BLBA 3BAJA 1QWUA 4WSJA 3DX0A 1OSEA 3CZ8A 3I3DA 1HWWA 5LA0A 1E4LA 1LL7A 1PZ2A 2J25A 1NWRA 3KEHA 1KWGA 1HJWA 2Y2WA 3VSVA 3WF2A 5DF0A 1GQIA 5DO8A 1XCWA 4AYGA 1XSIA 3WFZA 2PWGA 4FNSA 4PTVA 3SCUA 3ZSSA 4B16A 1BF2A 1GHRA 3FHQA 2CESA 4Z2GA 1G0CA 4XZBA 2YL9A 1ODZA 5IHSA 3N15A 1UKSA 5BRPA 4MB5A 3PBGA 2OW7A 2VX7A 1EH9A 3CZKA 4UFHA 1K9DA 2VZTA 3N1AA 1OCQA 4D6JA 2G3JA 1UWTA 1PS3A 3W53A 4DM1A 1MQPA 3W27A 4L4PA 1AQ0A 1K9EA 2F7RA 1HL9A 3AXXA 1R8LA 3AQUA 4XUYA 2ALWA 4GPNA 3GTNA 2WWCA 4UOQA 2X2YA 3PZTA 4X0NA 6TAAA 2WXDM 1SMDA 1QNQA 3ARWA 3PTMA 4AIOA 2A3CA 3ARYA 4PRWA 4BZYA 6CGTA 3W26A 3WQ4A 1VFOA 2EPLX 1BVNP 3MANA 1EIBA 4FMVA 4HU0A 3RIKA 3AMKA 3CHFA 3MI6A 2YDSA 1PZ3A 3EJRA 3NDZA 1JF6A 3GXDA 4PN2A 1XGZA 2DIJA 3EMZA 3VIFA 5A6BD 4CKQA 1H09A 5EFFA 4NZCA 3MUIA 4OBSA 4AD1A 1NWSA 1HKMA 3CZLA 4UFKA 1OD8A 6A3HA 4NX0A 1VEMA 1J10A 1B3WA 2XVGA 3BAIA 2WHLA 4A3HA 3WEZA 1UQZA 3MSDA 2V5DA 4TVUA 2YLAA 1LG1A 2DT3A 2WM0A 2QPSA 1HXJA 3IGUA 3OIHA 3LXBA 2W63A 1IZJA 1YQ2A 5A6KA 2NT0A 2WCAA 3NIYA 2W62A 1VENA 1CPUA 2WBGA 3VD9A 4HOWA 1E4IA 3N12A 3OZPA 1CXHA 3PZUA 2A3AA 5BXSA 4CVUA 1JYWA 2XFYA 2J75A 1RD6A 3WH8A 3VDHA 4UOZA 3GDBA 1KWKA 3AHVA 3GYCA 2DH3A 1J18A 3OB8A 3WUBA 1W9DM 1Q6EA 2YLLA 4B15A 1WO2A 1P6WA 1RP8A 5D9MA 3WBAA 3VSTA 3BMVA 4TVCA 4CN4A 4N0RA 2WZEA 3RM8A 3I3BA 3L4WA 4IPLA 3OZOA 1TA3B 1JI2A 5CGMA 2E9LA 1FH9A 3D51A 3QGVA 2XUCA 4UQEA 4UOJA 1XC6A 3CH9A 3VMPA 2UWFA 3RJYA 1EO7A 2YFOA 2E8ZA 3AYRA 5CSYA 3ZJ6A 3W82A 4CD7A 5CXPA 1CWYA 3EMQA 2XVKA 3ZJ8A 1B3VA 4AMCA 4ACZB 3CV5A 5A6JA 1JZ8A 3LPOA 1MWOA 4NSBA 4BS0A 5DT5A 3A4WA 3F5KA 1HF6A 5ABGA 3OLIA 5BRQA 3PZMA 4H04A 1J0HA 1GOWA 3UETA 3MO4A 5AC4A 4HMEA 1TFVA 3WDPP 1FP9A 4AD5A 2CNCA 1HKKA 4PEEA 1ITCA 5A6SA 3POHA 4U33A 5LYRA 2F1AA 8A3HA 4D6FA 3BMWA 3ARZA 1C93A 2D23A 1GOIA 3WF3A 4TX6A 1C90A 4JCLA 1CXLA 5E09A 1BTCA 2W61A 3M6DA 1UWSA 1KXTA 2BVDA 3BVTA 2QHAA 2W5FA 4HA4A 4U3CA 3WF4A 5CSUA 1DHKA 1EQPA 2JIWA 1HTYA 5A2AA 3CC1A 1VEOA 1W32A 4HP5A 4IPNB 5BXPA 2DDXA 1UWUA 3A21A 4D72A 1VEPA 1FHLA 4LPCA 1WZAA 2IGTA 3VGDA 3HZ3A 2Q8XA 3G6LA 1QNOA 3CIVA 4Q7NA 1RP9A 3WNKA 2VRJA 1VF8A 1K6AA 3T08A 4W5UA 1WDSA 2CKSA 2J47A 3BSGA 1NWTA 1NOUA 3GXFA 1JDAA 4Z2JA 3W28A 1OGSA 3AZRA 2VMFA 2YA1A 3L4YA 2GK1B 3MKKA 1HXKA 1ISXA 2JE8A 1FA2A 4AZHA 3WUFA 2CBJA 1WPCA 3DYOA 2E9MA 2YA0A 1BYAA 3LMYA 2UY4A 1HJUA 1GJWA 3D3AA 1F4HA 3WD3A 4WKFA 5C70A 1JL8A 1DWHM 3VM7A 3MV11 3ZIZA 3VD3A 5D9OA 1CENA 3TP4A 3EDJA 4U2ZA 2VCBA 1B3XA 1GQKA 3PN8A 4UQAA 1UYQA 4OUEA 2ZUNA 2F8QA 1R34A 2F2HA 3A4XA 5I78A 1E6ZA 3VDCA 3SCNA 2VZOA 1CEOA 3RJXA 4CU6A 1UKQA 1PX4A 5HBFA 2X05A 3WY1A 4P7OA 3EJUA 1E3XA 4ZE4A 2PBOA 4AY1A 4ATWA 3WDHA 5EBAA 3NUKA 1XCXA 3LXAA 5CG0A 4MPKA 4M81A 4QP0A 4KRTA 1E43A 1ISVA 2ESCA 3LRKA 7TAAA 1L0PA 5AY7A 1EOMA 3CUHA 3DX2A 3WQVA 3VDAA 4MJ2A 2DT2A 4AEFA 1TMQA 1ZBVA 3IANA 2J7FA 2DSUA 1E73M 4P7QA 1JZ6A 3D5HA 4OOZA 3T0BA 3FW6A 3ARTA 2J74A 5E1QA 1E0WA 4E4PA 3HG3A 3TOPA 1JD7A 1U30A 2VOTA 3TTQA 3WUGA 4QAWA 2E40A 1CTNA 2EEXA 1XSJA 4FNRA 1O6IA 4URIA 4M29A 4PUEA 1KXHA 4JFWA 3WFLA 3VOCA 3BXWA 1JYVA 4CD8A 3VUPA 2CHNA 3ARPA 1E4MM 2WMKA 2UY2A 4M82A 3GZAA 1V0NA 3BAKA 4AZCB 3UR8A 3QR3A 4W87A 3CHCA 3VNZA 2JF6A 3F4VA 1CGXA 1UWRA 2FYVA 5A1AA 3VGHA 3GNRA 4RL3A 1H0GA 1W3HA 3UR7A 4A4AA 2FHCA 1PIFA 1E3ZA 3EMCA 1BAGA 3L4UA 2ZXDA 4XV0A 2Z1KA 3LRMA 1H0IA 3GH5A 5HDRA 1UH3A 1ZU8A 2FHBA 3MMWA 5ABFB 2FGZA 1C7TA 1GOQA 1W3LA 3ARXA 2ZUSA 1EDQA 2WWDA 1UA3A 3AXIA 1J0JA 3VMOA 1L8NA 4AEEA 4WIWA 1W3KA 4XB3A 2A3EA 4UQCA 1CXFA 2GFTA 4V27A 1GHSA 5A6BA 4FLQA 1J9YA 1TZ7A 4GIAA 2XFFA 2VZSA 2FH6A 1PEZA 1W1VA 1BGAA 4PMRA 1OIFA 2DH2A 1QNPA 4D6DA 3W25A 4KH2A 2ZXBA 3IJ9A 4NXKA 1CXEA 5KEZA 1NP0A 4EANA 3LPPA 4UQDA 1FFRA 4JZ5A 1Q6CA 5IFTA 2CERA 2O92A 4H7VA 3AICA 3WQWA 1OGGA 4F8XA 1T0OA 1R7AA 3SUSA 1E70M 4M24A 2D2OA 4QFUA 3THCA 3BVUA 5A6LA 2ZX8A 5IDIA 1B2YA 3WQ8A 1H3GA 5FKYA 2EBNA 4C7DA 4H8VA 5D8ZA 3BGAA 3W38A 1GCYA 1WCGA 1W2PA 1DTUA 1JAKA 1V0MA 1GQJA 5BXTA 2PC8A 4XZWA 1FOBA 2CHOA 7A3HA 1JYXA 1TCMA 1QBBA 1UD2A 4CCCA 5DT7A 3U5UA 4LXFA 1B1YA 3ARSA 1XHGA 1GPFA 3VNYA 1OIMA 3MV01 1MFUA 1GOOA 5E0FA 3PZ9A 1KQZA 2EPMX 3WBEA 1KGUA 5A69A 1J12A 4E8CA 4NRSA 4CU7A 2WCSA 1TA3A 2YL6A 1QHZA 1FFQA 2XSAA 3ZR5A 2WSKA 3W29A 5CQ1A 1UD3A 4GI9A 5JIWA 3VIIA 1ITXA 4CD4A 1E6RA 2O9OA 1R33A 3DC0A 1PAMA 3W81A 4P7NA 3ZSTA 2FHFA 2J77A 3ARRA 1XH2A 3DDGA 1JZ4A 4ACZA 2VR5A 1EA9C 4OJYA 4J27A 3T0AA 1PJ9A 2O9PA 3M46A 2X09A 2BV9A 3J7HA 4R27A 2XIIA 3ECQA 4UR9A 1V0KA 1KXVA 4DWSA 2VRKA 1LF1A 1KBBA 3BSHA 5EB8A 1UZ1A 2WKGA 4KGJA 3BVWA 2YL5A 1E6SM 1OWQA 5JUVA 2E8YA 3CMJA 2VL4A 1W3JA 4N42A 1N82A 1MQRA 1QI5A 3OBAA 1KCLA 2XYLA 1E6QM 1C3FA 2DSWA 3ZQ9A 2PWDA 1WE5A 3LPFA 2XM2A 1IT0A 1CLVA 2YA2A 1S46A 1ESWA 2CKRA 5GNXA 3L4TA 2D0GA 3CGTA 2GJXA 3AMDA 4RE4A 3ALFA 3KLKA 1Y7VA 2BS9A 3WQ6A 1H11A 2XGBA 3CHEA 1UOKA 4UQBA 3GXMA 4E2OA 4V28A 2OSYA 1E6XM 1EXPA 4AZ5A 2OW6A 1UD4A 4FNTA 4DO4A 3AZSA 3GXTA 2IXVA 2W92A 3IJ7A 1WKYA 4YN5A 3L2LA 1M53A 2GK1A 2Y8VA 3NSMA 3WNNA 1WZMA 4AC1X 4CVWA 2VO5A 9CGTA 2BHUA 3AHZA 4WF7A 2YIHA 4J3WA 3TA9A 2XWEA 5C8BB 2VX6A 1QWNA 2WLZA 4GZIA 4LGXA 4CCDA 2WCGA 1UR4A 2BY0A 4ZE5A 2OWXA 3KL3A 3BLPX 1EHNA 3A24A 3F5JA 3WF0A 2E4TA 1VIWA 5E6ZA 2B31A 3HMCA 2A3BA 2VX5A 3SCVA 2BHYA 4GI8A 3I3EA 3FN9A 1DWFM 1AQMA 3WIJA 1WP6A 3CZGA 1O7DC 3VIJA 1V6YA 5GNYA 1ISWA 2BNJA 2J4GA 3EJSA 3CPUA 5FL1A 2DT0A 1JFHA 4KMQA 5EFDA 4CN1A 1UH2A 4PCTA 1HKIA 2CBUA 2V5CA 2WHJA 2WANA 1QHOA 3SUUA 3D52A 2DGAA
chains in the Genus database with same CATH superfamily
1FNSH 4KHTH 3DJ9A 2ATMA 1JE6A 1KN4H 4I9TA 3LCWA 2J6EH 2MNRA 4IIHA 4WO4C 3DERA 4YUEL 1Q7MA 4XO6A 1OO2A 4Y2DB 1I1AA 5BS0A 4JHAH 2VCAA 2HBVA 1A3ZA 1JULA 2BZDA 1MSSA 1VB9A 3UR5A 3IIPA 3T42A 1U3ZA 4EXKA 4DEPC 3CUZA 4QE4A 1RUPH 2VM9A 4P8UA 1BPLB 3P73A 5TTRA 2O5ZH 4IRSD 1SO5A 3VVGA 3EADA 4DNHA 5CFAA 2A6DB 4P2OB 4G6FB 3TR9A 3CLWA 3COTA 3RPIA 3SQOH 1L9RA 5FJRA 5EO9B 4I9JA 4Z7AA 4FO4A 1NTDA 1A3XA 3R58A 1T40A 3SGGA 2P5EE 3OZMA 2JJVA 2PPFA 1FL6A 5ESVB 1ECYA 3TZVA 4NRXA 1JCXA 3L0KA 2X1PA 4N0FA 1MQQA 1W1PA 1H3PL 1DSYA 2NXHA 3VD0A 5DMKB 3WEOA 4JRYB 3ZW3A 1SNRA 3TSDA 1KBLA 3U4BH 3WL0A 3RWGB 4HJ0D 1W1YA 5D6DA 3EWDA 3GZQA 4IJ3C 2HWZH 1TCRB 2BBFA 5F1KC 1KTDA 1IFRA 1ERNA 1LHZA 3ASNB 4ZFOB 2OGJA 3BH8B 5IFPA 4ZXBB 4RK8A 2RTTA 1RCQA 3T2PA 5ETUA 1NFGA 2Z34A 1EFQA 5FGBC 2AJYH 3TFKC 4QHRA 1JGDB 1RQ5A 1Z5LA 4G8EB 3K6SA 4PWGA 4DCQB 1K85A 1JIBA 3VPLA 4C7GA 4JFDB 5BNKA 4A38A 5KVEH 3GTIA 3JZ7A 3GHBH 4FKKA 4XXWA 2ZICA 2W9MA 2QKIB 1FORL 3KCWA 2Z7KA 3WJLC 4DPBX 4W8LA 3GDCA 2I1OA 2VISA 2W8CA 5DDHA 4FD0A 4LOVA 3TYBA 3ZZSA 4OZ4B 5CLTA 2VLMD 2DY2A 4TTUA 2P8PB 2L4OA 2NY5H 2QPUA 2IXUA 4MNQA 3A5VA 3UWEA 2ID5A 2APXA 5KVDL 3ROOB 1HZYA 3DKLA 1XFPA 4RZ4A 1P1VA 3AQDA 1A22B 4P4KB 1E67A 3QUMA 1NSNH 2R2HA 3G5VA 1EQCA 4UYPA 3I68A 3UABA 1JGLL 1GVEA 2X6BA 1OD9A 2ED8A 4PPTA 2Z1SA 4WY0B 1F58H 3QDGE 2GZXA 1N7ML 1E0VA 2X9YA 4IIFA 3MNZA 4GE8A 4C60A 5FAJA 2FX9L 4U4BA 1UD8A 4ESKA 1UXMA 1MI5B 1NKGA 2W6RA 5GZOD 3EYFA 5SWZB 3WKZA 1OP5K 5AAPA 4G6KL 4MWAB 4XNMB 1IAKB 3EG9A 4GAJL 1I3GL 5CEXB 1ADWA 4OT7A 4FIQA 3RF9A 4GFXA 1A7BA 3Q06A 1IEQA 3C9NB 2PCFA 1MPAL 1DBBL 1YXCA 4NJ9L 2XCMC 3UG5A 4M02A 3ID7A 3EBVA 4KI5C 4TQEL 3I6KA 3IVTA 2R9HD 5DCBA 4JY6B 4AGLA 2IFGA 3QORA 4LCYB 3D8MA 1WZ1L 2FR4A 1FXPA 3PZGA 2C8NA 5AB1A 5I8OL 3TT3L 5J13B 1OT1A 2FB2A 2ZADA 1LWJA 4ODTH 4PULA 4EN3B 4HIBA 4DZIA 1ITUA 1B0GA 4S3DA 1FFPB 5IUCA 1PD6A 2PLJA 1T7XA 5SV3A 1DFXA 3GK8L 4RE3A 3AHXA 1IEWA 3CMOL 2H3XC 2VQTA 3PWNA 1BIIB 4XAWH 2C4XA 1GZJA 2YAHA 2YO3A 3BARA 1V55B 2F15A 2C1GA 2HJFA 4HK3N 3KVMA 4YSEA 5F7FA 5E2UH 4I87A 2L04A 1B0IA 5I8KH 3EO0A 1URZA 4JNZA 4XVEA 3BD5A 2A4ZA 2C19A 4IU3B 1W3IA 3TEXA 2PDKA 3UJEA 1AGFB 4GXVH 5EF0A 2WNQA 1TQJA 5CZ0A 3BZFA 1XI3A 3MJ6A 5CBIA 1T89A 2OJZL 4FQXC 5I1IL 4HGMA 4BZ2L 2MWCA 5T1DH 2HN7A 1XGTA 1K4CA 1YN7A 2BFVH 3ZTDC 4A8RA 3SCTA 2AEIT 5FWQA 5E93A 5F7DB 2WN3A 2G3NA 1YIXA 4DO6A 4XZ4A 3BVNA 2CLMA 5AZ0A 4BQ4A 1GGTA 3RMJA 1GJUA 4G6AD 5FO2A 1W0VA 3BAXA 3BVDB 3F4CA 3W1XA 5KZCB 1MF2L 5D7SL 4RNRB 4JYEA 2XKUA 4JL2A 3NH7H 3GMOB 2YOCA 2EIEA 4NQDB 2EDDA 1JBJA 1GYLA 1QO5A 4ZUSA 4B60A 1A7QH 1OF8A 4WENB 3WQGA 4FB7A 5C08E 1AKJA 1JNHB 3KD4A 2PYEE 4MFEA 5GHWL 4M6OH 3T9PA 3GMLB 1BXXA 5I3DA 1CR9L 2FX7H 1DUZA 4EXQA 1MDLA 1VLWA 2XA3A 2ICWB 3VRJA 4Y5XC 1JK8B 4UTBA 5F2MA 4DW2L 1FNHA 4YDKH 1KTJA 1EC8A 3QXDB 4HIHA 5DVOA 2CALA 5LGKA 3FFOA 1RI8A 1MUCA 2CNZA 2O5YL 4Z7NB 4N3UA 4XP1L 4MZRA 3BG9A 2F1EA 2A2IA 2FB4H 3CQPA 4XIAA 1SJEA 2PCPA 4X9FA 5C71A 1GYWA 5I6KA 3B43A 4Q14A 1DWIM 4U05A 3QWRD 3H3BC 1DPMA 3A5FA 5FPIA 1OP3H 4ZFZB 2UY7A 5FF6B 1VBRA 3KE0A 4AWUA 5AKQA 1CLZH 5F9OH 4MAVA 1QEXA 3I85A 3UBFA 2W0KA 1F1DA 1XDLA 1M7DB 5MHSD 3H4HA 2XIJA 4Z3IA 5EEVA 2E7LC 4JS7A 2JIXA 3E1F1 4YSDA 1TTCA 1HS6A 2VLRD 5KBNC 1FFOB 5C0AD 1TVBA 1KCVL 2DBLL 4DWSB 3RMEA 4LEXL 1IIGA 1YMHB 3VC6A 4MF4A 3URQA 3IDMB 1FWBC 4ODWB 2DIBA 2X28A 4YBQD 5A2CA 5BYWA 2YPVL 4FFVC 1Q65A 2YBTA 1BG9A 5D4YA 2CLKA 3R43A 3KVKA 4JCWA 4P4RB 1UEMA 1EWEA 3H2NA 5D2XA 5F89A 5HYIA 1HJQA 3SD5A 2Y7GA 2VMEA 4Q7DA 3TOYA 2X9WA 1MG2C 3QPXH 3TN6A 2FYYA 5LQBL 2IG2H 4W6WB 1TE1A 5DMIL 4GD0A 1I1XA 3LLDA 1RKRA 4WR3A 3L4VA 3F58H 5E6ID 5GRJL 3AABA 3HV9A 5E08H 3EX3A 2X2UA 3D39A 1A7PH 1TETL 4PJBA 4XTRD 5BZDB 4MY8A 1TREA 4Z2IA 1I7RA 1UZHA 3V4UH 3GYRA 1ZHBB 2QMKA 5JR1L 2E6FA 4LNRA 1W8EA 4AL8C 3L9YA 1MMFA 3W2UA 3LEXB 3AM8C 1U3NA 4MA3B 1JTOA 4X83A 1NOWA 3EGJA 3PE9A 4S1QL 5K9CA 2QQLH 4KKRA 3EYQD 3BH4A 1VFLA 1S7SB 2CRZA 2FPTA 4P2QA 5F9DC 3SY0B 2IPUG 4Q2ZA 4XWGH 2VFIA 1K7FA 3T3PE 3O6AA 3BLFA 4ZMOA 5AZUA 3DPBB 5F7WC 2CM5A 4N22A 2J8UF 1LO5A 3NEVA 2CXGA 2I5QA 1U3HC 3RWEB 4QNPE 2FEEI 1NP2A 1GGOA 4U1KA 3ETTA 1A50A 3THUA 5I28A 5BZWB 2BFVL 2GG1A 1N3NB 4U1JA 5BRZA 1F07A 4V1XA 1MCQA 4RDVA 5CD5C 2XN2A 4KJYA 1CICC 4MCZA 1V93A 3DO3A 4GT0A 4W4OC 1LP9B 4U7MA 3OKYA 3IDNB 1U8MA 3L4ZA 3QZBA 1XZWA 2NUPB 2RHGA 1BD2E 3WQFA 4Y2OB 1WF5A 3APCA 2Z4QB 5J5EA 3O6LL 1E72M 2O61A 1OFRA 3WN5C 1HQRB 4L4TB 1BFOB 5KZEA 2EDHA 4Z2LA 2UXTA 3MDJA 1JRHI 4XODA 2EIZB 1FC1A 4TLTA 3G5WA 3VIMA 1A7QL 3V5DA 3R1GL 5ANHA 4FX6M 2XYBA 2ICWJ 2NVAA 3EWWA 4BK4A 4OJAA 4IU2A 1NOFA 3UYRL 2IJ0C 1KCWA 3N0AA 1ZLSH 2QSCL 3QDMA 1Q9WA 5DD0H 1R3HB 4G7RB 4XIMA 4PJEE 1BQSA 2P8MA 4AYSA 3APNA 5C09A 5LJYH 1OK6A 1J1XH 3GBEA 1A14L 4I1RA 4M1DH 1G7QA 4DZBA 4ALAC 1MRCL 4PJXB 1U8HA 4X6CA 3GC4A 4GXUM 3PTQA 4L9LB 5IM7A 1YDPB 2B0SL 1MAJA 3RY6A 3BAJA 2NWSA 4JNYA 4QOKA 3H9SE 2EYSA 4YTTA 3QH2A 4M5SA 1FZKA 5G1YA 3QFJE 2RAMA 3MO7A 5H94A 5H8UA 1KGIA 2XG4A 1QUPA 2NR6D 4WFHD 4HQQL 5LNVA 1ODZA 3D9AH 4PVMA 2FGWL 5DJCA 5CSBA 2X3AA 3BK0A 3I9IA 2VGFA 1T03L 5AAMA 3UGRA 1IBHA 3H2WA 2NY2D 4LAQL 4WTQA 4MVBD 4Y88A 1H50A 4XZUB 2XQYK 2Q2EB 4LDCA 2VM4A 4JE0A 3RWHB 2X4UA 1UTDA 2OYPA 2WXIA 4YDJB 4NZ5A 4OE7A 2XXFA 1FAIL 2R69H 1DJNA 2BP1A 4QWWD 4WY7L 5AOLA 1JERA 3GXDA 5HYSA 1K4HA 4NZCA 5CH9A 1KN2H 5CCKL 5FM8A 3VA2C 2DMHA 1VP5A 1BZ8A 1T41A 2ZKHL 3BIBX 4XXDB 3DTDA 2IG2L 4R9XA 2YLAA 3FJ4A 3OF6D 3IGUA 2H6OA 2EILB 2W63A 2DI8A 1IZJA 5REQB 4ZS6C 1GMIA 2NT0A 5DQ9B 3IU4H 1R3JB 3VD9A 4HOWA 1SBSH 4P23C 1UBSA 1YECH 1C5DA 4C1NB 3DDMA 4G6CA 2IPKA 3W7CA 1BTMA 1NDYA 4JZJB 3VDHA 4UQ3B 2TPSA 3WTTA 3KRSA 4P5MA 3UWUA 1TJHH 3KPMA 3VSTA 3MCYA 1ME8A 4JGMA 3BGGA 1KXVC 5C9JB 3QC3A 3EAUA 3QBTB 4ZX3A 7FABL 3MCLH 5MKGA 1FN4B 2VEPA 3CQIA 4X7EC 4QKXB 3UAEA 4F1SA 3RLHA 1X38A 4PJDE 5CWSA 3ZJ8A 2FQFA 4MJIA 3C2SA 4Z7WA 1S1PA 4HIXH 1WFNA 1XXFC 5SWSB 1MJJA 5LWYH 4LVOB 5DRNB 2VSCA 1WXZA 4F3HA 5CR8A 5I6NA 3KX6A 4B5TA 4JCLA 1R30A 4V1DD 3M86A 2DBJA 4ZYKB 2QHAA 1E9ZB 4HA4A 4E5XA 4C5YA 3K6IA 2V2WA 4A1RA 2PW1A 3DUHA 4M1CC 5D8JH 1E2VA 3MRPB 5GZNC 5KETA 1PDZA 1RY8A 3D6GA 1IZCA 3EBAA 5DK2B 4JKPL 3OGCB 3BSGA 3JRKA 4JG1H 1W72A 3N9RA 4MVAA 1QKZH 1YYLH 3ZE1F 3VFGL 2ARWA 5AD0B 2VFHA 3C2AH 1XIDA 2Z3FA 2LFEA 1FC2D 2F8QA 3A4XA 3NPUA 5IESH 3STGA 1X4XA 3W7GA 3SOTA 1U8JB 1FGVH 2A0LC 1QJWA 1AGBA 3WY1A 3W39B 2ICEA 5F88A 3RR4A 2JKSA 3MGOB 5HUOA 3EA1A 5E8EA 3DBXB 3WD5L 1Q45A 2J5LB 3ZWSA 1I4FB 2YAQA 1CGSH 4QMEA 4MPKA 1QUNA 5H37A 2ESCA 4APQC 5FJOA 3TJ4A 3N41F 2ADYA 2BVEA 3JWNE 5AZ2H 2J74A 4TS6A 4KX7A 3G1DA 1U30A 1I1AD 5BS0D 4FXTA 1SQ2N 4PUBL 3NTYA 1XSJA 2OP4H 4HJSA 2C9UA 1OP5H 4OVXA 4HBKA 2CHNA 2HK1A 4M82A 2BC4A 2E9WA 3QR3A 2P10A 4KNTA 4NJAH 3II3A 4PJCB 4RL3A 2QR6A 4MUPA 1HOEA 4O52A 4AFYA 4CADB 2HG5A 4K9EC 3WLJA 3EOYG 1RIHH 5M7QA 3VI2A 3JWOC 4PBWD 4K3JH 1A5AA 3UZQA 1J0JA 3VMOA 3AREB 3DG3A 4GY4A 4XTIA 1XYLA 3ZIYA 3PQYB 5DXYA 1T0NA 3L3OA 1A3RL 1XDMA 4KK6D 1UADC 1XYCA 3D9AL 3VI3F 3TZVD 2B1HL 1FSKC 4JX5A 1AXIB 1DQLH 5AVTB 1FWFC 2V17L 4I7ZC 1R9YA 2ZXBA 4GW1A 4IGBA 2VSKB 2QGBA 2CERA 3TU6A 9XIMA 3FUKA 3ML9A 4XBKA 4LHUG 4F8XA 4TUOB 3F83A 1L8PA 2EDQA 4RZCB 3SZ6A 4LLMA 1UB6A 1XIWB 3RP1A 3LIZL 2WXRA 4HGXA 4YR6A 1EJWC 3TH6A 2IXQB 5FA5A 3F65A 4Q4KA 3PUCA 2HUHA 3HFYA 3NQCA 4XPTH 4KPHL 4YFDB 5DUBA 3ITGA 4J5NA 3EB4A 3ARBB 1XHGA 3VNYA 5E5MA 3MV01 5SX4H 4LLYA 1AY1L 3BDYL 1NJ9A 1YJDC 3PHQA 5IHHA 1MAML 5B8CB 1TTRA 2CH8A 4XMZA 3PBYA 1XKYA 4KUCD 3H24A 2UUDH 1PAMA 2QCHA 2Z92B 2ITCB 2YGVA 4PJ5E 1NBYB 3CQ0A 2D03H 4XP4H 4ZJ9A 1YECL 3IV8A 1I2OA 4R27A 2A77L 1JEZA 3VXSB 4LL4A 4Q8MA 1UZ1A 3K30A 2CXEA 4CILA 3PJSA 3GMMA 2YL5A 4DGIH 3US1A 3CMJA 2FO4B 3Q3GB 2GC4C 2A83A 4MNQD 3U9WA 1E6QM 1WWWX 2X40A 4PLKD 3P9LB 2BRRL 4TSAH 2CZFA 3OQEA 2ZZ7A 3CGTA 3MRCA 4HA0A 5AHEA 3B9KB 4NT6B 1OSZB 4KO9A 4BWLC 4GAYB 4JDEB 3LZNA 3RDTA 1YNTF 1UM5L 2FVMA 3DVNA 2YXOA 2A9ML 4KQ3H 5FF0A 4PY8J 1KJ3H 1DO5A 3ZE2E 2B7OA 3LZOA 1NCWL 2VX6A 3KGTA 4POZC 5JHAA 3JWNH 2MUCA 3I2CL 3BUYB 4AQ1A 1XG3A 4F80A 3VAEA 2VLJD 3DRTB 4HOMA 5BOPA 2OTWA 1ONXA 1YSOA 1GYAA 3VZZA 1KC5H 3QUXB 3UXLA 3N6HA 4EAYA 2CIKA 2R8SH 4HVBA 3O8XC 4JG1L 2Y7LA 4Q9CA 3QFEA 3OKDA 1T5AA 4E38A 2VYRE 3VGEA 1D3GA 2WMIB 3RA7L 2B15A 5FO7B 5ECVA 4H2CA 1T1ZA 4IOIA 3UEZA 3M8OL 3TZNA 3FXYA 3P30H 3GI8L 2CIIB 4LF3B 4P9HH 2GI7A 5T1MA 2YXXA 3ZS4A 1S9YA 5D5MB 4AQ8A 4BF9A 1G5AA 2PWVA 1I7ZA 3QORD 3JTTA 5C86A 3WNPA 4N4QA 2H0EA 5BU9A 3D30A 2J7LA 1JNNH 3O0RH 2CHZA 2QUUA 3NM1A 3N29A 2KH2B 5D2YA 2E5EA 2C91A 2ITFA 5HGAB 5D32A 3FB7B 2XTKA 5L4IA 2XU9A 3PS7A 4X98A 1KTRL 3QXWA 4N2BA 4G3YL 5LGHL 3D2TA 4XP9H 5IXEA 2FZ3A 4X8GA 5A3IC 5I5MA 4FG6D 3T0EA 4H6EA 1RXLA 4P9ML 4BQ6A 1DBMH 2CKBA 1ET7A 1IGYB 3H9YA 4UOW1 3AWEA 1NFAA 3RJOA 5E8DH 1RCXB 2JKNA 4M61B 3LN4B 2OFJA 3RZCA 1KCRL 2RALA 4IBWA 1ZT4A 2J6EA 4JJ5B 4M5ZH 2FGLA 3D33A 3W1NA 3C09B 1RULH 1GVSA 1F2QA 3W7EA 4ODVL 1FKXA 1QTPA 2GITA 3U0TA 3SYPA 3SDXF 2ON3A 2WYSA 1QRNB 4J6IA 5AC8A 2P48B 2W88A 3C0SA 5L2KE 4IQDA 4N2DA 2H0PA 4Z7UE 4A6YL 4MNMA 3CTLA 3RCYA 1DQLL 4QLLA 1LOSA 4QDGA 4GMTH 4F7PB 2NX1A 4N02A 3ZDZF 4C55A 1X5GA 3DHUA 5J56B 1MYRA 3UT0A 5JIMA 3TA4D 4APXB 1AQKH 3QUYB 4QHMA 1WS8A 3TLQA 5ICXA 5U4NA 1UZ6F 4WEEA 1KEMH 2DUAA 2WAGA 1OGTB 1INDH 3N44B 2J7GA 4GZEA 3STFA 4HHAA 3O0LA 4MMXB 1NUFA 1O6SA 1U5VA 4C4UA 1AFSA 5EOTA 3V0VA 3CZSA 1OCCB 2LVEA 2XKSA 3RU6A 1UWXK 2VDPH 2EEAA 1AKJD 1ILSA 2YD7A 2NW3A 3BCDA 4ZX5A 3RPBA 3NSFA 2H2PC 1CLOL 4RISL 2JJUA 3TF4A 5HHQA 5A2BA 3S6OA 4MGXA 3TWBA 1F74A 4RRPG 2CYGA 3KPLB 2BP8A 3C5ZC 4K39A 1E9LA 3NSDA 1FFNA 2V30A 1W91A 2ZPKL 3HBZA 4LQFH 4ABVA 5ESQA 3MX0A 4Y2NA 1U8LB 4KKCD 2EE9A 4U4IA 4R26L 4FQ2L 4B5XA 4NQCB 1I82A 1H0DA 4HAGA 3THDA 4C6KA 1CGYA 2EAEA 4HCRL 3FH5A 3MNVA 2C3ZA 1OK8A 5CZXD 4DX3A 1PIGA 1XYBA 3FQ4A 2IDFA 3CAQA 3PABB 4MKVA 1X7IA 5CPQA 1BIHA 3K72B 4PRAA 2CLVA 4YHKH 3UTSE 2VQUA 2AXGA 2JIXD 4CCZA 4FNQA 1N4XH 3RTQB 1IEXA 1KJ3L 4H8UA 4IFOA 1QSFB 1T04B 3ZGHA 2NTSP 4B3ZA 4ATLA 1PKNA 3H7LA 5T8IA 4XC1H 4AWJC 2QJJA 1RHHB 3WKPA 1N5AA 5D2LF 3QN3A 1KYFA 3FT4A 1ZCCA 3P69A 3SBFA 3B9EA 5I73C 1KXTB 3ARDC 3E8VA 2AJ3A 1P0DA 3CLEH 2Z7YA 1OF2B 2EPOA 3FFCB 1SGKA 4IOFD 2CJUH 5DK0A 3Q58A 3TO4B 4L7ZA 2PXYC 1KFLA 2B7PA 2F7FA 2Q6ZA 5EBMA 1NEZA 3TQ0A 1DBAL 5IQ7H 3HNSL 1BWLA 3BLDA 2EACA 2ZWSA 3PP3K 5GGRA 4ZK8A 1SLXA 3SKOA 2BSBA 4PREA 4P3DB 1H51A 2FT8A 1AHKA 2KYIA 1J0ZA 2A3HA 3VDGA 4R0LC 3D39D 4NQSA 5FC9A 1W1A1 1KJVA 5E94A 4GVIA 3O9WC 2JTDA 1BQHA 5IBUB 3WE1A 4JFXA 4OLWL 4AMAA 1WISA 3V18A 4XRCA 2P5EA 2E9JA 4IFKA 2J71A 4PBGA 2X70B 4P2QD 1VAHA 1RU9L 1GQLA 4R84A 4HIJA 2BIPA 1ID2A 3FXIC 4AZBA 1DE4A 5E8DL 3RUBL 1ADOA 1SLVA 2XIBA 5ICYB 2ZAHA 3KLHD 1GYMA 2A2QT 1W9BM 3FS9A 3SCMC 4ODHL 2P50A 1RZPA 3FTXA 2G9KA 4JKWA 5D1QA 1L6XA 5DRWA 4L1WA 2P8LA 2ETWA 4DWHA 5DD5H 1T80A 4Y2WA 4LBAA 1B0RA 5BXFB 4WJEA 1UFGA 1ZP3A 3L3GB 1UC6A 2WBWB 5BOFA 5BRZD 7CGTA 1B9ZA 3GKWL 4HWZB 3FSAA 4M9OA 5EC1B 4PWJA 1NFKA 2EYTB 1PZBA 3AMCA 5DWUL 5J3HD 3QWOA 1KY6A 4NGHL 3WEMA 4UV4H 4Y9NA 1H5BA 3P8IA 5AYUL 4X4ME 3TCSA 3EEZA 4H01A 4NKOB 1X5FA 2ZE3A 1G1YA 1LORA 5CM1A 3S4SB 5EWIH 2QJDA 5DURD 4LRNH 3UTTB 4YHYB 4NQVA 4FQCH 3GHEL 2P1YA 3VZXA 1F4WL 4ZO8A 5EU4B 1TO4A 3EA3A 5E95B 2FLIA 4E42B 4G1EA 3ABMB 4LOCA 1NBZB 3ME0A 5KYUA 1B88A 1OC6A 3ZT7A 1SOSA 1CFQA 5T9BG 3M17B 1ZJIA 3QDMD 4ZNCD 1L9TA 4RWYH 4X60A 1PCKA 4J3BA 1JPEA 2X4PB 1QASA 4WW1B 5C09D 3M41A 3KLLA 4P7RA 1QR1A 1I9JH 4GRMA 3IMRA 5HMDA 3FO1B 1E9QA 1V05A 4LU0A 4IQEA 3W9DB 4LQFL 1A53A 2DM7A 3HB9A 1SFJA 4JEQA 2AERT 1IT8A 4A2EA 3H55A 5KVDE 5T1LB 4H4NA 2QT6A 4ZMQA 1H4PA 5D96C 3W87A 3DIDA 4QOKD 3WDRA 5FYKL 1I7TB 2DVXA 4D9RD 2F2KA 5D2NA 4CSZA 2Y07L 1J7VR 3NCXA 4UUJB 1CE6A 1S2CA 2SODB 1D5XB 1FWWA 1K5NA 4NJJA 1IGSA 2NX5E 4NKQB 1FYHB 3R12A 3IFLL 4X7CC 3RPMA 2Q5BA 1M5WA 1BJ1J 4OKVB 2ISSA 3EH1A 1WYJA 2XVLA 3WFEH 4YUEH 1M7XA 1UPPA 4XNZC 2PDJA 1JN6B 4M3JA 4OGQC 1EXGA 2A4EA 3S5OA 4RCAA 3KOYA 3BVVA 2DPEA 5D38A 2HT2C 5KANI 4AZ7A 1OFQA 1SHXA 3OLDA 2AL2A 4UUIA 3RVXC 4HK3J 3TFCA 3TAOA 4HMCA 4W93A 4TX8A 2DYRB 1L2QA 3QQ3A 5I5IA 4PJAA 4Z0SA 4R33A 1RZJL 2F5AL 1SZRA 4D9PA 2VITA 1VFBA 1XLJA 3HRZC 4HIEA 3GSUB 4Z5RB 1JRBA 4FI4A 3QF0A 4Y4FA 3PWIA 4WI7A 5EUOB 3WQ5A 5CKGA 3HCVB 1ENUA 5JHBA 1PZ0A 1H3PH 4MYXA 3BPWA 3VWJA 3QS3A 5CHNB 3LZ5A 1PIIA 3LHAA 4O1CA 1TZGH 1V7AA 3PCYA 4WGHA 3GEWB 4ISVA 2OYMA 2H3DA 4NQ1A 1V5JA 1AP2B 3C4UA 1JDDA 4JPWL 3BT2L 2G4FA 3CASA 1PLAA 2X6CA 4KGLA 3T8QA 2VL5A 2HTMA 3P3RA 1E8YA 3BP4B 1BEUA 4ANVA 3TONA 2I60H 3A6OA 3IEBA 1WDRA 4NNYB 4HIQA 2D7PA 4OLVL 1UBPC 1SN2A 5DUPL 1DJSA 3JUYA 2X0YA 1T20A 4R7OA 1A7OL 3DVGA 1LDSA 4ZMXA 3NAAL 3FUEA 4U1LB 1R86A 4Z7VE 3OXSA 2W0FA 4AEHL 3VWKC 2A5UA 2XGZA 4UFMA 4FMKA 1FORH 4RMSA 3TZFA 3L17A 2I7OA 5K9JL 1UWFA 3EBHA 3L9CA 1M4KA 4U0RB 2CPCA 1BG4A 1TR7A 2DTML 3ZVIA 5DU7A 3K13A 5C54A 3F01A 5KVDH 2PYEA 3RY4A 3QXBA 5XINA 1K3UA 4UV4L 4ZODA 5EIQA 2MPAL 3TJHD 4PRDB 4CRPA 4AX3A 2VERA 1EX0A 2PF6A 3CX5K 2QAPA 1KCBA 2YYTA 3URBA 2DZVA 1JGLH 5D93B 1N7MH 3W2LA 4KKLD 3N4EA 1MLCA 2RD0A 4ZW8A 2HAZA 3NCFB 4HYRA 3P9WB 2NY6B 2Q1EA 5ECJE 3ABKB 3HGJA 2GIYA 4I5BB 4XTDA 4N2AA 2HVJB 5HD8D 4POUB 4XCFL 2IALB 5DRZA 2C3GA 1FWRA 4B16A 4G6KH 3T6VA 1SO4A 1TELA 4PJ9C 3SQBB 2H6UA 2RDUA 4Q4MA 3W2NA 2UYLA 5J4MA 4GAJH 2OW7A 1JUBA 4XAGA 1IARB 4JK0D 1MPAH 4YL9A 3W27A 2PTZA 2BOCB 1HL9A 4NJ9H 2X10A 2X3BA 4QGYA 4PI2A 5F8RC 2WWCA 2X2YA 3KM1A 2PDYA 2ODIA 3LQMA 3RU8L 4EBQL 4TQEH 4NKIL 3V0UA 3MUGA 1VFOA 2EPLX 1PZ3A 3UJIH 1JF6A 2Q20A 1WZ1H 1XGZA 3L3KA 3T77A 3OKEA 5INCB 1F11B 3TT3H 4GW4B 2ZYIA 4X8JB 1SW3A 1QK2A 4JTJA 4ZAKA 3ZTNL 1BMWA 1DZBA 1D5BB 1BQ5A 2Y1AA 4IGBD 3WFEL 2CLRA 3GK8H 5IMLA 3CMOH 4EPKA 5E9DE 2WB7A 3WLTA 2DI7A 3AU6A 1MLBB 3VNKA 2XFYA 5JO5A 5B3JE 2J75A 1RD6A 1Z8AA 3OB8A 2EVHA 3ANUA 5IW3A 4DT2A 1H15B 2K7QA 4L2YA 2NMSA 5T5NG 1AO7B 3H3KA 4P2YA 3FMGL 3MRQB 1QLRA 4DBEA 4DB7A 2OJZH 3SGJC 1TTIA 5I1IH 5AYTA 2ZCGA 4LCIH 3LENA 4BZ2H 4YTRA 3AYRA 3C0LA 4AMCA 1OTUD 2R82A 4BS0A 2YN5A 4J6RL 5EG6C 1DVZA 4GSDL 3WDPP 3LRGA 3O45A 4O2FA 3TN0A 3HIZA 4BQ8A 1DV7A 3PBMA 2H0FA 5A6SA 3EXRA 5IOPB 1MHHB 1WAPA 2VDQL 1TZGL 2GIMA 4F92B 4O50A 2BVDA 1KFKA 1EQPA 3LKRA 4AUUA 2H8XA 1PS9A 4IPNB 1JPTL 4J3OD 4XO5A 2CGRL 2V5YA 1I8KA 1P4BL 3IJDA 1MF2H 5D7SH 1B6DA 2PDMA 2R83A 5I1DB 2I60L 1SUXA 4ZVJA 3WKNA 2OG9A 4MQSB 2YCIX 1I8UA 2YB1A 2EE6A 3HPLB 3Q1SL 1XZ0A 1L7IL 1TPWA 1FA2A 4AZHA 1FWNA 3WD3A 5AYZA 2XFXA 5GHWH 3VD3A 4ODBD 3E5PA 4NSKB 4K8EA 5I6OA 3S3GA 1Q2RA 4OUEA 1CR9H 3ZVHA 5EZIL 2F19L 1RJYA 5AW1B 4N2FA 2MMXA 1V7ML 1UWXH 4Z1YA 1D9KC 1PX4A 3G1VA 4DW2H 2NOYA 2APWA 1NL0L 4ZT1A 2FT6A 4ACPA 4IQLA 2XWZA 2O5YH 1KY7A 5JPMA 4ATWA 4XP1H 2ARJB 4TYUA 1H7NA 1QO2A 4DI8A 4EWJA 1HILA 5C3IA 2M2DA 1UC4A 5ANMB 5KBPA 2IQ9H 3A9BA 3PNUA 2Z2AA 4Y5YA 3FONB 5ABTA 1AODA 4O9HL 5E1AA 1ME9A 2QIWA 3NPXA 2IAMA 4TIMA 1T21A 4MKSA 3GAYA 3IRZA 3QZPA 2K4WA 3AY2A 3L4UA 1KCVH 2DBLH 2B3IA 2Z1KA 1H0IA 2XOTA 2FHBA 4LEXH 4GYPC 1J9TA 1DKWA 3VUSA 1W80A 1LBMA 1A4KA 3H9SA 5IBUG 3GS6A 4WIWA 2YPVH 3QFJA 4U1NB 4GIAA 3ES6B 1RY7B 2ATPA 4W9TA 3U2EA 4M8QA 2V2TB 4OW6A 3PTDA 4HHMA 2HFEB 3T0ED 2WINA 3KP1A 3U6XA 3CEPA 2PTVA 1MEIA 1H7RA 1LTDA 5SWQB 3CH0A 2QADC 2B16A 1KRCC 1N0LB 3RZCD 5LQBH 4PP2A 4X5LA 4OF8A 4G6ML 5A6LA 2XETA 5DMIH 1GZHC 1G69A 2HE8A 1GCYA 5GRJH 5E4OA 3UJIL 3IJQA 4BJHA 1J5DA 3TEYA 4AX6A 5IREA 3QIWC 2BWGA 4CCCA 1TETH 2I69A 3X12B 4HH9A 1TTGA 1OCNA 1KTLA 5JR1H 4FYQA 1AAJA 1QHZA 2WSKA 2C16A 4NQXA 4ZB2A 3KBPA 3O6FA 2P9RA 4S1QH 3EYOB 3VI4E 4QYOB 4WDIA 1L0YA 3MR9A 3RVUD 4RAUB 1PJ9A 1G6CA 5F70A 3J7HA 2PP1A 3DRQB 3AADB 2V2HA 5EB8A 2WKGA 1IQDB 3S4SG 3RX5A 3V6FB 1OSPL 1R2TA 1S2VA 1MQRA 3M7OA 4Q6XA 5DJAB 3GTVA 4LDLB 1REQA 4S1DD 1Q9OB 3QV7A 3VG0L 1UOLA 4XHJD 2EP6A 4LCIL 3N91A 5CP7A 3GSNL 2UY6A 1RHFA 1SJHB 2BS9A 1UOKA 4L1BA 4V28A 1LQ2A 5F8QC 3ICJA 1K6WA 3AGVA 2NQLA 3LNGA 4LHUB 4XPHL 4EN2A 4FHKA 3T7VA 4TULL 3ZJAA 1HAWA 2N4IA 2QJGA 1CD0A 5E6ZA 3I3EA 4ZW7A 1SZGA 1BWMA 2EDOA 1BXCA 3GDLA 3O6LH 3IJSB 3PWJB 4KKPA 3Q67A 1MZHA 3UAJD 2R0WL 3WNIA 5IQOA 2OOFA 3D52A 1ED3A 4EK7A 5FKAA 4CGTA 1IXNA 4PLJD 1OX5A 4WOZA 4Y6GA 3GB7A 3QJQB 5I9QB 1NIEA 4UYQA 5AAWA 3R1GH 4PUDA 3PDDA 1HJXA 4QRUA 4I89A 4HJ1A 4DAIA 3UYRH 1PU0A 3TLLA 4RVBA 2QSCH 5BOJA 3VTTA 5KBDA 5IFAL 2R0ZL 3CQJA 5JXAL 2IKIA 1T99A 2JEPA 2X42A 1X7SA 2RCSL 4OKDA 4P46A 4GIPD 1KB9J 1YAIA 3VSUA 1ODUA 1A14H 3KZ8A 2X3CA 2BMKB 1IL1A 4O53A 2V3FA 4QD2E 5FUCC 1MRCH 1ORQB 3MV8A 3P02A 4FOUA 3MZGB 3ATBA 2B0SH 1SMOA 1Z9SB 5K5YA 3P2BA 4BI6A 2IQ9L 4ENED 1DQJB 3S46A 3SKJL 3MT1A 2GQ3A 4HQQH 3WG6A 1ACCA 4HTBA 4HXBL 2FGWH 1C08A 2X1UA 3IBEA 1PLBA 1T03H 3DUSB 3RG1C 3QS2A 3VMNA 1R87A 1IE7C 2DVUA 1LLZA 1JCYA 4KK5D 4LAQH 4IKKA 1KIRB 2G9HB 2WO4A 4HD5A 4GZJA 3MMUA 1IIIA 3LM7A 4B3EA 3ZYOA 3OGRA 3U2IA 2P5ED 1FAIH 3HAEA 3T81A 1I8MB 1BJMA 2HCZX 4M4PA 4WY7H 3IDYB 5C0JA 4JMNA 4AY7A 1VJZA 2AJZA 3VFLA 2NXYD 5CCKH 3EGXA 4PMFA 3VD1A 2BFGA 2ZKHH 1UZ4A 1R3WA 3EJYD 2V6HA 3K0WA 1N9PA 5D1QD 4PRIE 3TIEA 1KBIA 5BZXA 3POCA 2SEBA 1HWHB 3T0CA 1CT5A 3EWXA 2B2XL 4BSWB 3D0VA 4LTSA 3MLVH 4CQ8A 3W00A 5AHFA 4IG2A 3IEAA 4FXKB 3MNDA 4D6GA 2UX7A 5IROC 1PF3A 3BV7A 4M1GL 2ZQ0A 2EO7A 4WUUE 5AC5A 3GD1C 4IIQC 7FABH 3SDOA 4O18A 5FOBA 5FW8A 1X8FA 4Q8VA 3RNKB 1UQSA 1BYNA 3FIGA 4QSFA 3MLSL 4LCQA 3IKKA 1XWVA 3OWRA 4DVRH 4MNLA 3C3NA 3HI1B 3I6SA 1QUMA 1SXZA 2DQCH 1WDPA 3SPVB 5F7KC 4GFTB 3N2CA 1RBOB 4PH8A 3PZQA 4MMZC 2K3TA 4YC2C 3ULUF 5IB4B 2RH0A 3V75A 3ECBA 1EO8L 3IFNL 1GOGA 1HJCA 4LV4A 1D7FA 4MCYB 4N8PA 2H2SC 1KPUB 1TTBA 4EF9A 3ZLHA 1KF9B 4ZQPA 3HQPA 3ZZLA 4KS0A 1PG7X 4G56A 3TQPA 3R8QA 4MNKA 5FA4B 3NCCB 1ZT7B 2FZ9A 1FVDA 2PWEA 3F7YB 1LO0L 1HZKA 4JREC 4JKPH 1IEAB 4PRHB 3TO2B 1XGEA 2EXWC 3A4DA 1XL4A 3VFGH 1G4PA 2NY4D 4I3GA 4W88A 1K9FA 5FO8B 1GH7A 5AKTA 1KJ2B 5TE6L 3WUWB 4LMQI 3CLMA 4XXCC 5JBEA 3QIUD 3ZL1A 1UKOA 5D9SA 1LE9A 4LGPB 4IBLT 4FXGA 4KOBA 4BK9A 1BFVL 4QRQA 4TXEA 3Q01A 4L4VE 2IH1A 1TQVA 3WD5H 4FTDA 4BA0A 1PB0A 2J43A 3NQIA 1KYAA 3ZHDA 4JTAA 1BXVA 2MNUA 5JZ7D 4L29A 4UZSA 2YAEA 4BZ1A 3N18A 4S3KA 2BWDA 4PUBH 2X6MA 3WIAA 2ZKWA 2G4GA 3WNLA 1K9TA 3UYPB 1HX0A 2WTPA 2INEA 5LAXB 3HS0A 4GG6F 4X4XA 2PB1A 3HF3A 3DI2B 2CRYA 4QRSA 3IJEB 2FATL 3ZWTA 2QQQA 3DDFA 3KBJA 1E8XA 2JVUA 2E7HA 5AL8A 5C0NC 4DJFA 4A37A 4Y4FD 4HUXA 4UTAA 4YWSA 1A3RH 1PE1A 2ARJQ 4KK8C 1LLOA 3FB6A 1VCAA 2XTSA 2B1HH 2VABB 4MOZA 3UBXI 4YHPA 5CZRA 3KYNB 1QW9A 2CLIA 2V17H 5F7UA 1XFBA 2FNBA 3AOFA 3VWJD 1OAJA 1TJIL 3DFHA 3H12A 1O5PA 2ZRXA 3MP5A 4JZNB 2Z9TA 5IW1A 1WAEA 2RQ8A 3LIZH 4PJIA 1UCWA 1XLAA 4X6DE 4HJIA 1H1NA 3HC2A 3UP6A 1TLKA 4KPHH 5SWUA 5L2KA 3ZYZA 4Z7UA 1P53A 5M1TA 4AF0B 3WIFB 1AY1H 3BDYH 5I0DA 5KBLA 4C6LA 1MAMH 5IFJA 2VZUA 1T6MA 5LA2A 3BGMB 4PRNA 3NZHL 3C5SA 4GYJA 4PY7A 3PFQA 3VXME 1UWGL 4LUTA 5MI0C 2DLHA 4D9QE 3ZDYE 4CAGA 3KBSA 4L37A 1OM0A 1FWIC 1PG7L 3V6OC 4GO6B 1OPOA 3L5HA 3EX1A 2DDQL 4IW4C 3MLVL 1AFVL 1JQVA 2OR8A 1AKPA 5JORB 2A77H 2CBVA 1JV2B 2V2CA 5A7BA 3CVHB 3VFTB 1FXQA 4ADIA 2YXVA 4KX8A 1DIOA 4EZJA 4FL4B 4G2AA 1GC1L 3DYPA 1OJXA 3ZHFA 4N9BA 2PYED 1XXDC 2BRRH 4TUJA 1KC7A 4GH7B 1MHCA 4HUKB 1ZY9A 1VFAB 2E27L 4P2CG 2BERA 2W07A 5K39B 4DVRL 4Q74A 4W85A 1UM5H 5C0AB 4KTDL 3EYUL 5I16B 2DQCL 4LZKA 3UVIA 2A9MH 4GJ1A 2ORBL 3CIWA 1JDEA 2EDFA 4IH3A 3UPMA 2BH0A 4ANXA 1J8SA 3GXUB 1LEIB 1LK2B 2EVFA 1FL3B 3C6CA 1NCWH 3GIVB 3WFAA 2Y7DA 4X9YA 3D08A 5JIHA 3I2CH 3NDZE 4CDGC 4GKLA 3OXRB 2F18A 4XBGB 4HULB 5F4WA 5DS8B 2LHAA 4PCNA 2FEJA 3V0EA 2OKTA 3SDYL 1HDMA 3V1PA 5JXQA 5HYJE 4JEJA 1MRFL 2Y4SA 4NU7A 1CDHA 3OL2A 4QISA 4MAYC 3RA7H 1F4YL 3NJMA 3C3UA 1EJ6A 1HYSD 1B31A 1NFDB 5E6IB 5F1UA 3M8OH 2HPOA 3GI8H 3N1PC 2RGLA 3KWWB 3MSGA 3ZIMA 5FDWB 2LT9A 4NZUL 1T6WA 1GTNA 3KS0J 4S0SD 5DZ9A 1NLBH 2WWKT 5GS1C 2NUTA 4DFHA 1X1NA 5AVYB 3P4NA 3RR1A 1CFSB 3O8AA 2C3HA 3GMQA 2Z2BA 4NO5B 1DANT 3ZLFA 4GGBA 4K2UH 2JLPA 3QAQA 4ZAKD 4F15B 1HH6A 3E80A 4Q97A 4C8XA 3DGRA 1O66A 2Y36L 5FGCE 2K8QA 1T5WA 1TO5A 4A67A 2I27N 4G3YH 4HMNA 5LGHH 3JV4A 5T3XL 3TC3A 3US0A 3QHMA 4AZ6A 4P9MH 2VENA 4O02L 4X99A 4GBXA 2Y85A 2QGCA 5I1CL 1XUZA 4AL8L 1ELSA 2R2BB 4GP5B 1PTDA 3TMLA 5EY5A 5FGSA 3WSUA 4JQIL 5LXXA 1PZAA 1KCRH 5HYQB 2R1WA 4OLZL 1M04A 3EB3A 1PW3A 2C0HA 4ODVH 1YPZB 5C9UA 4JCMA 3U25A 1YLVA 3IDIB 4Q52A 3MRDA 4K7FA 1KV8A 3PP4L 1L6PA 4XBEH 3G22A 3GHTA 2FMNA 4Y90A 2EDRA 3MNWA 4A6YH 1VJIA 1HP4A 3UEQA 5DMYA 1X7QA 4I2XB 3RHWF 3Q8FA 1SMAA 1YX1A 4FQHA 2C18A 3QHOA 3IYLW 3QP3A 1Q6FA 4H8HA 2GUOB 1LL4A 2A73B 3ITLA 1XQLA 2BVOA 3EOLA 4BA8A 3BVJA 1Y0LA 1F13A 4IZGA 4U3AA 4XSMA 2ZIDA 3FNKA 1MJ8L 2B7QA 3N43F 3R8RA 1LWIA 4NDMA 2JXMA 3EGDB 2R59A 1W8SA 5ENWA 3S96B 4HFWB 5CPSA 1CDYA 1CLOH 4OFYA 2AEWA 4RISH 2AQWA 3SEPA 3QHNA 3HFML 1GKEA 4CUCA 3IT8D 4XH2B 2WLIB 2E47A 2MH4A 2I24N 1ZPUA 4X4MA 3UYCA 5IRPA 5H35B 1K2DA 5C2UB 1L0QA 1VZIA 2V2XB 4OJFL 4MJ4A 3ZR4A 2WUCL 5KS9E 2ZPKH 4WSJA 2FEDD 4R26H 4R3SB 3C86A 3KYOB 4FQ2H 2H6PB 2A74C 3P11L 3WF2A 1AL7A 5DF0A 4HCRH 1FKWA 2XTJC 3JUZA 3WO8A 3U2ZA 3WJSA 4U7KA 3OZ9L 1P7QB 2FRGP 3WAKA 3SY5A 3N15A 2FYMA 3BN9C 2OAAA 1OGPA 5LHEA 2IAMD 2BSSA 4AQAA 3X13A 1P7KB 4N2LA 2SFPA 1MQPA 3T4CA 2I9TB 3IACA 3QC5X 3DSNA 4ZZFA 5KSBF 5D7IA 1D5MA 1MCBA 4KNSA 4CVXA 5IVZB 4IIGA 4DRSA 4HU0A 4HF5L 3CHFA 2YDSA 3QFJD 4OB5L 1J9SA 5LN8A 1BZQK 3OJGA 1W3NA 2FEEL 4IQHA 5F7LB 4NX0A 2JJSA 4NENB 1J2WA 3EPMA 1ZLDA 3FO2B 2RA1A 4DQWA 1DBAH 1FUNA 4GW5A 3HNSH 5FYKE 3DETD 4F2UA 3NP3A 3PZUA 3I75A 4PVBA 1NLBL 1XR2A 2EUWA 2DH3A 4ADJA 3AZUA 1JUKA 3DGGA 4F5CE 3ABGA 5KN5B 5IHZB 4N0RA 4K2UL 1IT7A 1XTLA 3DX8A 1X96A 2XUCA 3NPSC 1XC6A 2AJXL 1EO7A 4X22A 3FCUB 4OLWH 3BEWB 4IKIA 5DT5A 5A7EA 1IIKA 3HC0B 4AEIH 2KERA 4NLAA 5LGZA 1RU9H 1BVWA 3RJDA 4FULA 1D3HA 3GMPB 1EFXA 4UDUA 3M6DA 4HHHA 4ODHH 3SRFA 4JHUA 4HP5A 3FUIA 1QNOA 3GG1A 5GIRB 3T8XB 3NQMA 1T1YB 4P5TB 2CKSA 4ZOEA 4XBEL 1CL7I 1N2RB 4QRAA 1FE8L 5K59E 4OFKA 2Y2TA 1ISXA 2VGLM 1DLFL 5DFVD 4FHAA 3GKWH 1SOKA 4GAAA 1Z89A 4K3EL 4HCIA 4C47A 3D0CA 2VCBA 4AH2B 4RMQA 2QVIA 1ZENA 5DWUH 1QOKA 1E6ZA 3TGXA 1QLFB 4NGHH 3TBSA 1OSYA 3WUWG 4WI0B 2X05A 1O1HA 5AYUH 1OTSC 4C6FA 1KNOA 3V6BR 4BZ2A 4YGVB 3FOMB 4Z7VA 3UFYA 1GRWA 2IGLA 4HGWB 2YXGA 3HUJF 3NCJL 4H9XA 4H0GA 4LKXA 5CG0A 3LZFL 1KDIA 1HSBA 4JAMA 1DQDL 5F96L 1ISVA 3GHEH 1U95A 2IADA 1G9EA 1EEQA 1F4WH 1ZBVA 1XLMA 3D5HA 5EUKB 3ARTA 1I1AB 5BS0B 5ITBL 2C3VA 2F8VA 3NQKA 3IDXL 4JTRA 3IB4A 3TTQA 4QAWA 3BEVA 3QO0A 3MOAL 3KYAA 1B4RA 3P73B 4Y5VA 4NQUA 3F84A 2XH4A 2BLFA 5CAKA 3UR2A 4YHMH 4W87A 3CHCA 4P46D 2AI0H 4IL0A 5HYEA 3H7BB 4P59L 3RPIB 1E3ZA 4LSQL 1NINA 3GVRA 3P3BA 2YD9A 3MV8D 3CHOA 5D55A 3ZLGA 1XF0A 1EDQA 3TYFA 4NFCA 3QTGA 3AXIA 4Y4HA 5EYWA 2GGHA 2ADAA 5IVXE 1FL6B 1WLHA 2Y2YA 5FYKH 3NA8A 3TZVB 2FMOA 2Y07H 1B2WL 2XFFA 2HUEA 2OZ4L 4NRXB 4JPIA 3PBWA 3WS6C 1EWHA 5FJTA 4Q6IA 1G7HA 3G9AB 4RGNE 4H25A 1UURA 2C3XA 2ZKXA 3KCPA 5KYYA 2QV5A 3S9DB 4G5DA 3MC0A 5IFTA 1NCUA 3IFLH 4K9EL 5FYKU 1NFIB 3S9ZA 4O51A 1T0OA 3VOGA 1KTDB 3MBEC 1QFPA 4X7FC 1SY6L 4ZMAT 1UWYA 5KOMC 2BZCA 3MHGA 1ZFJA 2CHOA 4BWUA 5C5YA 4BRVA 3ARSA 4IDLA 2ESVB 4DF9A 2EUZA 1VADA 2EPMX 1SVBA 2OQJA 3ZR5A 1P43A 1RZJH 2F5AH 1BF8A 1XCTB 1XL6A 4EIUA 3B03A 2VC2L 5ICZB 1AD0B 2OVLA 1NDMA 4NQTA 3WJJC 4MJ6A 5E24E 1K8YA 2V9TA 1EA9C 2HTKD 3ZLQC 4YDZA 4QXIA 3GS4A 2O9PA 4NX5A 3FQNB 5E9DA 2YPVA 4NCC2 3LLFA 2Q76A 4LLWB 2I07A 4QHKI 4HS6A 3VQLA 3RFZB 3WLWD 2Y7SA 5LNWA 2VL4A 1N82A 4MZ1A 4J5VA 1W0MA 1GOXA 5J1AA 5HK4A 4GIRA 1GMEA 4PWEA 2FIQA 3QUMB 3KPSE 4MXQC 2R2HB 3G5VB 3L4TA 1E7VA 4JPWH 3BT2H 4NN7C 4LVBA 2OMAA 1K4DA 4FNTA 4I0PC 4AEIL 5ACZA 3MNZB 1L6YA 1Q3NA 3IJ7A 43C9A 1WFOA 3WNNA 1KIPB 3VC5A 2BHUA 5DRXB 3HOGA 5GSVA 4NZ4A 5K9QG 4OLVH 5DUPH 3EYFB 3F7PC 1IM9A 4DYKA 4HALA 4I5RA 2VLJB 2IOIA 3FN9A 3PULA 4AKOA 1A7OH 5IVNA 3NAAH 3QJRB 3WO3B 2VR2A 4LCSA 4KZCA 4BUHA 3EG9B 4AEHH 4NAMA 3SUUA 1IXOA 4H9UA 1F3RB 1LDCA 5I74B 2WMFA 3AITA 5JA9A 1KIUA 5K9JH 5KJ4A 4WWKC 2PCFB 2IW0A 4GG9A 4GKTA 3PZNA 3XIMA 3EWBX 5IQMA 3UF9A 3THAA 2DTMH 1W9XA 1A4LA 1M03A 3T1GA 4DUWA 3G5EA 1QNIA 4XO7A 3EKCA 4L5ZA 3QORB 2PZNA 1WFUA 2MPAH 4FOKA 5IW6B 1RZMA 5H8PA 5DZVA 3EYPA 2QJHA 2G5BB 2ZOLA 1NQ6A 2WYHA 3CE1A 3QR0A 2VFDA 3BW2A 3FH7A 2VMDA 5IHUL 4RMWA 2PGFA 4NBXB 4KK9D 5D33A 4U2YA 3AQXA 5BV7B 3PWNB 3D87B 2RKXA 5K3VA 1KZYA 2NW0A 3VKCA 3A67L 4XCFH 4TNVF 3T1FB 2GB2A 3DI3B 3RO8A 2HJFB 2GSGB 4S3JA 3D25A 4ZUUA 2CO6A 2NNAA 4YHML 1TMCB 1XBZA 4CCEA 3EO0B 4KO6A 2OZNA 2CHDA 2AI0L 4LRIC 3QDGA 1YO4A 3F85A 3OA3A 5C55A 1A1MB 2DZTA 3RX4A 4I0KA 3CN2A 1HHGB 5MEPB 4MJZA 1V3MA 1YCSA 2O9TA 4CVZA 3OGVA 1YE6A 1WFTA 3ZE0B 1R1CA 2RFXA 1D7KA 3O6KL 4Q9BA 2HN7B 4I3RL 2R2EB 3RU8H 2LU5A 4EBQH 1DBKL 4NKIH 1XGTB 3DAQA 1GG0A 1K4CB 3AIBA 5TAOA 1Z6KA 2Y25A 3S5YA 1R3YA 4DJFD 2VDOB 1A49A 2V9RA 3I6GA 5I8EB 4W86A 5F0PB 1JZ7A 1KYUA 1DQIA 3ZMRA 4RPQA 3BVNB 2IEPA 5I77A 4WV1B 3FXGA 5H2ZA 1Y65A 2EE0A 3VTAA 2UY3A 3ZTNH 1HKJA 1USZA 3JUGA 1OP4A 2ED6A 2X87A 1A25A 3IXTA 4YN3A 4J3SA 1I9EA 2O5NA 4FAAB 1UR1A 1Z0NA 3BE1L 3CV7A 4ZZ9A 3CBWA 5CCGE 3R8BB 5LG1A 5L4JA 1E56A 2D2JA 5IY5B 1YNYA 4QKTA 3NPZB 2Q71A 2HXAA 2YAPA 1V3KA 4LE8A 2ROYA 3QDAA 5KBKA 1MCWM 1KUMA 3AT9A 3FMGH 1KCXA 1XR8B 3RU8X 1TU2B 3NNTA 1ZAGA 4GQQA 4AVFA 3DROA 1H63A 4L1XA 3WE6A 1WWCA 1XGUA 4HZ8A 3I4EA 1NBQA 2IPGA 4J6RH 3MAWA 5F72S 1SJEB 2GJRA 1THFD 2BSEA 5CGTA 2BSTA 1R3KA 1VH7A 3QVQA 3VKJA 4U6TA 4GSDH 5E8NB 4HQVA 3MGTA 5IQNA 2VDQH 2F8OA 3VRLE 2UY7B 3PXLA 5FYLL 5HMEA 3RGVC 1QVBA 3W1TA 4ZEPA 3ULVL 1ZJAA 1M1BA 1N8IA 3SJNA 5TGBB 2ZXQA 1JPTH 3BD4A 1SFHA 2CGRH 3QISA 2CCRA 1E5NA 1P4BH 1BQKA 1S7WB 1AGDA 4QTIL 5A2IH 3AJXA 2PDQA 1T2QL 3MJ7A 4MJID 2EABA 1UD6A 1QPKA 5EO0A 2GHZA 4GJIA 3GNNA 1TVBB 3Q1SH 1L7IH 2VOMA 3FO9B 4NAEA 2NZ1A 1S7RA 1LOQA 5A8OA 3K0YA 4B2DA 3MRIB 1US2A 3KXFE 3B97A 3CHRA 1WDQA 4GNJA 4W9CC 3K1GA 3VKAA 5EZIH 2F19H 4JDBA 1V7MH 2NY7L 3V16A 1PSKL 3VRIB 3ZKSD 1NL0H 2FAUA 3VM5A 4UQIM 4IBVA 5BQ7A 1KPRA 2LW3A 2F8XC 4ORZC 2CKNA 3CYVA 3N40F 5GGSA 4ZFCA 4BFBD 2PW2B 2L5HA 2AANA 5K33A 3H6OA 4N2MA 3SBWC 5C08A 3IDUA 5PAZA 4K68A 4KRUA 3FZUD 1KFEA 1YEHH 5DVMA 3WN6A 3SSGA 2QF8A 3INUL 4O9HH 3D39B 4HNOA 4PJBB 4PGBA 3REQA 1V77A 1I7RB 4MD4A 5IB1A 1JXFA 1OAUL 4LNRB 4ES9A 2YBVA 3KFTA 1D8WA 3GSXA 3QT2A 5K9KA 1UG6A 5FL0A 3BXNB 5BNXD 3WCYA 3JV6B 1WHPA 3V0DA 3WFHA 4I18C 4P2QB 4G6JL 3IDGA 4NJIA 5EBLB 4GUQA 4C56E 5IBXC 3S3CB 4Y7EA 1LRTA 4DBWA 1S2TA 3NESA 1MCKA 3HHRB 4GBXD 4KRNA 3SCPA 1KLGA 4JPQA 3QC0A 2ED9A 2GJJA 2UZYA 1YUHB 2VN5A 5JIQA 1TPXC 2HT4D 1H41A 1FCGA 4U1KB 3LD8C 3GT6A 4G6MH 5LCVL 2AZUA 4JRLA 4UDTA 4U1JB 1E4KA 5BRZB 5CGQA 3L95B 4OZIF 3S5SA 2PCEA 1PQZB 1OFPA 2CZEA 2V3DA 4KJYB 2HKHL 2EADA 3EBGA 5DC9B 3OPSA 3CMFA 1S2EA 2P5WE 4PJ7F 1XXXA 3NJ3A 3OYZA 4G9PA 4KTGA 2DW7A 3NGBB 3T2NL 4KWUA 1E0XA 3MNMA 5I1LA 1KV5A 3E74A 4LCCA 4J3UA 2VGGA 4H2HA 3NPWA 3C75A 2HTLD 4JLRA 3OC8A 1PX3A 3VOJA 4NZ8A 2O61B 4LBUA 5DURB 1ZANL 3ELQA 4PRIA 5LG6A 5EF1A 5DS2A 1CT8B 4B97A 1OTTC 4RMRA 4CMHB 2PGRA 4HZ6A 5FSEC 2PWHA 1OSPH 4MCMA 2JQAA 4FNUA 2DM2A 5D09A 2F61A 1EAPB 1LMKA 3VG0H 3PIQA 3UG3A 3QQ9D 5FA3A 2P8MB 4AC4A 4K8GA 4WUUA 3GSNH 3OR7B 1H7WA 3FCTA 1JGIA 3UNTA