1KBBA

Mechanistic analyses of catalysis in human pancreatic alpha-amylase: detailed kinetic and structural studies of mutants of three conserved carboxylic acids
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQAVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mechanistic analyses of catalysis in human pancreatic alpha-amylase: detailed kinetic and structural studies of mutants of three conserved carboxylic acids.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ALPHA-AMYLASE, PANCREATIC
total genus 176
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2001-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 1kbbA02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1kbbA01
4M24A 3VD7A 1R34A 5BXSA 3D51A 1JIBA 3CZEA 2E9LA 3CZSA 1BAGA 2ESCA 3BVUA 2JF7A 4JFUA 2UY3A 1VEPA 2DH2A 1RP8A 1CXIA 3APGA 1NH6A 4AIEA 3BAXA 3AIBA 3CHCA 4BQ3A 2D1ZA 2VZOA 4JHOA 1OT1A 1QI4A 1XHGA 1R7AA 4UFHA 1EOKA 3U5UA 1FOBA 2WHMA 1KB3A 1R33A 4AZHA 1QNRA 1GW1A 5FD0A 3UCQA 3BUIA 1QVBA 2OW6A 3SCTA 4NZCA 3T09A 1HNYA 1H49A 1UA3A 1RPKA 1JDAA 2EPLX 4LPCA 2XM1A 1NWSA 1PS3A 1E0VA 2ZIDA 5CZKA 3MO4A 4D6HA 1DWIM 4D6IA 3SCWA 1JF6A 3PZQA 1XH0A 1WB0A 3T0DA 1NWUA 2J4GA 3WY3A 5I79A 5A8PA 2F18A 3I3DA 4PSRA 3NJ3A 1QWUA 3TTYA 2QPSA 5FCZA 3SCOA 1QNOA 4HU8A 5A2CA 3ARTA 3G6LA 4DWSC 3AS0A 1CLVA 1PX3A 1E6ZA 4J3XA 4CU7A 3L4UA 3WY2A 3VIHA 3U7VA 2NT1A 4DO4A 5A2AA 3J7HA 2XJ7A 1PBGA 1V03A 2ZXAA 5ABGA 4C7GA 1B1YA 1BFNA 4W7WA 3BLPX 3WSUA 2WBGA 3GZAA 3PTKA 3QOKA 4ZENA 3UR8A 1H11A 3MKKA 1QNQA 3VIKA 4PUDA 3GH5A 4RE4A 1ITXA 3DYPA 3VMNA 4NX0A 1ZBWA 4OOUA 4MNJA 3MANA 1W9BM 1J10A 3VDHA 1IZKA 1K9EA 3D5HA 4FNQA 1E73M 3ZMRA 3A5VA 4IM4A 4BQ2A 3OGSA 2XVLA 2VMFA 1E72M 2PC8A 1VEOA 5CGTA 1E1FA 2FHFA 2ZOXA 2VNCA 2RGMA 4BQ5A 1JAEA 5E1QA 2X0HA 3ZIZA 3CHFA 1W91A 1BTCA 2OSWA 2ZE0A 1TQVA 1DWHM 2W91A 1W3LA 3GNRA 4CCCA 2WM0A 3WNOA 3HZ3A 2VCBA 3W27A 1VEMA 2W4XA 1GVIA 2ZX5A 3MSGA 1W3JA 3OB8A 4WF7A 4ACZB 1ZJBA 3WF1A 2DSVA 3TTQA 4PMVA 3RO8A 3RPMA 1QHOA 1E6RA 4U31A 3PN8A 4UQCA 3ZSSA 3WD1A 3WNMA 5HDRA 2PB1A 3VIMA 3RDKA 1MWOA 4M1RA 3BSHA 1LJYA 3W82A 4NI3A 1XYZA 3FN9A 3WY4A 4U3AA 2ZX7A 3EDDA 2YFOA 2YFNA 3DX4A 1QOXA 1KQYA 2DT2A 3WQ8A 4W5ZA 1M03A 4ZE4A 3F5LA 1OSEA 3WDQA 2ZUSA 1U33A 2YL5A 3AXIA 4CCEA 2WW5A 1FFQA 3DC0A 1TFVA 3ARYA 4TX8A 5A95A 2EPMX 4CVWA 1R85A 1W3KA 1HX0A 4KMQA 4DM1A 1FP8A 2YA0A 4GI9A 3WD3A 2WCSA 3VD3A 1GOMA 2DT1A 3A4WA 4U3CA 1QPKA 3GH7A 1V6UA 2ZX9A 2Z1SA 3ZSTA 5E09A 3K4DA 3VGDA 2VCAA 4JCLA 1OGSA 3A47A 3W25A 1UWTA 1IZJA 2E8YA 3VINA 2Y8KA 1OGGA 3SUWA 1H41A 2CKRA 1X6LA 1WP6A 3N17A 1UASA 4DO6A 1UA7A 1Q6GA 3FHAA 3VGHA 4WK9A 1EHAA 4JZ5A 4N0RA 3ARRA 4Z2HA 2YL8A 4TVDA 3II1A 5E0CA 1FP9A 5TD4A 1E43A 3HG4A 5GPRA 4AZ6A 2O9OA 3CUJA 1MXGA 2X2JA 4UQAA 2PWEA 2EPOA 1PX4A 1CEOA 1FH7A 3CHEA 1N82A 1UD4A 1E4MM 2WSPA 1UWQA 1GJUA 1US3A 1W2PA 1CWYA 1ZBVA 3MMUA 3KLLA 1WDSA 3IANA 1WZLA 2VX4A 1MW1A 3CZLA 4WKHA 1CTNA 2J75A 7TAAA 4GZIA 1JFXA 3UR7A 6TAAA 2J7EA 3AISA 3BAWA 4FLSA 4HPHA 1U30A 3WENA 1FFRA 4AIUA 2WSKA 1MQRA 2F7PA 2V38A 3W29A 3CZ8A 3NDYA 5E6YA 3PZOA 4CVUA 1G1YA 3CUFA 1FH9A 4X0VA 5IFPA 3GYCA 4EE9A 2D73A 2YA1A 3B8SA 1VENA 3DX3A 4PMYA 1WE5A 3BUQA 1CXFA 3VIJA 5CSUA 3WD0A 4HMEA 1GHSA 3VGGA 3L4ZA 3G6MA 1WPCA 4AZGA 4M80A 2O92A 2HISA 3AS1A 3SIMA 2J7FA 1W2VA 2WMIA 3VOCA 1NP2A 4H8VA 3M46A 2IGTA 4XZWA 3WBEA 2EPNA 2A3HA 1C7TA 3O2LA 2WXDM 3VIPA 3WFZA 2V3DA 4TOQA 4AZ7A 3GBDA 3VD4A 1SMDA 1XGZA 3VSVA 2GK1A 1Y7VA 2DDXA 1QBBA 3VDAA 5HPOA 2OLHA 1D2KA 1V02A 1E0WA 5EFFA 4AMWA 3CLWA 4CU8A 1W9XA 2XGIA 3KL0A 3D52A 4KH2A 2VX6A 4TX6A 1E56A 3CIVA 4LXFA 1KWKA 1GZJA 1SFSA 3O9NA 3ZM8A 2C7FA 3FHQA 3AFBA 2D22A 5I6SA 6CGTA 3GM8A 4ATLA 1V3IA 5DFAA 1H1NA 4UQ9A 3TOPA 3WNLA 4E4PA 3VD5A 5A6JA 3W6MA 3U5YA 2XN2A 2QF8A 1M53A 1CXLA 3OLEA 1HP5A 2OSYA 4JHZA 3GXFA 3RM9A 3B9AA 4AMCA 2UWFA 1PIFA 4F8XA 3MMWA 4PSPA 1KFWA 4AYSA 4AY1A 2WC7A 1QBAA 5I3DA 4QLKA 5A1AA 2FGZA 5A6AA 5A8QA 1IT0A 5CXPA 3HN3A 1TR1A 1NOFA 4CCDA 1QI3A 3CUHA 3AMCA 2CXGA 1VF8A 2J7CA 1HKIA 1T0OA 1ZL1A 4D6EA 3AICA 1NWTA 5A8MA 1CPUA 4GZEA 3AMDA 3MMDA 1J0KA 4AD4A 1A47A 1ODZA 3BLKA 4PN2A 2WHLA 3LPGA 1G94A 2UY4A 5LYRA 1F4HA 2G4FA 4NXKA 5ABEA 5I23A 1TG7A 1EDTA 3WUFA 3N04A 1JI2A 3AMKA 4U2ZA 1JZ6A 2EJ1A 3EYPA 3GXTA 1JDCA 8CGTA 2IUZA 3OIHA 2YL6A 1UR8A 1ZBCA 4X9YA 1GOWA 1C3FA 1XYFA 3SCVA 1HJQA 1R8LA 4D71A 1XD1A 1VBUA 2ZXDA 2CNCA 4MNLA 2J7GA 4ZFMA 3MUY1 3WMSA 2DT3A 5E6ZA 3WKZA 1UH2A 2CBIA 5IXEA 4F9JA 2F7QA 2ZXBA 3VKKA 1XCWA 2E40A 3BGAA 2DSKA 2GJRA 2YLLA 1JGIA 1V0KA 1OWQA 4UNIA 2OWWA 1LL4A 1QI2A 4P8XA 4HA1A 3OLIA 4LGXA 1KXQA 4OBSA 3WY1A 4UZSA 2OWCA 2MANA 1MQQA 3N18A 2AOSA 3VU2A 1WO2A 1HXKA 2GDVA 3T0AA 4D6CA 2CHNA 4W85A 4TUFA 1J0YA 2XTKA 4M82A 3CMJA 3LPFA 4XV0A 5D9NA 1IV8A 3LXBA 1EOMA 2CYGA 3PHAA 2J74A 1NP0A 4AD0A 4UZUA 1R87A 5D9PA 2VJXA 4H8HA 4UFLA 3AHVA 1Q6CA 3GXMA 1CGTA 4GIAA 5FL1A 3ZT5A 1J18A 5E70A 1C8XA 4DWSA 3EJTA 2F2HA 3DYMA 3W38A 2G3NA 2EABA 4MAVA 3AMLA 4GKLA 3VILA 3E1F1 5EMYA 2FGLA 4W87A 1R47A 3VO0A 1OD0A 1XCXA 1B0IA 1OGBA 2WMJA 1BGAA 1VJZA 3EDKA 2Y2WA 1PAMA 2YKKA 3IJ7A 3WF3A 1C8YA 1E6NA 4AEEA 4A3YA 3RIKA 2YL9A 2VURA 1AVAA 1TZ7A 1DWJM 4BCEA 3WQ5A 1JZ5A 2XSBA 4KRUA 4TTUA 3VIGA 1H4PA 4UFJA 1QHPA 3A4XA 3ARZA 4NF7A 1ISWA 3SUUA 4JL1A 4CN4A 3WEMA 3M07A 4CN6A 1UKTA 2J8GA 4DUVA 2WCGA 3WQWA 3ECQA 4ML4A 4AD3A 2PWHA 3K8KA 2VX7A 3WUEA 3F5KA 4PMRA 1B3XA 1DWFM 4FMVA 4DO5A 4P8WA 1G5AA 2D20A 1UKOA 4D6FA 3LRMA 1ISYA 4KGLA 3HG5A 1GJWA 1OINA 1H09A 3THDA 5F7UA 1BQCA 2Y5EA 1CGUA 1MXDA 4RE3A 2D0GA 2ALWA 1ZS2A 4GQQA 2A3EA 3AYSA 2DGAA 4W8AA 4D1IA 4MNKA 1H0IA 1W9PA 1JYWA 1K9DA 2WAGA 5AC4A 3DHUA 5DT7A 3W6LA 3QOMA 3AIEA 4L4OA 1D3CA 1XV8A 4P7OA 2ZUVA 1K9FA 1C90A 1CXEA 3TA9A 4UFMA 2BY0A 3U57A 3WDIA 2BXYA 2BVDA 4AD5A 3BMVA 5A6BD 2BY1A 1B2YA 2GUYA 2W5FA 3W28A 1WZKA 3K1DA 1BLIA 3GXNA 1FHLA 2EADA 3F5JA 4HOZA 5BRPA 3BAJA 4ZXOA 1XSIA 2WVSA 1JG9A 3CZNA 3ZJ6A 5I24A 1CECA 3BCFA 2VRKA 3PZIA 2QHAA 2J8FA 3GXPA 5CGMA 4ZXLA 2FH6A 2W67A 3WF4A 1LL6A 4E8CA 3WEZA 1JXKA 1LG1A 4UFKA 1KXTA 4EANA 3QGVA 2FDMA 5JBFA 3D50A 3O6AA 1V3MA 2V3FA 4FLQA 1V3HA 3EDFA 3CTTA 1UYQA 4UTFA 1I75A 1JF5A 3LMYA 2VTFA 4M81A 5AYBA 1UWIA 1HXJA 3OG2A 3BLBA 4MAZA 1KR1A 3SEPA 4E2OA 1G0CA 3A21A 4CU6A 2NW0A 3ZR5A 2CHOA 1JZ7A 1B30A 1CLXA 3WD4A 1J0JA 1I1WA 1V6XA 3SCSA 4HOWA 1JD9A 4GI6A 2GDUA 3TTSA 1MW0A 1BYAA 4GXPA 4F66A 1KTCA 3VVGA 1L8NA 1E6PA 2G3IA 3RILA 5GQBA 2BXZA 1HL8A 2X0YA 2WC4A 9CGTA 5I2UA 3UG5A 1E6QM 3VSUA 4FNUA 2W66A 3BAIA 4GZJA 1QI0A 2UY2A 3JUGA 4M29A 5GNZA 3H55A 4P7QA 2ZUWA 3IK2A 5C70A 5KEZA 3WIJA 4W93A 3SCRA 3NUKA 1O7AA 3M7SA 1LLOA 2V5DA 4H41A 2CBJA 3WUGA 1NOUA 2VOTA 4FNPA 3EMCA 4A3HA 3SUSA 3L2LA 3DX0A 4UR9A 1EO7A 1CNVA 3TONA 1DEDA 4MPKA 4A4AA 2WMHA 2WHJA 1TQWA 2OWXA 2XFRA 3MU7A 1TUXA 1PJ9A 2JF6A 2XWDA 1BVNP 2V5CA 5I5RA 1O6IA 1UKPA 1UOKA 3OA5A 5FOOA 1PIGA 2GK1B 1AMYA 1NARA 3N12A 2VR4A 2VCCA 2VZSA 1OD8A 2BVTA 3VDCA 3UG4A 2YBTA 1AQ0A 2E9BA 4KWUA 1J12A 1US2A 1FA2A 1KCLA 5ABFB 5CLTA 1E5JA 3QR3A 2WMIB 1UKQA 1E6XM 1B90A 5CLWA 2J78A 2EO7A 5D8ZA 1UH4A 2VVSA 1H2JA 4XUYA 1PEZA 1ESWA 3CBWA 1UG6A 4W7UA 4UOZA 1CGWA 1S46A 4PMOA 3WQ6A 4FLRA 3VIFA 4B16A 1E4NA 1GOQA 3A24A 2JE8A 3VM5A 2E9MA 5DEZA 1QI5A 4XZBA 3BAKA 3WDRA 4K68A 5A69A 5IDIA 1KBKA 3KLKA 2X09A 3WH5A 4P7LA 4HMDA 1JZ4A 2D0HA 5EB8A 1VFOA 4DUWA 2PWFA 4CD6A 3WFLA 2VZVA 5A8NA 1V3LA 4HU0A 5KZ6A 5M5DA 3MUIA 4P8VA 1SMAA 1JD7A 1NQ6A 2W63A 1XSJA 3CZGA 1E3XA 1TVNA 1WCGA 3FY1A 4F79A 3PTQA 1UWSA 5BRQA 2E8ZA 5E0FA 3AS2A 3WN6A 1EQPA 3LRLA 3ZO9A 1BSIA 3WUBA 4D6JA 4NSBA 4CGTA 5D8WA 1LG2A 2HVMA 5A6BA 4LX4A 5BYWA 4JIEA 1JFHA 4MB3A 1OM0A 3T2QA 2DT0A 3RM8A 2DSZA 1GOOA 4MDOA 1EA9C 2Y8VA 3W81A 1HVXA 1MVYA 2EXOA 2WHKA 4H8UA 1CGXA 1GORA 3UG3A 1E71M 4Q22A 3CMGA 3CPUA 4BQ4A 1HT6A 5DT5A 2VL4A 5M17A 3BC9A 1EHNA 2WVVB 4WIWA 1R7OA 1D7FA 3LXCA 1WNOA 2XPKA 2XN1A 1GOKA 1WDRA 3BCDA 3W26A 1GOIA 1CENA 1GCYA 5IHSA 2BV9A 4GQRA 1PZ2A 4PRWA 2RGLA 4D6DA 3H54A 2E0PA 3KL3A 1YHTA 4JL2A 3NSXA 1E5NA 4W8LA 1WDPA 1M04A 3NIYA 1BF2A 2J25A 1KXVA 3UEQA 1B9ZA 1JZ3A 3DX1A 3CZKA 4PCSA 1GUVA 3RJYA 4NRSA 3POHA 1VJSA 1BVZA 1BYCA 1AQHA 2VRJA 2F8QA 2CERA 1HVQA 3ZT6A 4MJ4A 2GJPA 1GHRA 5CPSA 1NOWA 3PZGA 1WZMA 3VPLA 5I0DA 1DHKA 4OGZA 3AZTA 3THCA 1B3VA 1XRVA 3VIIA 4F9DA 1QWNA 4LQ1A 4AIOA 1OB0A 1HL9A 3NSMA 3L4VA 1ISVA 4AXNA 4PTXA 2CEQA 1HJVA 4ACZA 1HJSA 2ZUNA 4EKJA 3IAPA 2CPUA 2XVGA 4TXEA 4FF5A 5CG0A 4R5EA 4Z2GA 4WLCA 1E6SM 1UZ4A 2X2IA 1UD8A 2VZTA 3VNYA 1OIFA 4WKAA 1VFUA 1UD5A 1K9TA 1TQUA 3WMCA 2YA2A 1TMQA 1LL7A 4EAMA 1E1EA 1EDQA 3FW6A 1TQSA 4CD5A 2XYLA 2WYSA 3BVWA 4C7FA 1C92A 3WNKA 2Y4SA 3PZNA 1UH3A 3OGRA 2BS9A 3BAYA 1Q6FA 2DPEA 2GFTA 3BVVA 3TTOA 1ODUA 2OW7A 3HU7A 4OUEA 4RE2A 1B3YA 3K4AA 4J7RA 1XC6A 3S2CA 5A6MA 1RP9A 2CIPA 4BS0A 4QLJA 4UFIA 2G3JA 2W61A 5D4YA 2Y24A 3VD9A 3H53A 4MJ2A 3DHPA 5CPTA 2ZICA 5JBDA 1JZ2A 2AMGA 3ZR6A 3WMBA 2PBOA 2BY2A 3CGTA 4PUEA 5ABFA 3BXWA 4OIFA 4QCFA 4JFSA 3ARXA 3WNPA 3ZQ9A 2WCAA 1DTUA 1JYVA 4M56A 3GNPA 2WVUA 5FL0A 2YOCA 7CGTA 4YN5A 3AHZA 4H7VA 4W5UA 2ZUUA 4MDPA 5LA2A 2JFEX 1MW2A 3K46A 3ARVA 2JIWA 3WQ4A 1UR1A 3A4AA 3ARQA 3AROA 3BUPA 4NXSA 4AW7A 4U5IA 3SCNA 2VO5A 3W24A 3DYOA 5BXRA 1CIUA 4DWSB 4JAWA 2TAAA 3VGBA 4AC1X 1GONA 1HKJA 3EDJA 4AD1A 2VC9A 1HKKA 1TA3B 4AYGA 4U2YA 2XG9A 1E15A 1TA3A 4NZJA 3W37A 2X1IA 3CO4A 1JYXA 2WMKA 1M7XA 5CSYA 4BZYA 2JEPA 1V0NA 5FIPA 3WELA 4D1JA 3SCUA 2D0FA 2FHCA 3VX0A 4ACYA 2DIJA 1ZU8A 1BYDA 1HN1A 1CZ1A 1NM9A 4ZEPA 4XX6A 3A22A 1E55A 2WKGA 3WD2A 4TVUA 4HZ7A 1M01A 4PMUA 4M8UA 3WF2A 5JBEA 4W86A 3GXDA 4QCEA 4B3KA 4W84A 3MV11 4PTMA 2BHUA 4CN1A 2F7OA 2EEXA 2J7DA 3AHYA 2CESA 3ZT7A 4MADA 4Y7EA 2EACA 3T08A 2C8NA 3HJEA 3KL5A 3VMPA 3MV01 4KRTA 1H0GA 3OLGA 4CKQA 5JUVA 2ZUMA 1KXHA 2VI0A 4PTVA 3GTNA 1W32A 2GVYA 5C71A 2NSXA 2BHYA 1JYNA 1W3HA 4CD4A 3HG2A 3POCA 4QP0A 3RMEA 3DDFA 1X1NA 2FHBA 5M3WA 5D9MA 3ZJ7A 1JL8A 4HP5A 2A3CA 3ARPA 1F4AA 2VR5A 4IPNB 1UD2A 1XH2A 8A3HA 1GQIA 3FXYA 1TVPA 3DX2A 2NT0A 1R75A 1JZ8A 3MSDA 4AZ5A 2WWDA 3W0KA 2XHYA 3L2MA 5A8OA 1QNPA 1HJUA 4QDMA 3VSTA 2XUCA 3ALGA 2CCRA 5A6LA 1C8QA 3GBEA 4IPLA 3NYDA 4UOQA 1GNXA 4Z2JA 1X6NA 2QV4A 4UCFA 3IAQA 1Z32X 2O9TA 5GNYA 1J01A 4DUXA 2QPUA 2XVNA 1ZJAA 1QNSA 3VNZA 4RL3A 4IISA 1B31A 4HPGA 2PWGA 2WZHA 3EMZA 1VBRA 3AZSA 5BCAA 1CXKA 2DEPA 2D3LA 1QHZA 5M03A 1CXHA 1YQ2A 1UR0A 5CQ1A 3OGVA 3WL0A 4ATWA 7A3HA 3A23A 1GQJA 4HTYA 2WZEA 1EQCA 1K6AA 2J79A 3WDHA 3AMGA 2C0HA 1CYGA 2WMFA 2O9PA 3CHDA 3CC1A 4JFVA 1EH9A 4BA0A 3I3EA 3W4RA 5I77A 4AD2A 1MFUA 5HBFA 5HOSA 1J0ZA 1MQPA 2WLYA 2J62A 4OOZA 2VT0A 5C8BB 3LXAA 2Q8XA 3FAXA 1W1YA 3IGUA 3D3AA 1SR0A 1ECEA 3CV5A 3PZTA 3T2OA 5AC5A 2GJXA 4P7NA 2G8ZA 2G41A 1VFMA 4W88A 4PBGA 3UESA 3ARWA 5AY7A 3SCPA 2XVKA 1JAKA 3PZ9A 3S5ZA 4MB1A 4S3KA 2D3NA 1UR4A 2EBNA 4QFUA 4AZBA 2WWCA 1HJXA 1RD6A 3A3HA 1GPFA 2WVVA 1EO5A 3WDPP 3W53A 2BNJA 2UY5A 4MB5A 3ZJ8A 3ARSA 4Z2KA 1DWGM 1W1VA 4NZFA 2FH8A 3VDBA 4MTVA 1W1PA 2VZUA 1OBAA 2DH3A 4J3UA 3AIRA 1O7DC 2W62A 1R46A 3IJ8A 4E8DA 4FNRA 5JIWA 1KGUA 4YPJA 1E4LA 3T0BA 1BG4A 1FHDA 3N11A 3EJQA 1CDGA 1GVYA 3VGEA 5A3HA 5A2BA 1J0IA 1KQZA 1VRXA 4Q7NA 3PZMA 1OT2A 2IXVA 4AZCA 3VGFA 4V27A 3BSGA 3VMOA 2YDRA 3B9DA 4D72A 3WH7A 1E3ZA 4OZOA 1KR0A 3FNDA 2YIHA 2DSUA 2PF0A 4U5KA 3RJXA 1MFVA 3PBGA 1BG9A 5GNXA 1KTBA 1BPLB 1Q6EA 2J7HA 3AIUA 3ZOAA 4JKLA 3WH6A 3PZVA 5EFDA 1HJWA 1V02E 2XFFA 3AHXA 3OZOA 4Z2IA 2ZWYA 2J7BA 4AZCB 1VIWA 2DQXA 1CBGA 4ZE5A 1WAWA 5LA0A 3CZJA 1Q6DA 2ZX8A 3HMCA 2CBVA 3AHTA 4UOJA 3OBAA 3TV8A 1ZB5A 3IJ9A 4FNTA 1CGYA 4HZ6A 3LPPA 3WF0A 1ISXA 1UQZA 2X2HA 4WJXA 4PEEA 3NDZA 1E40A 3ZJKA 3GNOA 5A6SA 5EBAA 5AYIA 3MUZ1 4P8UA 3WBAA 5E9AA 3EDEA 5BXTA 3GXIA 1BYBA 1R86A 3LPOA 3L4XA 1H5VA 1EGZA 4WSJA 1OCQA 3M6DA 1JNEA 2CITA 4FK9A 1EIBA 3N15A 1KGWA 2XIIA 4MNMA 1UUQA 4PCTA 3F4VA 4QLLA 1TQTA 3FAWA 4CD7A 4URIA 4CUCA 2QMJA 2PWDA 2J77A 5A6KA 1P6WA 3VUPA 3VM7A 5DO8A 3K8MA 1UKSA 1G9HA 2QMKA 3AZRA 3L4YA 2XM2A 4YHGA 2WVTA 2OYLA 2VQTA 4J3WA 4V2XA 4TTGA 5DF0A 2F1BA 6A3HA 4PMDA 3WH8A 3PTMA 3EJSA 1C7SA 4FNSA 1PPIA 4GO9A 1UZ1A 2JALA 1HIZA 1AQMA 3GH4A 3MS8A 4EK7A 5IFTA 2X05A 2FE0A 2WPGA 2ZXQA 1JI1A 3ALFA 4GO8A 4PMNA 1DP0A 4GI8A 3UERA 1TCMA 3WDJA 4B9YA 4PMQA 4LYQA 5BXPA 1V6VA 3SUTA 1UD3A 1E0XA 2VQUA 3GDBA 3KWXA 2JEQA 4V28A 2GSJA 2D2OA 2OSXA 2YLAA 2AAAA 4JCMA 3LRKA 2OYMA 4S3JA 3VIOA 2ZWZA 3B9EA 4H2CA 2BFGA 1UR9A 4N42A 4MB4A 4LYPA 3WQVA 3VX1A 4B3LA 3EJUA 1LWJA 1HWWA 2FYVA 2XFYA 1J11A 4CD8A 2CKSA 2X2YA 1UQYA 1QW9A 1GQLA 2F1AA 4GINA 5HXMA 1E4IA 1W9DM 2PBGA 1HF6A 1LF1A 1LWHA 3MI6A 4AMXA 4DWSD 5JIPA 4J28A 2JIEA 4OBRA 1J9YA 5BWFA 2VUYA 2XN0A 3AS3A 3SCQA 2GJXB 4GPNA 4UQDA 4C7DA 2WZIA 1V3JA 4ATDA 1V6WA 1UWUA 1DWAM 2W92A 1MW3A 3KE0A 2WMGA 1B3ZA 3BVXA 1C93A 3BUDA 3EJPA 2XVPA 1E70M 4IUGA 2EPKX 3MUAA 1XH1A 1I1XA 4P7RA 5BROA 4X0NA 1V6YA 1SYTA 2XWEA 1BHGA 2YDQA 5CJ5A 1V0MA 4J3SA 5I78A 1UR2A 1HP4A 4UQBA 2ZUTA 3BUBA 2D23A 2WBKA 4L4PA 3AIWA 2WK2A 4JKMA 4UQEA 3QHMA 3KEHA 1ZBKA 5DMYA 2WC3A 4B9ZA 5ECUA 1V08A 1L0PA 3WH9A 2F7RA 4YHEA 2XIBA 3A6OA 2ZX6A 5HPCA 4WSKA 1PZ3A 2A3AA 4JFTA 5ABHA 4PMZA 4PYSA 3DECA 2PI6A 1V3KA 1C91A 1G01A 3AQUA 1KGXA 3RM4A 3AXHA 1KCKA 4JKKA 3U7BA 3BH4A 4WKFA 3D4ZA 3L4WA 2WLZA 3HG3A 2XSAA 2OYKA 3NSNA 4J3TA 1NWRA 1ITCA 1UWRA 2VX5A 4W8BA 1CGVA 2CETA 1ISZA 3S6TA 3SUVA 2V3EA 3T2PA 1A3HA 2WB5A 2WKLA 3AIVA 1HTYA 1RH9A 1E9LA 1U2YA 3EJRA 1BGGA 4NRRA 5A94A 2Z1KA 4FLOA 4U33A 3QHOA 3AXXA 1PX8A 3N1AA 4R27A 3OLDA 3AJ7A 3I3BA 5D9OA 1WZAA 1VAHA 3K8LA 4LYRA 3D4YA 1KWGA 1QX1A 4KGJA 4J27A 2DIEA 3EMQA 4HMCA 2YDSA 3KZSA 2BHZA 1W9UA 1WDQA 3QHNA 1XD0A 2O9RA 2EQDA 3AYRA 4H04A 2QLYA 5IHRA 2J47A 4W7VA 3UETA 3N13A 1W1TA 2E3ZA 1OIMA 2V3GA 3WEOA 1EXPA 3CH9A 1V0LA 2A3BA 4HA4A 1Q4NX 4QAWA 2BY3A 1EDGA 1W9VA 2F61A 1FH8A 4DM2A 1J0HA 3WNNA 1VB9A 2D24A 1JNDA 1GQKA 4JFWA 3CUGA 4HOXA 1HKMA 4D6GA 1VFFA 3WL1A 4XB3A 1XSKA 3RCNA 3N9KA 2YBUA 1JDDA 1SZNA 5CPQA 2DSWA 1B3WA 3EBVA 4PMXA 2B31A 1UD6A 2IXUA 3BMWA 1TE1A 5HNNA 3CUIA 4W89A 4OJYA 2WANA 3L4TA 1QW8A 1WKYA 3S5YA 4AISA 5FKYA 5LA1A 2EAEA 1MYRA 2CBUA 2YJQA 4HA3A 2XGBA 2E4TA 3NCOA 1UHVA 3PZUA 2VRQA 1LQ0A 2G3MA 3AI0A 4AWEA 1KBBA 4Z2LA 3OZPA 4AEFA 3SURA 3DDGA 3LX9A 3ARUA 4PTWA 3AIQA 3BVTA 4J3VA 4B15A 2BVYA 4HZ8A 3VTRA 4TVCA 2WNWA 4BF7A 2VVNA 1H3GA 4AZIA 3AOFA 4OKDA 1JXJA 3TP4A 2X8RA
chains in the Genus database with same CATH superfamily
1PD1A 4QHNB 2O1AA 4HSHA 12E8H 1CBJA 3GMOB 3U79A 2CHRA 4XO6A 1ED3A 3MLRH 3MV9D 1JIBA 4N6RA 1ANUA 4P4KC 5JR1H 1NEPA 3ESVF 4UBDC 3CZSA 5A40E 4UTBA 4GUQA 1VZGA 5CZJA 4M0XA 5GGQH 3RVUD 2FJGA 2H6RA 2IH8A 1VEPA 1IKOP 4YSTA 1NH6A 5TGBB 1AC6A 3SHSA 5BVJB 1ITUA 5GS0C 1Q5MA 1RK0A 3V4PL 3HPXA 2R1WB 1IIIA 5HI4D 4ZODA 2WB1A 3BAXA 2VFIA 3RX4A 3GMRB 2WXHA 1NCWL 3B1UA 5FK9A 1I2QA 3FU3A 2R9RA 4YDMA 2OMTA 4BQ3A 4CQDA 2QF7A 1SY6A 2VZOA 1RJZB 2C9SA 3VYOA 1J48A 3V4UH 1OTUC 1XIDA 3SN1A 1A1NA 4JQXC 1X5YA 2H47C 1YMYA 4FAAB 4UTHA 2F6AA 2UWEB 4K4KA 1T0NB 1KJMA 4H2AA 3RUGF 3V9CA 1W1A1 3NO3A 1CDCA 3MACL 3Q6FB 1KPVB 1XHGA 3CAVA 1R7AA 1A5FL 3C6LA 5F7DB 1IBHA 3RTQA 4Z8FL 1I85A 4DGVH 3Q6FA 4GSQA 4Q9CA 5JA9A 5JTWA 1R1CA 1H7XA 2CZDA 4GKTA 3VZYA 2W0UA 4XPAL 1KB3A 1MDLA 4FQIL 2V6HA 4Y0GA 1CX9A 3DIVA 1AZVA 3ITCA 4UQ3B 2YSSB 3G3MA 1U4FA 3KPOA 4PJAE 5T1DH 1P7QA 3GBLA 3HRZA 5HJDA 1QNRA 3UCQA 4UNLA 3OGOE 1QVBA 4FS0A 5A2LH 5FPIA 4O4YL 3SCTA 1UA3A 3LCYA 4HS8L 4KVCL 1RPKA 2WUBH 1KEGH 1IT7A 1JBJA 4PCPA 3F7RA 3E0FA 4B2DA 5ID0B 4CNSA 3R4DA 3ME0B 2XM1A 1MVUA 2DL9A 3GLAA 1XL6A 5CINH 1EX0A 1CLOH 2ZIDA 4Y2OA 5CZXC 5I6MA 2FIQA 3BO9A 3MO4A 3ATFA 4IXHA 2APVA 3IDNA 2WM1A 2H32B 2P5WA 3VI2A 3F85A 1FFNA 1IAOA 2WIIB 4HBCL 1Q72H 4I0KA 5E8DL 3QP3A 4R7NA 4C6FA 1TEGA 2P5WB 2W6RA 4LSQH 4LVGA 3SB0A 1RIHH 1GSKA 2CLZA 1GTHA 2J4GA 3WY3A 2PDNA 2R0LL 2UXTA 1QWHA 3N85L 3UAJC 4OZHE 5HYSG 3QPEA 5A8PA 3V5FA 1KYUA 3FXIC 3TA4D 3TTYA 3Q8EA 1ZHNA 4BK4A 1KYDA 2VAAA 3SCOA 4EBQH 1QMLA 3L81A 3EPNA 1QO3A 1SEQH 4I9TA 3H2NA 1NC2D 1OGTB 4AVOA 2HRHA 4A3YA 5CPOA 3FA3A 1PX3A 3KCPA 2DKMA 4P07A 4CU7A 1BVOA 3VXOA 3HOGA 4JRXD 2AQOA 4TPRL 3GG8A 4AG0A 4GFXA 1BWMA 5KOVC 3GRWL 2MHAB 2Z7UA 5U7SA 2YPKB 1K8ZA 4DO4A 1RSYA 5E2VL 5A2AA 5C2GA 1OJXA 2PLKA 2ZG1A 1VCVA 3WN6A 1WS7A 1S2AA 5HDOA 3PANA 3BKMH 5J4MA 1I8UA 3EYSL 1PBGA 5DDHA 2HRWA 3CJPA 1RY0A 4XNAA 4LUIA 4NNCA 1JUBA 3B8WA 4U6XB 1LEIA 2H9GB 5BOOA 4G1MA 1LO2L 1SQ7A 4UF7C 2IBGA 3WJZA 2QEJA 3GZAA 5K33A 3PTKA 5EMUA 1H11A 3V7AG 3CFKA 2XJLA 3LSOB 5GRVL 3I10A 2YLKA 4RISH 2NQZA 2H9AB 2DBLH 4KH9A 2F15A 1HGWA 4L4VB 1JR1A 4CSPA 3N2BA 1NMBL 1S8DA 4X4KA 3PP4H 2SEBA 2CQVA 4I2XB 1NGXB 1QOKA 5I9QB 5BZXA 3AUJA 4Z0XB 3I02A 2X2UA 3DRQB 4A7QA 4D94A 5J13B 5JMOC 1W9BM 4BH7B 3VDHA 3FDWA 3D5HA 4CNPA 4M51A 2IPUK 4FTVB 4DZBA 3EX3A 4BWWA 3KRBA 1E73M 2FZBA 3ARDB 2VR9A 2QQKH 5IK3A 5E24E 2A99A 4IM4A 4A39A 1E27B 2FT7A 1LYQA 2O5NA 2P5PA 4KJYB 1H3WM 1N8ZB 4QHUB 4U6HB 3EYQC 5KVFL 2XVLA 1NFKA 2GJ6E 2PC8A 1XF5A 1EERB 2R2BB 2XWJB 4X7SH 5D2VA 4LSRL 3F58H 4MA1C 1XDLA 2FHFA 2HE5A 2DFAA 2NUXA 3MUXA 3DOIA 2WLLB 1LD9B 4J6RL 3EO1B 2EDBA 4KVPA 3T71A 4DIXA 5JW3H 1A0QH 1KKOA 4P9MH 1TENA 4JTCA 3V0VA 1N18A 4IOIB 4PJ8C 5IV2A 4HKJB 3V9FA 2X0HA 3BUTA 2XH2A 1NLBH 4R84A 3AREB 1BXVA 4JNZA 1W91A 2M1KA 3US1A 1KULA 4L9XA 3IE4A 1NY1A 2R2HA 1YDPA 5AHEA 4NKOA 4UTCA 5KS9E 2ADGA 2WBJA 2HRPL 3STFA 2RGSA 5D4QA 3UP8A 3D0LA 1MCJA 3R8BB 5DQPA 1KFGA 2XKNB 4OUEA 2QJJA 4ZX3A 4Y90A 3WHE0 1MJ8H 3ZKND 5J1AB 2AXGB 3JTTB 4RW5A 4FABH 2WLKA 5F2FA 1FL5A 3QO0A 3RZWA 3DX7A 4ENED 5AQ0A 4YXHL 5I19L 5CZ0A 4OFIA 1SEBB 3ZL4H 2F6KA 4C1NA 6FABL 3VGAC 5IVXF 3T0ED 1WBXA 4PMVA 3RPMA 2IOIA 3CUXA 3K7UA 5LIUX 3TYGH 4K7PY 4WI7A 5DWUH 1A7BA 1QHOA 3OKOB 3DBXA 3TNMB 5FYLL 3AAZB 4JGMA 3VAVA 2B2XL 3LEVL 1U42A 2I9LA 2PE4A 4YDNA 1SJAA 1BKSA 1V8HA 1FE8L 3WLBB 3FYEB 3EHBC 4UQCA 4QRPA 4DVBA 2NY3B 4NUMA 3SE9H 2OLSA 3WD1A 2X4QB 4QITA 3FUDA 2OJZL 1RZIB 3MOBL 1H7RA 1RCOB 1UUMA 1MJ7L 1GOGA 3BZ4A 3TIEA 5C0EA 2AEIT 2WLIA 1KTRL 3EDDA 2YFOA 4LHUA 3S37L 2C14A 4GQ0A 4XMVA 4KJWD 2DQFB 3QEHB 3FKRA 3QDJB 1GGIH 1U8JA 1KCVH 1XLAA 2OCZA 3L7RA 3WQ8A 4M5TA 4IM8A 2G30A 3TYFB 2IH1B 4LUSB 4X7DC 1QTSA 3BH9A 2MPVA 3HI1B 4LEOA 4M9PA 1HO4A 1I9JH 4IHOA 4Q6XA 4MA8L 4RZKA 2VWEC 1N7MH 4S1QL 1M9SA 3D8MA 1JK9B 1X5AA 4XC1H 2EP6A 3O3AB 3MLXL 5IGXL 1J5OL 3TYDA 3OKMA 3ARFC 2YL5A 4Y9MA 2ZZ3A 4CCEA 1QWKA 3DHJA 4M62H 4UTBH 1G01A 2PP8A 1TFVA 3BDYL 2APXA 1MFMA 4OFPA 4P2RE 4R4ND 1ZCOA 3H2OA 3ATDA 2C3VB 4CVWA 4DETA 3LKPA 2J6XA 4DJEC 5DS8B 3CH1A 2C4XA 5AAMC 5I3KA 5DK0B 5DJDA 4WFHE 4DM1A 1FP8A 4P2VA 2VM4A 2YA0A 3KS0J 2XZAH 1IGWA 5AVVB 2VJ0A 3WTTA 3ZL1A 2NY5H 5K5YA 1H62A 9XIMA 3VD3A 5AL0A 2RA1A 4Y5VA 3A4WA 1ZHKB 1PE1A 4ZCWA 4ZMGA 2A6JB 3L65A 4O4VA 1HNGA 2V2TA 3HFYA 1RPUA 4NKQB 3OXSB 3GH7A 4NLAA 1JNHA 1G6RH 2F5BL 2ZP9A 4GS7C 3ZSTA 4O54A 4RW3A 4KROD 3RVWC 3DARA 4J1UA 2EH7L 3HZMA 3MNMA 3VGDA 2PMQA 1JZDC 1KZYA 1SF5A 3IDYC 3Q5TA 1QEWA 4FC3E 1I3GH 5DUPH 4QNPF 5E7BA 1BIIA 3SGKA 3VQLA 2C1IA 4O2FA 5HMEA 3K2IA 4I0PA 5T3XH 1X6LA 1T7WA 4I18B 1G9MH 4N2FA 1UA7A 1TYRA 4DGYH 5BVPH 3IFPB 5IHZA 1DJNA 4G7FA 2CCWA 1TTIA 3W70A 3VGHA 5C08D 5KN5A 1EHAA 2OR2A 1XZ0B 3H6AA 4HS6B 4LDEB 1VFTA 1IAIL 4N0RA 1UM6L 3ES8A 3URQA 2UXFA 3GB7B 4DGUA 3ARRA 2PF8A 2VLKA 1R5VB 2YL8A 3VD2A 4UNKA 1XAKA 4NZ4A 4JZOB 2XN9B 4JANA 3EWXA 1AODA 4UB0H 3STZB 4NILA 1E43A 1CB4A 3HG4A 1J1PL 5GRVK 2HWZL 5IBXC 3NFUA 1R3VA 2Z8VC 2Q86B 3OIXA 1MXGA 3VFVA 3PCYA 3W2DL 1GPOH 1DUYB 1WIOA 2ZWLT 4PRBB 4BHUA 3GTIA 3DVFA 5DQDH 1CI3M 5FJTA 3TFKD 1FH7A 4FKKA 2X4UB 4KFZC 4DEPB 4B91A 1KCRL 3NL6A 2BMKB 3EKGA 1UD4A 1IEBA 2GJ6B 3O6FD 3V55A 3M0YA 1ZDQA 3S6DA 1D6VH 1M2OA 2NW2A 4LVHC 2D4DA 1H7PA 1W2PA 2V33A 3NQAA 4X83A 1MI5D 2Z0IA 2A9NH 5AZEH 2P1FA 5TK4A 4LWWA 5IM51 3MXVH 4QXGH 3HI1A 3ANUA 4DBUA 5J9PB 1F2QA 2Y7LA 1E5CA 4P59H 5D03A 4EOUA 2WZ6A 3QUMA 1LDPH 5J6SA 3VTMA 5C3IA 2GJZB 4Y9GA 2PDMA 5EMLA 3W7RA 4WKHA 1ZGLA 3IFOB 4UNTA 1CTNA 3N2XA 3TFXA 2ACUA 3FYYA 2F2KA 4KUZH 5L9DH 2H41A 1JFXA 3QI9C 2FYYB 4OB5H 3IXAA 4QTHA 4U7SA 4AYFA 1R19A 5LO7A 1CD1A 4P5TA 3CV1A 1YUKB 1HESA 3STBA 2J7EA 8FABB 1J96A 4UM8B 1AGEB 2E6FA 4RMBA 3QM3A 3PHOB 4JFHE 4HPHA 3GR7A 2H2SD 1SW0A 2DYRB 4FQQB 4OLXH 2J43A 3EGXB 4ZX6A 3RWEA 1ZA6A 2ZE3A 2WSKA 4KKAD 4BZ2A 3BKJL 5I0WA 5I16B 2F7PA 1RSCA 5I8CB 3LSCA 1TJGH 3SPGA 4BFFA 2CSPA 1IEQA 2XWTB 1IGCH 1ZLEA 1AQDA 1SJHA 1S5IH 2XWZA 3A6BH 3VB8A 5I16A 1XLGA 3CZ8A 5CZRA 3SGDH 4G8GA 3UZEC 2G0LA 1TPDA 3APTA 3CXOA 3VXGA 3PGCB 3TO4B 1YMMA 3MHGA 4X0VA 5IFPA 1BJ8A 3PAYA 5GGRB 3GYCA 2D73A 2YA1A 4M6AA 3PGCA 3TO4A 1XCFA 4O58H 4WWOA 3B8SA 2FZ8A 3GEWB 5D1ZI 3DX3A 1CGSL 2V7NA 1OTSC 4QXWA 4BFEA 2H9GA 4PH8A 1BZ9A 4GIOA 5I26A 3BZEA 1P0EA 3WFAA 3NFPB 5GJMA 3ILDA 1HOCA 4HMEA 4XBEL 4DJMA 5E8OA 1OWWA 3KWVA 2B1OA 5ESVA 3SY1A 3T4AB 3CWGA 3DBSA 3PAUA 2P5WE 1ZSDA 2X4SB 1WPCA 3QI9A 3KP1A 5KANG 4A6YH 2EXWC 4DQOL 2O92A 3NJNA 2OODA 5TQLA 4KZDH 2J7FA 4DP7X 2BNQD 4HULB 4NM8H 2EG8A 1W2VA 4GK8A 3ZDXE 3VOCA 4O17A 1ZLSL 5IFAH 1NOAA 4ZMXA 1I2RA 1NP2A 3GK8L 5DK0A 3WG6A 2HFGL 4C6QA 4G6FB 1ZGDA 4QNWA 3DMMB 3QA3A 4PV9B 4ONFH 3IIPA 2Z26A 4LP5A 5CF3A 2GJ6A 1JPIA 1SJMA 1HIMH 4J8RB 4DTGH 1NQKA 3DKJA 3DOHA 3S1GA 4MBOA 3ZYOA 3I9GH 3OQ8A 3VD4A 3DLQR 1Q8MA 5D7JD 2Q02A 1O6VA 3UT0A 2V5JA 1XGZA 2DLGA 2H8PA 3Q9PA 3NEXA 4WFEE 3VSVA 4ZTPH 3LERA 1LILA 2P48B 3PUOA 2DDXA 1CS6A 1MDTA 2AEPL 1KBGL 1ONQB 3OAYH 1W5QA 1PKLA 2NSQA 1E4JA 5IVZB 1RPXA 4P9HC 4NCC2 1VYRA 3BZ5A 2J5WA 3NXLA 2TRHA 3TYZA 4F4RA 1JNLL 4KK5C 2VLJE 3TVMD 3O41B 3AJXA 3FZUD 3PBYA 3B7RL 3IDMB 1OOAA 1ZP3A 3N6YA 1NCBL 1E0WA 4GQGA 3CBKB 3P77A 4E9WA 3NXFA 3PV7A 4GYPA 2UXGA 4K37A 3P9MA 3V4PH 1W9XA 3S3DB 3ULUH 5C0AA 1N4XL 5TF1L 2FBOJ 5J57B 3QIUC 2NX9A 2XGIA 3KL0A 1VPYA 1CD0A 3BLEA 1KC5L 1BD2A 4KH2A 2K7PA 2QZQA 4JZOA 1QPQA 4I5RA 4PJIF 4MA7H 4TX6A 4YTUA 4FK9A 1MF2H 3V4PA 3R06A 3NJLA 5I7GA 5C0RH 4JIQA 3LV5A 4BKTC 1XB8A 2C7FA 2KYIA 1DHPA 2NZLA 1OGTA 3VNIA 1NA8A 4XNUH 3CSFA 5DR5L 4C4KO 4YJZL 2GPZA 2XWBA 1I7UA 3GM8A 2Q6WB 2B77A 2PR4H 1S2EA 4F15C 2BWIA 2B7OA 3S8HA 3M86A 4IIBA 2RFXB 3TOPA 3HS9A 4IBZA 4MRCA 3C2EA 3RGVA 5DD6A 4DJDA 4E4PA 5A6JA 1MJJA 3DVNB 5IUCA 3Q65A 3U5YA 4O52A 3WLJA 1T4KA 2GTWA 5DJDB 4HX1B 5DMKA 2HS6A 1M53A 4JY9A 4YVNA 1EZLA 1TTRA 2J55A 3EJZC 3KVQA 4FKEA 4PJHA 3FLUA 4ZUWB 4JREC 3IDJA 3RWCB 2LQRA 2IPFA 3BQUA 3GJFA 3E9TA 1P1ZA 5ABDE 2V2TB 4DK5A 4MTMA 2R23B 2XV3A 1JPEA 4HKJA 4M4RB 2UWFA 3BEWA 1PIFA 5EU6D 3IT8D 4ZAKD 4F8PA 4OI8A 4IQDA 2CHDA 1FGNL 4H19A 1B2WH 1WKDA 1A6PA 3DROB 2EC9T 2WC7A 3OTRA 4WWKD 2QVHA 4REQA 1N3NA 5DZ9A 1YEHH 3DFQA 4F33A 4JM4L 1UWGH 4S2SA 4PS3A 1KCVL 1IC5H 3HN3A 4UMBA 5B22A 1XWYA 1NMAH 4CC0A 3C0SA 4DP1X 4R3UA 5C2BH 1JTPA 4G70B 5T5FH 5I1DB 4R6UA 5I5MA 2Y7GA 4CCDA 3FT4A 4ERSL 3GUTA 2BZCA 4JFYB 3TEYA 2CXGA 1QSEB 2W5PA 3NIDE 3TXAA 2CA3A 1INQB 3D39E 5ESQA 1U8KB 2YR3A 4ZW8A 3G22A 5D7LB 3TLRA 3U4AA 2V9QA 4LPXA 2IADB 2Z93B 4DEFA 2A77H 3DSNB 3PWLA 1NWTA 3U3HA 1CFVH 1UWEH 3MMDA 5D7JB 5E2VH 3WLMA 3P3TA 3L3GA 4WJ5B 4JZNA 1UACH 4QXUL 1KYAA 3LTPA 1GS7A 3B03A 4H9UA 3LPGA 1DJWA 3LZ3A 1S3TC 4JG5A 4O11A 1POJA 5HVWA 4XN9A 1CIDA 3F4WA 2W65B 4C6JA 2V5KA 3G5VB 4HGWB 3IVKA 1F6LL 1EDTA 5REQA 1R4XA 4PWEA 1G7JA 1KTKE 5C08E 2BRQA 4U2ZA 3GIZH 3KPNA 2WSRA 5EWIH 3TXZA 1M1SA 1Q6OA 1N6QL 2HTMA 8CGTA 4M3HA 3ONBA 4QG6A 4MVBC 1KBIA 4AH2A 3H2WA 1U2CA 3HPJA 5GS1B 4KT2A 2E9IA 1NMCB 4IQJA 3KOXA 1QP1A 4DYJA 4X9YA 5FYJL 1VA9A 2AQ2A 3KCPB 4GRWH 3U1SL 3LD8C 2NCEA 1R8LA 1RK5A 4ZR8A 4IK6A 4GGBA 1VCGA 4QM1A 1EANA 2LFGA 3L3DB 1VBUA 3UJ2A 4YR6B 1QBML 4Q4MA 4OSUH 2ITFA 4UMSA 2J5LB 5BS0A 5I17A 1JUEA 3WMSA 2A1WH 5H8MA 4O0QA 2XG4A 2I5GA 2WQVA 5AVZB 3S4SB 2F9RA 3W7GA 5CN2A 4FALA 3LRSB 4B97A 4F9JA 4GQZA 2F7QA 3V5HB 4N8PA 5IT2H 4PGZA 3RVXC 4C47A 1W1ZA 2MOQA 3HFMH 1ZP4A 2VGIA 4WFHD 3BGAA 4Y89A 3SKNB 1FFOA 3P82A 1MUJA 3UZWA 3LQMA 3BPOB 1V0KA 4WDWA 4UNIA 1JPHA 1JGUL 4BXVA 2D7PA 1MVFA 3CS2A 4WY0B 3R1ZA 1UIOA 3LV6A 5EULV 4AYEC 3V7PA 3NH7H 4G6KL 4UNVA 4E9SA 3SCMD 2PDJA 3BPNB 1GYNA 2CO1A 2Q3ZA 2FECI 2Y7FA 2B4CL 4BFGA 3H12A 3N18A 3PUCA 3CN3A 5HGHA 2HRPH 3OKEA 3SPVB 1A6ZA 3SKOA 2JJTA 3UAJD 4JGNA 1F4XL 2VISA 5BJTB 2PP3A 4H8PA 1ZAHA 1OCWL 5I6XB 3LKOB 4D6CA 1DORA 1JMZA 1AHKA 4JN8A 3OF6D 3PWPE 4TUFA 1DV7A 5I3IA 2R4RL 4N3UA 1CLZH 1DQUA 1RURH 4OHQA 1PXGA 1HE7A 2A9NL 4N8VB 5FM5O 5CLXA 5AZEL 1XL9A 4Y9CA 2ZZUT 1R3JB 2CBTA 3A4EA 1M3UA 4ZQRA 3DFYA 4WFED 3VFUA 3I4KA 1KC7A 2KL6A 2EG7A 1S7VA 4P46C 3GS6A 3SOBH 3QUYC 4KIRA 1L6ZA 4JX6A 4JBSA 1DIEA 3P0VL 5EU5B 2YLHA 4YHKH 4O2EB 4PLNC 1NP0A 3MNVA 1O4UA 3CM4A 1CFSA 5C09B 5L9DL 4GIRA 5HNTA 1C9DA 2VLRB 4G9FB 4ALAC 3G8RA 2K6WA 1ZALA 4H8WH 1RZGA 2VDNB 3LBCA 1E9IA 1T5WA 4WEBL 3AHVA 3LNFA 3MODH 3JZ7A 3GXMA 4B9CA 2D2JA 1LO5A 1IM3B 4GIAA 1XBXA 3MTRA 4M4RA 3AXMA 1J18A 5E70A 4TNVK 4RKAA 3CDYA 4UBPC 4EP8C 2XIMA 2G3NA 4MAVA 4X5RA 3QXWA 2Y1YA 2FJSA 2J3SA 4N2MA 2FGWH 1XC4A 4IDJL 5I1LB 4BFAA 4MS8C 3RVTC 1OYBA 4HT1L 4L4TA 5C1MB 1S1RA 1X1OA 3MP5A 4ILSA 4HUUB 3S3SA 3RG1C 2O5YH 1CDIA 2FD6H 3QVAA 3QYSA 1T2XA 2GBVA 4Y2OB 3K2KA 5EOCH 1XCXA 1B0IA 3ZHKA 4ELKA 1SDAB 3ARFA 3OGCB 4MNGE 1RK7A 3LH2H 2W9EH 2YS4A 3NJJA 4P3DB 1I7UB 5D6DA 4OGXH 4EZMA 4LL9A 3BZJA 5JHDD 2OX5B 3HC3H 3MJMA 1H3PH 1PY4A 4Y9AA 3S2JA 3QHZH 4E42A 4JTGA 1C5DA 4Y9EA 1V4YA 3UTSA 3B7TA 2P10A 3IACA 1OAZH 4NC0B 2YKKA 3IJ7A 3VCLB 2FQGA 4O8RA 3ETTA 3WF3A 3TFCA 1SN2A 1LRTA 1N8OE 1X7TA 2DZEA 2OI9C 4WI3A 4IU3A 5KITA 3RIKA 3T1WA 2YL9A 1AVAA 2QCEA 4RX0A 4BCEA 4BWUA 3WJYA 2D3VA 1JZ5A 3VXSE 1O5KA 1V77A 3WIHL 5LAPA 3D7PA 3GGWA 4ZMZA 2Y7EA 3RFZC 2QPEB 3O0KA 4LS0A 3VXRD 4JNYA 1UMLA 4TNWK 4UFJA 1IGML 3BUVA 3OVPA 5SX4H 1NTDA 4AT6A 4HETA 3FOKA 4JL1A 3E6EA 1NFDB 4L1LA 4O1CA 3U8GA 3OM3B 3MKVA 1V7NH 5I6PA 4FFYA 1I53A 3KEDA 5AB1A 2QFRA 4LCUB 1C9WA 4IRJC 2WCGA 4LPYA 4OY9A 4ML4A 1L5GB 4OVXA 4AD3A 5T5NF 2A9AA 3SPVA 5HGHB 1X7FA 4TR9A 2DD8L 4BF9A 5KYWB 5BMFL 3QDJA 1AD0B 4FFTA 4PMRA 2XZQL 3AWGA 3HS0C 1DWFM 1LBLA 1EZVX 4A2FA 4P8WA 2K7QA 2YEZB 4ODHL 1YEDA 2D20A 3TQKA 2MUCA 3SGDI 5IJDC 2FTWA 3FVDA 4BY3A 5AG9A 4P06A 3WE6B 2WQAA 4ABVA 1ISYA 3HG5A 5J11C 1J8HA 4KJPC 1WWAX 5AOJA 4IIQC 5FGRA 4YVPA 3FH5A 3AT9A 3C2YA 4XBKA 1OZQA 5CJOH 4DZ8B 1R0AH 3BURA 4RE3A 4HVBA 3S4SA 2H3NB 4QO1A 2F84A 2A3EA 4GQQA 3AYSA 4PJHF 4P2OD 3P62A 5XINA 4G7YL 3DTUB 2VB5A 5I73B 2W88A 1AO7A 2AI0L 1JWSA 1TZZA 1W9PA 2BS71 4CVZB 3L66A 3C5ZC 3C8HA 1EJFA 6XIMA 1YTDA 1CICA 3FCGA 1XPGA 1MF2L 5FGBA 5DA0B 5AAPA 5T9BG 5AC4A 5EEWA 1FDYA 1W5NA 3PUGA 3AFLA 1OFBA 3DHUA 1UXMA 1SBBA 3QOMA 1M7DA 1ND0B 1QHQA 3N40P 5F97E 4MMXB 1XHHA 2G3FA 2CXKA 3NZHL 5FLUA 1UG9A 2FMNA 1TQCC 5HI5C 4AGOA 3E6HB 1RUKL 4P59L 2E27L 4UFMA 2R9HD 2BY0A 1EXUB 3QXDA 5IEHA 3TA9A 3U57A 4PP2B 1IM9D 4QDWA 2BXYA 4ZQTA 2ZUQC 3BMVA 2Z24A 3O07A 4MKTA 3N29A 3W9ZA 3SD5A 3TDFA 4HVXA 5FDYA 3OZYA 3KR3H 4XKYA 3W28A 4HNUA 3NG5A 2PDGA 3B8IA 5FA4B 1A0DA 3ILPA 4RIRA 3C56A 1U91B 3CFDA 3FFCA 3W3BA 3F5JA 2LV4A 3WK1A 1GOFA 3CVIH 4Q8QA 1HCFX 5BRPA 1NFGA 3B0PA 3GQYA 4MCYB 3ZDYE 5IHUL 1A5KC 3L21A 3GT6A 1LP9E 3FO0L 3FL7A 4PYHA 4I9WD 1J1XL 1CECA 3CDZB 1XIGA 1WBYB 3BCFA 4IZGA 4ZUSB 3YPIA 3CPLB 4RQQA 5JORB 4QTHB 3CVHB 1FRBA 1UBPC 2X1TA 4DELA 3GXPA 4ZXLA 4JBRA 5HATA 1FWXA 4OCXL 2PP1A 1C8VA 4Z1BA 4WXZA 4XWGL 3DHMA 3N2JA 4JPKL 4PJ9B 2XLLA 1N2RA 5GHWH 3S37H 1FO0A 2H0EA 3QUMB 1TIWA 4C83A 1E6JH 2GAZA 3LIUA 4GY4A 1IVTA 1Q66A 2DQEL 3MUUA 1KXTA 3SKOB 2N01B 3X12A 5L8LB 2BIHA 3OVGA 5GS2D 1FXPA 2P7TB 5JBFA 4BK9A 2NX5E 2V3FA 1A2YA 1E5YA 2BVPB 3G6JF 3B9KC 2Z91A 3CTTA 1R3HA 3N91A 3PPSA 4JPQA 3SDAB 2PTZA 4M81A 5FO7A 3D69A 4JFDE 4Z9KB 1FF5A 1K5NA 1XT5A 2J73A 3LV3A 2DQDL 4R7DB 3UZJA 1DQTA 3UTTA 4AMWA 3GVGA 4NL1A 2QT3A 1A6WL 1N0LB 3DJ9A 4XCYB 4YSCA 3QUMH 3HM7A 4TTDC 3E9UA 4RESB 4MAZA 1VLXA 3AYTA 4TYUA 4XPBH 1ZLSH 3VCLA 3H4XA 1SU5A 4OBTA 3INUL 4X5QA 1EBAA 1NJ9B 1XTLA 4TSCH 5CP7A 1FVDA 4AQ8C 2J13A 2XZ9A 1PQZB 1E0UA 4E2OA 1W1IE 2VLKB 1G0CA 1EEYA 1UJTA 3EZ8A 4JVPA 3VXQB 3DMMC 3N41B 4CU6A 5KJ7E 4I1RA 4EN3D 2JFCA 3N43F 3CK0H 4JM2F 4D9LL 1I3VA 4GLRH 3QEQD 4YQXL 2TYSA 4GIYA 4JTDA 3ZFHA 4JY8A 4OU1A 4PBVC 5DBUA 1DLHA 1KB5A 3FOMA 3LKRA 2P9RA 3S36L 5A8GA 5F2LA 4NIKB 3SCSA 1JD9A 1WFUA 4GI6A 4Y1TA 4N0YH 4F7EA 1UUNA 2GDUA 4M19A 3P3RA 4K1GA 1BZOA 3ALXA 3B7YA 3NSJA 4F7PA 3PFMA 5T26A 2PTVA 3CEUA 5KINA 2Y22A 1XIMA 1FWAC 3NAAH 5INDA 2VEIA 4KRPC 2YCKX 1KN4H 4K94C 4WDIB 1O9WA 1ULVA 5CCJA 2ACSA 4ANUA 2QPXA 2H6PA 3W2JA 4FYQA 5KSAD 3MV8E 5CIPH 3L23A 1GGUA 1F8TH 3P9MB 5DJ8B 4WO0A 3KOFA 2F38A 3L13A 3V4VH 1LO5B 3P61A 3W57A 5GGRY 5LXVA 4AK1A 5E08H 5I1CH 3NOEA 1R3LB 2X0YA 5DJ0A 1U41A 2I07A 1CMOA 2QIWA 5I2UA 5SWSB 5E1HB 1FSKC 1PVHA 4V1DE 2V17H 4K3GA 2D4FA 4UI2A 3W7QA 2W66A 3EO9H 2GUOA 4IBSA 3V4PB 1SJBA 1QI0A 1VLWA 4ORZC 4M29A 2UY2A 5I1JL 1QW7A 4NB7A 4EO5A 5DC0A 3V0HA 2ZUWA 4FQCL 2IBZX 2QDEA 1K4CA 4EZLA 5C70A 5KEZA 1QR4A 4W93A 1G7LA 1TJIL 1CE6B 3NUKA 4KKRA 3QC5X 1O1ZA 1O7AA 1VFSA 2AABH 3GUTB 2V63A 2PKDA 3KLQA 1PWMA 2FKPA 3HGJA 3FB8A 3WUGA 3NIGB 3NVQA 1HH6B 4XNUL 2G75A 5D1QB 5DR5H 2ICSA 3WLSA 4L4VD 3LHAA 3W7EA 5DQDL 5DVKA 1RSFA 4Z18A 5CKAA 1T1WB 3DX0A 3AXLA 3TAOA 4UR9A 1SXNA 2JV6A 4G6JL 3UYRL 1EO7A 4DP2X 1DEDA 1YLVA 4XN2A 3H2CA 3TSMA 4LNCA 1IWBA 4LLYB 4Q6JA 1F61A 1E3FA 1GSMA 1ACYL 3EFFB 4CQ9A 1LQSR 1BQHG 3BFOA 1QABA 3BH9B 3GYRA 4QRQB 3GRGA 5DQJB 1LDCA 3KDNA 5F71A 2XFRA 3CB3A 3SSJA 3QMSA 2G95A 2QW5A 3MU7A 3NQMA 5GSVB 2VDLL 1ORQA 2JF6A 2BSSB 2E7DA 3T1FB 1TF4A 5DZOA 2DQFA 4B7IA 3G6DH 1UOKA 3W85A 3I9IA 1UUOA 2YPLA 1RLBA 3BE1H 3MGOB 3SDDA 4GC3A 1K72A 3IS0X 1U92B 1PIGA 3KAAA 4KPHH 3I74A 3QDGB 3MY9A 2J6EL 3R8QA 1IXOA 1MRDH 3NSDA 5E5MA 1QFEA 5DO2C 1TSIA 4RZ6A 1HSAB 1Q9WB 1TZGH 1MCFA 1X7QB 4R7OA 3AAZA 2FVLA 4DKDC 3CNKA 2X4OA 5MENA 5IBUB 4R7LA 3H2EA 4RFEB 1L6PA 1EO8L 1SJEB 2QUUA 3KVLA 4X5LA 3L3DA 5A6TC 1Q0XL 3GTVA 3UCRA 4APQD 1QFPA 3CO8A 2FGWL 5CLTA 3MFFA 4J2QA 5DHVA 5LIWX 1GAFH 2WMIB 2R1PA 3MV8A 2CZNA 3MFFB 2OR9H 2J78A 3R06B 1JRBA 2OLAA 1NDTA 3MCLH 5HHXH 4BZ1H 3V9EA 5GJSH 3ASWA 1UH4A 2ATPA 1GKRA 2ZOKA 3GHPA 3TR2A 1PEZA 3VXTA 2BMBA 1ES0A 2YZ5A 2M26A 1TNNA 4E8GA 2XRAL 3CBWA 1FWDC 4OFKA 1UG6A 4W7UA 1KJVA 5CAYB 4P23B 4I90A 1T3FB 4PMOA 1NCHA 1T1XB 4LIQL 2GQ3A 4QJ3B 2UWEF 1XYCA 4FX6M 3P14A 1OAZL 1E4NA 5FWRA 3A24A 4WWKB 2JE8A 2UZIH 5JHDE 3CFJA 4IOIA 1SUJA 4PIRF 5FGSA 5LKNA 2E6AA 1QI5A 1PKYA 2BSSA 2BC4A 1CLOL 3BAKA 1DQJA 4LCCA 4K68A 3ZKXC 5A69A 4L8DA 4QRTA 4PMJA 4CMMB 1Q7MA 5C3LD 3MLZL 3IUDA 1JZ4A 4PJEB 2D0HA 15C8H 1FUNA 1QSEA 1VFOA 3KVPA 3MLYL 3ITOA 3RVTD 3CCHB 2XNAA 1H15A 5E5RB 4ONFL 1BQUA 4IBLT 1V55B 2WP3O 4HCHA 2R56L 4N20A 2YBGA 4OQ1A 5GRJH 4EBQL 4J8RA 1TV8A 4HU0A 1BQ5A 3GS0A 5LBSL 1GVQA 1JNJA 5KZ6A 4HISA 3NFNA 1Z42A 5M5DA 1GG1A 3ZS4A 1ECZA 2L7QA 1A4CA 3MNZB 2BO0A 3O4LA 1JPDX 1XSJA 5M2FX 5FYJD 4DZ5A 4J39A 1Z69A 5KVMC 1M42A 2BNUA 4JE0A 1UZ8B 4KZCA 1TVNA 2LU3A 2BOGX 2I25N 3H21A 2OXGA 4NKMA 4NSKB 3NN8A 4JR9H 4PS4H 3Q1SL 1K3UA 4F79A 5E0FA 1H3TA 3MJ9H 1LQBC 3AS2A 2ZONA 3O3DA 4TNEA 2BVOB 3VFWA 4P4KB 1LOLA 4HGMA 2YOAA 2FLRT 2V37A 4MGXA 3BPOC 4QPEA 4U7KA 2ZTBA 3LRLA 4YDJA 3T8XB 2VE6B 1I7ZA 3DX9A 1A3QA 4Z7WF 4C1LA 3IDJB 5IRPA 1L9SA 3WUBA 5LKYA 3QORD 1HKLH 3FB5B 3L5WA 5ETUA 3ZN6A 5JNYA 4GW5A 1JJUA 4R5XA 4Z7QB 1NDZA 2X6MA 3II2A 3QDJE 4DGWC 1ZAGA 2E7HA 4KKNA 2HVMA 1ZT1B 2X0VA 4GSXA 1T20A 3O2VH 5KSBE 4JIEA 3GEFA 2E77A 1ZKAA 4JQIL 1JGVH 3BZFB 4QDGA 2P4AB 4JM2C 1F4WH 3T2QA 1OM0A 2DT0A 4HNOA 2ADIB 5HGDB 4G7QB 1WIUA 1EA9C 5FSDC 5EA9A 1JERA 3RWEB 5D71L 4LAMA 4U4MA 4MWFB 4RGMC 5AYUH 4CSSA 4GG6F 2QJIA 4C56B 5MEPB 3O11B 2Q7AA 5FW8A 3HC2A 1ZA3B 2EXOA 2WHKA 1XLFA 1OCCB 1OZTG 3ILEA 1SW3A 3BOVA 3WFBL 2VFFA 3EB3A 4KK6D 1IQ8A 2MNJB 3VNMA 1MWAB 4Z0BL 4C6CA 2BSED 1YA5A 2UXVA 3SCMB 3RNKA 4NPJA 5TE6L 3UG3A 2HT4D 4FKHA 4ZFGL 3UBGA 2DWXA 3QJHA 3UZQB 3CMGA 5IB3B 2PODA 5JXAH 2XZCH 3IJLA 1JVNA 2FSEA 4TKWA 1CB2A 5H1WA 2DF3A 4Q9QH 3HZKA 3LEYH 4ZTYA 2WLHA 3NABH 4ZMWA 1NAMA 4MZ8A 4GSRA 5CFHA 4E0RA 4D8AA 3FBQA 3W1XA 2E1DA 3C2VA 4H6KA 3WQCA 1K8DA 1JPTL 3FDGA 3ZKSD 3OAZK 1S2VA 2X7WA 5IVXE 3RYMA 1BBJB 3J27A 1BF6A 3BCDA 3W26A 3UTTE 5FEPA 2X1SA 1MWAH 4N85A 5FFOA 3FTGB 4B41A 5EMKA 1LQ2A 5HHOA 3T0WA 3E49A 1GCYA 1H9DA 5IHSA 2BV9A 3BRFA 4GQRA 2VUNA 2G9HB 1QRNE 1SN5A 4FULA 4JM2A 4JZJC 4KO7A 4AUJA 1XR2A 3NGBB 2I17A 1QSFD 3CWOX 2GJNA 1D5IH 3HPLA 2E0PA 1JQVA 5KS9F 2Z2UA 3EYOA 2MH4A 4ORGA 2ZRUA 5EC2A 2ITDA 2NXYC 2C9UA 4YHOL 4G9FD 1IIHA 4JD4A 3MLSL 3LEXB 4ODUA 3NSXA 3H2MA 2ZYIA 1LEGB 3PP3K 2EKGA 2VC2B 2YKLH 1SNRA 1F3WA 3NRQA 4X9FA 5ANMA 1BF2A 2AQ1A 2F5AL 3I7SA 4HIBA 4IRZL 3ABLB 5DUBB 4YWGH 5KTEH 2B7NA 4DFHA 4KEVA 1B9ZA 1MJ7H 4YFLF 3CUZA 3KLDA 3FONB 2IQDA 3QQ9C 2XI9A 4L4VE 3HMXL 5E99L 1GUVA 3GE7A 2QQNL 1NGWB 3PAZA 3X3FL 4LSQL 3QNYB 4HCIA 4LOCA 1AE6L 1CK0L 1VJSA 1T20B 2YR1A 4LGPB 2GHZA 1XKJA 2Z2AA 3MNDA 5FUZH 1OAXH 3DJSA 4IMLB 3CK0L 2YN5A 3GF8A 3AWOA 4PODA 1XRSA 2VXSH 3QG7H 3GU2A 2OCCB 3FTZA 2AW2A 1FORH 5C6WH 1PLGL 3UPBA 1D7BA 4MAYA 2GJPA 2R2HB 3GNDA 1FNGA 1MCOL 2XA3A 1NOWA 3GDRA 1WZMA 1PL9A 5I5JA 3S2LA 3VPLA 5J04A 3G5XA 3G1SA 3MP4A 2AXWA 3QAQA 3QIUA 5FA4A 1DHKA 3GMPB 2EE6A 4LOVA 4OGZA 4PRPE 5T1LA 2VC6A 1GW0A 1OAKH 3LMJH 3N42F 3KRZA 2CK0L 4J40A 4GMEA 4DPBX 1ZE3C 3WO4C 3D9AL 3FT2B 3W7IA 1I8MB 1ISVA 1RXLA 8TIMA 3B3IA 1ZXKA 2R2BA 4OQTA 4PTXA 4FPSA 2CEQA 4UM8A 2CU0A 3QT2A 3TBYA 2HROA 3W73A 4X6BA 1FN4A 2DJ4A 5SWSD 5C7ZA 1KCUL 5BXSA 3VH8G 4F57H 2R29A 4N3TA 2QGCA 4EKJA 4TXEA 4LU5L 5IB2A 3G08A 3RLSA 4NY2A 4WLCA 1E6SM 1UZ4A 3SBRA 4KROC 2PFHA 4GCAA 4JVWA 4Y4KB 4JW3A 1ODAA 3MDUA 2D7TH 4X8XA 3UOAB 4IIFA 3NGJA 4PG9B 2IS7A 4M7LH 1ET7A 4ESKA 4E2BA 4NPYA 2D31A 4CMMA 5I30H 4YZWA 3C0LA 1K7XA 5FEZA 2B4CH 2L04A 2DEYX 1AP2B 4G3YL 2IALB 3RAOA 4L80A 1TQUA 3QF0A 4GVGA 1R5WA 3HZVA 3P11L 5AW7B 3DFOA 1I2OA 5HHOD 4G5ZH 1Q6QA 1EDQA 4DF2A 2Z0BA 4OD2B 4GAYB 3U36A 3B2MA 2QSCL 4HKXA 3N2CA 1ZVYA 4Q7IA 2XYLA 4U6XA 1LEIB 3V2AR 5DJXB 2PETA 3BVWA 4BCYA 4C7FA 4OFVA 4UDTA 3SE6A 3IB4A 1K4CB 1ELSA 4RLIA 3CVIL 3MLRL 4X3ZA 4RMSA 1DE4A 4Y7MA 4BFIB 1R5IA 1P1XA 4M9OA 4GOSA 2HXUA 3PWIA 3UCDA 1N5YH 2BS9A 1IAIM 1YJDH 4X8JB 3UJTH 3ZIYA 3GB7A 2EDTA 3IS1X 3LCXA 4HIIB 1DUZA 5CGQA 2DPEA 5LBVA 4AC4A 3LCIA 3BFWA 3ILPB 1M71A 4RIRB 3VFPA 4Z7IA 2O72A 4KPHL 4B5WA 1KA9F 3HU7A 3ABMB 1JV2A 2R2EA 1CCWB 3QC0A 2IMRA 4IIDA 3FTUA 2H1PL 4WV1A 4TQPA 4J7RA 1XC6A 2Q6ZA 5A6MA 5CGBA 5HWJA 3GGWB 1RP9A 5FYLD 2PDIA 4BS0A 3WEAA 1EA0A 3EXTA 4BCXA 4YLWA 2G3JA 4WWID 3BH8B 3AQYA 5H6HA 2Y24A 4EQ3A 4MAYC 3RPIA 3VD9A 4DXKA 3OJGA 1GYVA 4FJZA 3THMH 4NQEA 3V35A 3HZMB 3HRPA 2HFTA 2GK0B 1HHHA 1RZFH 1BIHA 3KXQA 4NO5A 1XG3A 2PBOA 3DURA 2BY2A 1XCQA 3PF3A 4PUEA 3MCKB 4N2BA 4RV3A 5GJTL 4E6MA 1BXAA 3WFDH 3NRPA 1U5JA 2PYED 1WCBA 2ZYSA 3WNPA 4WUUE 3ARFB 1DTUA 1IYXA 1KFEA 5E94B 5ERWB 4M56A 1T7VA 5E6SB 2F7FA 3GNPA 4G7EA 4ZTPL 1OSZB 1ZHLB 3A0OA 3C08L 3FT9A 5CP7B 5D6CA 3MZNA 4YN5A 3B9VA 2GL5A 1YMHB 3AHZA 2C1OB 4H7VA 5C0CE 1D8WA 3GHTA 4W5UA 3V5KB 5IESL 1YW1A 4RDQG 4X9SA 4UT9A 1RZJC 1NCAL 5KVEE 2MCPH 3GHBH 3T78A 3GSXA 4YGAB 1UR1A 4RLDA 2WO5A 4LAJH 3JZUA 3TWBA 3H7BA 4JN1L 4TUOA 1B3JA 1PZAA 2ZCHH 4B9IA 3RTQB 4TLTA 5KBDA 2R91A 2CE6A 3HW7A 2C79A 1ZSHA 3I6SA 4U5IA 4O10A 3EXRA 5ALCH 1MG3C 4XP9L 4YLQT 4EDWL 5HJ3B 4HIXH 1I2NA 3DI1A 2XQYK 4FFZA 2R1MA 1CIUA 3RGVC 3C87A 4XZ4A 3NDZA 1M1XB 1L3NA 3QSKB 2B4GA 4IX2A 3AWNA 3SRDA 4DQAA 3TYFA 2Q20A 1ALDA 1RIUL 3LH9A 3PHQB 1ECYA 1EZSA 1BLNB 5L6YH 1EFZA 1HKJA 3VXMB 3D18A 5AWNL 3BQUC 5IMMA 3UR2A 3K2UH 1GJIA 1HKKA 1CT8B 1FZJB 3GTFA 3EW3B 4GG6A 5LG6A 1S7TA 3GRWH 2PMZA 2OOFA 4EUPB 1AH0A 2OZ3A 4WO4D 4U2YA 2F19L 3U9WA 1DJQA 2A0NA 3KJ6L 3KM8A 2JCCE 4NZJA 3UVIA 1Q7QA 1JYXA 3NZGA 1JCYA 3GQFA 1M7XA 4TS6A 4UTAL 5JHLH 5A2JH 1M3JA 2PXYA 3VC5A 4YEFA 2EXSA 4LRNH 4E42B 3GC5A 3QUYA 4AJVA 4LB4A 1W5PA 1PHWA 5AOUA 4QS6A 4OGQC 3B2UD 4PVNA 2VAAB 2QZ5A 1A9BB 4CMHB 1XUZA 1BTMA 1ZU8A 2DQUL 5CM1A 4D8ZA 4E9LA 2YCIX 2G5BA 4JKPL 1NM9A 2J6WA 1LEKB 3W7NA 1HHHB 1OG6A 5H91A 1PYFA 3FZUC 5IW1B 4KKLC 4JN6A 2WKGA 4GG8B 2ZCLH 2AJSH 4GIPD 5IW1A 4HZ7A 1M7DB 4HXBL 4QT5B 1OABA 3GSVB 4PJ7E 4W86A 1IBZA 4DAFA 1WTLA 4ONGL 3IPWA 2P24B 4JPIB 1IGTA 1IO4C 2DORA 5H8UA 3KOWA 1RXOB 4NHCL 3H26A 3CVDA 2GYSA 2OL3A 3C75A 1S2TA 1L9RA 3JQOB 2R69H 4W84A 1R3RA 4DVOA 4CN1A 2A1YA 5LZLA 3PULA 1AG6A 4MCMA 4UC5A 5D9SA 3VWJA 2FQIA 3AHYA 2CIKB 4EI5B 3EEZA 3F03K 4Y7EA 2OELA 2J6EH 3SN6N 2VFHA 2WINB 1H6FA 4BFIA 2WJEA 5LNGA 4A04A 5HHQB 5EU6B 2IBZY 3EG9A 2C8NA 3RI5F 3TEXA 3KL5A 5ID1B 3FB7A 5DC4B 1PKQE 1CB7B 4W6WB 1FHVA 2FPYA 4KETA 5C54A 5C0RL 1H0GA 1IGSA 2OEKA 4OVVA 1DBBH 4KXZH 4APXB 1EMTH 4CKQA 1F4WL 1XQ4A 3C6LB 1BAWA 1JE6A 5I2IB 1F6YA 2ZUMA 4DXXA 3F5WA 4TIMA 4NZRL 1YY8A 1CF8L 5I2IA 3QUKA 3BP7B 1NFIB 3GTNA 5EZLA 3RWGA 2WNKA 1ZIBA 2AK4A 1SM3H 2NSXA 2IFFH 5M94B 3UZYA 4F9LC 1LK2A 3FB6B 1W3HA 3L3GB 1JGDB 4WJ5A 3D85D 3H3KA 3HMWH 3ZE0E 4NJ9L 2B59B 4F9PA 3H8AA 3VOGA 1DQDL 1QRNA 2O5XH 5DZJA 2FHBA 5AL8A 4YSSA 1X1NA 3STEA 2WWMD 3HNVL 4KCUA 1Y0LA 1CWVA 3NSYA 5AHFA 3VE9A 4IMKC 3OMZA 4XAYA 2BNQE 3QQ3A 3QXVA 3G1DA 4HP5A 3ZDZE 2C91A 3M0LA 3EOTL 2QJNA 4IPNB 3BWUC 3QXDB 1MCBA 5TQ0H 2QV2A 3QH3A 4UU9B 5FKAB 3OBEA 2DZUA 3V5HA 1GQIA 1SYVA 5CN1A 1C16A 4E4FA 1R75A 5FUOH 1NUNB 5L2KD 5D7SL 1Y07A 2WWDA 2YCEA 4LPWA 5HYQA 4MJMA 2Q76A 2F53D 1ET8A 3L2MA 4J3OF 1T1YB 2KQNA 3PPFA 4QE5A 3BW9B 3PXJA 4LOUD 4KQ0A 3P40A 3KPRE 2BW4A 3EJYC 3P9LA 4OV6F 2O26U 2OPCA 4XCEA 4H9ZA 3UWYA 4WKZA 4KY2A 5DMJB 3WJSA 3BWAB 3HB3C 3BSMA 2FEJA 3FUIA 4I1NB 3PWJB 1AAJA 3T55A 2ZOLA 5CZVL 4ELMF 4IPLA 4Y5XC 2BP8B 1O7SA 4Z2JA 3F5WB 2PWUA 2CG9X 5TDOA 7ENLA 1PG7H 2CGRL 1G1OA 3IAQA 3U0WH 2O9TA 3TNBA 1ZDSA 2A9DA 4L05A 4NDMA 4NP4L 3R1GH 1HILB 2P8MB 4DUXA 1J01A 3DVNA 2I56A 5F1UA 4IRZH 2R6OA 1NBCA 3VNZA 1FH5H 3LHZA 2RFXA 4MDRA 3PFUA 4IISA 5C55A 3V0AC 1WXJA 3H2QA 3MRDA 3PL6B 3SDDC 5JHLA 4HPGA 2GY5A 3PUEA 2PPDA 4FX7A 3I4EA 3EJCA 4GRWB 4Q14A 4R7XA 3T0CA 2OMWB 3T65B 1ZK9A 2E86A 4JFQB 5IR1B 2YAEA 1L9OA 3TN0A 4CRPA 3T4YB 4PGDB 2N1KA 4HXAL 1VBRA 3HRZB 2DEPA 3QQDB 4M6OL 2D3LA 1WWBX 4PJCB 1PTAA 5KYXA 3G9VA 5F9AC 4KPLA 4NO0B 5E8EB 1QR1A 2VXSL 1N6QH 2FX7H 1CXHA 1EAPB 2Y7QA 3PXHA 4PJXE 4YHIB 1UR0A 3DKHA 5K9JL 2E7LC 3OGVA 5CQ1A 2PD9A 4GZ7A 7A3HA 3W11D 3HAEH 1LOSA 4UTWC 4H1LB 1A4LA 4KRNA 1IEHA 5HI5D 2C9XA 2K70A 2GPTA 1U58A 2JQAA 4XRCA 2UZPA 4ORGB 4XN5A 5DT1L 1EBHA 4OWGA 2V8MA 4D7BA 1O5RA 5GGUA 3QZWG 5AZ2L 2UY6A 4HC1H 3VXRB 2HA1A 5CLYA 3CFNA 5KYYA 3U7AA 2J79A 4QE1A 3GKWH 1AQFA 4F58L 1BA9A 1RJZA 3APDA 1RD5A 3U0TB 2ARJQ 3ZGIA 3UBFA 3CC1A 4OH2A 5IB1A 4KO5A 1EH9A 1SZEA 3I3EA 4M1GH 3W4RA 5I77A 4J3OH 2J6VA 4ETQA 1MFUA 3VAEA 4H4NA 1J0ZA 3JWOH 4L3EA 1XYLA 2WJFA 1FNEA 3MA7B 1KCSL 4Y5VC 2VOMA 3L12A 4C55A 4OOZA 2VT0A 5C8BB 1NEZB 2E5EA 3SCMC 4OECA 5DK3A 2VELA 1WXZA 1IAKA 4PM1A 5HQMA 3MREA 2TSBA 4YGVB 1B54A 4CEXC 3D3AA 4OGXL 5E1IA 2WNXA 5ITFA 4KU1A 2NNFA 4OLVL 2YN3A 3PZTA 5AYXA 4F7TB 4P7NA 3ULVL 2G8ZA 2B9BA 1G6RA 1FBIL 1IM3D 2LU5A 3MRBB 4CNIB 1YNLH 1J7VR 3ASNB 3F7KA 3NJXA 3CU1A 3QO1A 2JCCF 1A3ZA 4TVPD 3ZKQD 3PSWA 4HB7A 4PFHA 2BOBB 2FX9L 1EAOA 1S7WB 4U1HB 4XVTH 1ADOA 4C56D 3W1NA 1XO8A 4Y7OC 2IH3A 4IMKA 3ZYIA 2Z7KA 3PZ9A 5KJ4A 4ZPVB 4QHRA 4PJGE 3S5ZA 4S3KA 2Z31B 3WMQA 5FESA 1RURL 1HFUA 3TNNA 2HKHL 2REQA 4P46D 5BO1L 4NFCA 4GY0A 4WJ8A 2EBNA 4U6TA 4W9EC 5IBLD 4AZBA 1HJXA 1XB6A 3HBGA 4X8JA 3L5AA 3AG3B 2AF2A 1Q6RA 3GSMA 1EO5A 2LFEA 3WMPA 1R5IB 3W53A 3MRLA 5D1ZB 4DI9A 4MB5A 3WFHA 4M7ZC 2WNZA 3JTSA 3OX8B 4OFYD 4Z2KA 4XR8C 5ILTH 2I14A 1JGEB 1DWGM 4US5A 3OAYK 3VFUB 3N19B 3VABA 2PP0A 5CH9A 2GSGB 1Z3GL 4NZFA 4OD3L 3U83A 3E96A 3R89A 3HVNA 3MBEC 3E5BA 1SFJA 3V6BR 3EA2A 1W1PA 3GX9A 5CD3A 3FU6A 2VZUA 3O6LL 2F8XC 2DH3A 3KS5A 4P2RD 4G80A 3OYXA 3QZNA 2QR0B 5A3ID 4NKIH 1SJCA 3CIQA 1QPOA 5LGKA 4NSKA 2PDWA 4XZUB 4E8DA 4HUWA 1KM0A 1KGUA 5JW4R 3ZXAC 2PN5A 1QQDB 3PS6A 4R4FH 1R0AL 4MSSA 1Z5HA 3C8KA 5D09A 1ILUA 1UOZA 3N11A 2NY5C 2NZ9D 1IQDB 1GVYA 1B9KA 3P3UA 3QDJD 4OZFA 1SZFA 1CD8A 4K94H 4A67A 2OFJA 3BVDB 2Y63A 3PNUA 4WI6A 5BOZG 1SVDA 1IKNA 3MRNA 1DTNA 1PCKA 4JQ4A 3Q7JA 3SE8L 1OT2A 3QRLA 3QEGH 1I1FB 1OAKL 3LMJL 2CLIA 1KV3A 4N0UE 3B9DA 4UIKL 2YXFA 3GZOA 5CJXA 3KGTA 1M9HA 4TVPH 1KR0A 1SM9A 1TETL 3FNDA 1T40A 2JI1A 4Y9OA 3LRSA 1MNNA 2DSUA 1W72B 3OR6B 4OLUH 3WO4B 3MHUA 3P7YA 4HU4A 5DHYA 4XXWA 3VXRA 3PBGA 1EBPA 2C9PA 5IM7B 3RHGA 3SBQA 4YNYA 2MNUA 3RGBA 5GNXA 4GD0A 2MNWA 3BLLA 3FUNA 3D46A 4PB9H 3T2LA 2NVAA 3UY8A 3AIUA 1LT8A 1XFBA 3P93A 4GPNA 2IAMD 2X53A 2AQNA 1MEXL 2GOUA 3UXDA 1Q72L 4MYXA 5DK2B 3IFLL 1RCQA 1IR1A 3KCOA 5IB3A 1FNGB 4QR6A 5HTSA 1U3JA 2XFFA 3AHXA 3OZOA 1NPJA 1L0YA 2J7BA 3OPZH 4O50A 4GVIA 2DQXA 1K8IA 3TJHC 4KI5E 4U1KA 1ICSA 2VDKL 3BK0A 1FWWA 4ODWB 1GY2A 1E2VA 3TYUA 4K7PH 5CC5A 2IW0A 4QYOA 1Q6DA 1US0A 2QXWA 3FVMA 4RFNB 4OZHB 1CICC 3AHTA 4MNQB 5E6IA 4ZFZA 4UOJA 3BQ5A 2NX3A 3RR1A 4JY4A 3EFOB 1AW5A 1ZB5A 3KWWB 3RIFK 2CHWA 1OX4B 2AGKA 3ULSA 2XZZA 1XG4A 1JGUH 2E9WA 2W59A 2IADA 4QXIA 1HFBA 2RD0A 2NLJB 4YXHH 5T8IA 1ISXA 4X6DB 2GUUA 3QZWB 3QUZA 4G1NA 4OKVA 3N14A 5E6ID 3GNOA 5AYIA 1AW1A 1Z9PA 4HGXA 1YNTF 1OCZB 3B3IB 3MUZ1 5F9WC 2ZZ1A 4NJJA 3M5XA 1MAML 3T1FA 4FCHA 3FRUB 2PGWA 3IJHB 3HAEG 3FCUB 3DPBA 3NN8B 1NM4A 3ORWA 4QCIA 2XOTA 2H3KA 4HZ1A 1DBBL 4OJDH 4UYPA 5IEKA 1Q94B 5FHAH 3Q5YA 4IP7A 1TMLA 1D9KA 5JPNA 1WHPA 3M6DA 3RBGA 1AR1B 2QGDA 3SGKC 1EHXA 2UZ9A 1HOEA 3IM1A 1NGQL 4HJ0C 2ISSA 1C5CH 3P0YL 3ABQA 4AHPA 4GW1A 6PAZA 1ETZB 4GXWA 4TQEL 2NOYA 1O7DE 1UUQA 4G6CA 2PR4L 4PCTA 3R7QA 3SPIA 1L8PA 3F4VA 4EWND 4MXVE 6PCYA 1UCTA 4OCSL 3OVUB 5GGUB 1ZLVK 4B9PA 1VGAA 4IMFA 3CSYB 4RE0A