1KBTA

Solution structure of cardiotoxin iv, nmr, 12 structures
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
RKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Comparison of the hemolytic activity and solution structures of two snake venom cardiotoxin analogues which only differ in their N-terminal amino acid.
pubmed doi rcsb
molecule keywords CTX IV
molecule tags Cytotoxin
total genus 6
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1996-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1kbtA00
1LJZA 1HOYA 2ABXA 4FAOE 1NYUA 1JGKA 1QM7A 2UX2A 3KFDE 1LSIA 1CDRA 1ERAA 1FF4A 2CDXA 1ABTA 1KXIA 2JQPA 1BXPA 2ERAA 4P7UA 1ONJA 1FSSB 1KC4A 1CREA 2LA1A 3NH7A 1KL8A 2CTXA 2GOOC 1L4WA 2QJAC 3KFDI 1CXNA 2BTXA 2MHYA 2MJYA 1NTNA 3EBXA 3HH7A 1LXHA 1CHVS 1FSCA 3PLCA 4ZQYA 2MUOA 4IYEA 5DO6A 1UG4A 2HLQA 3BT2U 1BTEA 1RL5A 2JVEA 1COEA 5DZ5A 1HAAA 2UWRA 1CDQA 1LX5B 1FFJA 1TXAA 5IMTD 1H0JA 4LFTA 2CCXA 2QJ9C 3FEVA 3LAQU 4HQPF 1QKEA 1MR6A 4OM4A 1IQ9A 1W6BA 1DRSA 1CTXA 1IK8A 1ERGA 2H64C 3EVSC 2H5FA 4AEAA 1F94A 1NTXA 1IDHA 2QC1A 2K3GA 1CXOA 1JE9A 2GOOB 2QJBC 1FRAA 3ERAA 1IJCA 1KBAA 2CRTA 2H64B 5IMYC 1CDTA 1JBDA 4BIKB 2PJYC 2MUPA 2H7ZB 2H7ZA 2J8BA 4DO8A 1IDGA 1KBSA 4XJJA 1NEAA 2L03A 1IDIA 1TFSA 1YWHA 1CRFA 1G6MA 4RUDA 1I02A 1TXBA 2HLRA 2L5SA 2MJ0A 1ZADA 3BT1U 2H62C 2FD6U 1CCQA 3NEQA 1NORA 1REWC 2CRSA 4OM5A 1XT3A 1S4YA 2N99A 2H62D 1NXBA 1RGJA 4FAOC 2I9BE 2NBTA 6EBXA 1KU6B 1KFHA 1CDSA 5DU1A 4EY8B 1IDLA 4BDTB 1V6PA 1QKDA 4QTIU 1HC9B 1HC9A 3NDSA 1HAJA 3VTSA 1ES7B 1PLOA 1TGXA 2BHIA 1VB0A 1KBTA 1KS6A 1CB9A 3U74U 2OFSA 1MAHF 5EBXA 2MFAA 1CODA 1KTZB 1F8UB 1NYSA 1B41B 2VLWA 1LXGA 2X8BB 1IKCA 2PJYB 3QB4B 4UY2C 2LCRA 2H8UA 1M9ZA 1FASA 1CVOA 3U73U 2MJ4A
chains in the Genus database with same CATH superfamily
1LJZA 1HOYA 2ABXA 4FAOE 1NYUA 1JGKA 1QM7A 2UX2A 3KFDE 1LSIA 1CDRA 1ERAA 1FF4A 2CDXA 1ABTA 1KXIA 2JQPA 1BXPA 2ERAA 4P7UA 1ONJA 1FSSB 1KC4A 1CREA 3U73U 2LA1A 3NH7A 1KL8A 2CTXA 2GOOC 1L4WA 2QJAC 3KFDI 1CXNA 2BTXA 2MHYA 2MJYA 1NTNA 3EBXA 3HH7A 1LXHA 1CHVS 1FSCA 3PLCA 4ZQYA 2MUOA 4IYEA 5DO6A 1UG4A 2HLQA 3BT2U 1BTEA 1RL5A 2JVEA 1COEA 5DZ5A 1HAAA 2UWRA 1CDQA 1LX5B 1FFJA 1TXAA 5IMTD 1H0JA 4LFTA 2CCXA 2QJ9C 3FEVA 3LAQU 4HQPF 1QKEA 1MR6A 4OM4A 1IQ9A 1W6BA 1DRSA 1CTXA 1IK8A 1ERGA 2H64C 3EVSC 2H5FA 4AEAA 1F94A 1NTXA 1IDHA 2QC1A 2K3GA 1CXOA 1JE9A 2GOOB 2QJBC 1FRAA 3ERAA 1IJCA 1KBAA 2CRTA 2H64B 5IMYC 1CDTA 1JBDA 4BIKB 2PJYC 2MUPA 2H7ZB 2H7ZA 2J8BA 4DO8A 1IDGA 1KBSA 4XJJA 1NEAA 2L03A 1IDIA 1TFSA 1YWHA 1CRFA 1G6MA 4RUDA 1I02A 1TXBA 2HLRA 2L5SA 2MJ0A 1ZADA 3BT1U 2H62C 2FD6U 1CCQA 3NEQA 1NORA 1REWC 2CRSA 4OM5A 1XT3A 1S4YA 2N99A 2H62D 1NXBA 1RGJA 4FAOC 2I9BE 2NBTA 6EBXA 1KU6B 1KFHA 1CDSA 5DU1A 4EY8B 1IDLA 4BDTB 1V6PA 1QKDA 4QTIU 1HC9B 1HC9A 3NDSA 1HAJA 3VTSA 1ES7B 1PLOA 1TGXA 2BHIA 1VB0A 1KBTA 1KS6A 1CB9A 3U74U 2OFSA 1MAHF 5EBXA 2MFAA 1CODA 1KTZB 1F8UB 1NYSA 1B41B 2VLWA 1LXGA 2X8BB 1IKCA 2PJYB 3QB4B 4UY2C 2LCRA 2H8UA 1M9ZA 1FASA 1CVOA 4KSNA 2MJ4A
chains in the Genus database with same CATH topology
1LJZA 1HOYA 2ABXA 4FAOE 1NYUA 1JGKA 1QM7A 2UX2A 3KFDE 1LSIA 1CDRA 1ERAA 1FF4A 2CDXA 1ABTA 1KXIA 2JQPA 1BXPA 2ERAA 4P7UA 1ONJA 1FSSB 1KC4A 1CREA 3U73U 2LA1A 3NH7A 1KL8A 2CTXA 2GOOC 1L4WA 2QJAC 3KFDI 1CXNA 2BTXA 2MHYA 2MJYA 1NTNA 3EBXA 3HH7A 1LXHA 1CHVS 1FSCA 3PLCA 4ZQYA 2MUOA 4IYEA 5DO6A 1UG4A 2HLQA 3BT2U 1BTEA 1RL5A 2JVEA 1COEA 5DZ5A 1HAAA 2UWRA 1CDQA 1LX5B 1FFJA 1TXAA 5IMTD 1H0JA 4LFTA 2CCXA 2QJ9C 3FEVA 3LAQU 4HQPF 1QKEA 1MR6A 4OM4A 1IQ9A 1W6BA 1DRSA 1CTXA 1IK8A 1ERGA 2H64C 3EVSC 2H5FA 4AEAA 1F94A 1NTXA 1IDHA 2QC1A 2K3GA 1CXOA 1JE9A 2GOOB 2QJBC 1FRAA 3ERAA 1IJCA 1KBAA 2CRTA 2H64B 5IMYC 1CDTA 1JBDA 4BIKB 2PJYC 2MUPA 2H7ZB 2H7ZA 2J8BA 4DO8A 1IDGA 1KBSA 4XJJA 1NEAA 2L03A 1IDIA 1TFSA 1YWHA 1CRFA 1G6MA 4RUDA 1I02A 1TXBA 2HLRA 2L5SA 2MJ0A 1ZADA 3BT1U 2H62C 2FD6U 1CCQA 3NEQA 1NORA 1REWC 2CRSA 4OM5A 1XT3A 1S4YA 2N99A 2H62D 1NXBA 1RGJA 4FAOC 2I9BE 2NBTA 6EBXA 1KU6B 1KFHA 1CDSA 5DU1A 4EY8B 1IDLA 4BDTB 1V6PA 1QKDA 4QTIU 1HC9B 1HC9A 3NDSA 1HAJA 3VTSA 1ES7B 1PLOA 1TGXA 2BHIA 1VB0A 1KBTA 1KS6A 1CB9A 3U74U 2OFSA 1MAHF 5EBXA 2MFAA 1CODA 1KTZB 1F8UB 1NYSA 1B41B 2VLWA 1LXGA 2X8BB 1IKCA 2PJYB 3QB4B 4UY2C 2LCRA 2H8UA 1M9ZA 1FASA 1CVOA 4KSNA 2MJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LJZ A;  1HOY A;  2ABX A;  4FAO E;  1NYU A;  1JGK A;  1QM7 A;  2UX2 A;  3KFD E;  1LSI A;  1CDR A;  1ERA A;  1FF4 A;  2CDX A;  1ABT A;  1KXI A;  2JQP A;  1BXP A;  2ERA A;  4P7U A;  1ONJ A;  1FSS B;  1KC4 A;  1CRE A;  2LA1 A;  3NH7 A;  1KL8 A;  2CTX A;  2GOO C;  1L4W A;  2QJA C;  3KFD I;  1CXN A;  2BTX A;  2MHY A;  2MJY A;  1NTN A;  3EBX A;  3HH7 A;  1LXH A;  1CHV S;  1FSC A;  3PLC A;  4ZQY A;  2MUO A;  4IYE A;  5DO6 A;  1UG4 A;  2HLQ A;  3BT2 U;  1BTE A;  1RL5 A;  2JVE A;  1COE A;  5DZ5 A;  1HAA A;  2UWR A;  1CDQ A;  1LX5 B;  1FFJ A;  1TXA A;  5IMT D;  1H0J A;  4LFT A;  2CCX A;  2QJ9 C;  3FEV A;  3LAQ U;  4HQP F;  1QKE A;  1MR6 A;  4OM4 A;  1IQ9 A;  1W6B A;  1DRS A;  1CTX A;  1IK8 A;  1ERG A;  2H64 C;  3EVS C;  2H5F A;  4AEA A;  1F94 A;  1NTX A;  1IDH A;  2QC1 A;  2K3G A;  1CXO A;  1JE9 A;  2GOO B;  2QJB C;  1FRA A;  3ERA A;  1IJC A;  1KBA A;  2CRT A;  2H64 B;  5IMY C;  1CDT A;  1JBD A;  4BIK B;  2PJY C;  2MUP A;  2H7Z B;  2H7Z A;  2J8B A;  4DO8 A;  1IDG A;  1KBS A;  4XJJ A;  1NEA A;  2L03 A;  1IDI A;  1TFS A;  1YWH A;  1CRF A;  1G6M A;  4RUD A;  1I02 A;  1TXB A;  2HLR A;  2L5S A;  2MJ0 A;  1ZAD A;  3BT1 U;  2H62 C;  2FD6 U;  1CCQ A;  3NEQ A;  1NOR A;  1REW C;  2CRS A;  4OM5 A;  1XT3 A;  1S4Y A;  2N99 A;  2H62 D;  1NXB A;  1RGJ A;  4FAO C;  2I9B E;  2NBT A;  6EBX A;  1KU6 B;  1KFH A;  1CDS A;  5DU1 A;  4EY8 B;  1IDL A;  4BDT B;  1V6P A;  1QKD A;  4QTI U;  1HC9 B;  1HC9 A;  3NDS A;  1HAJ A;  3VTS A;  1ES7 B;  1PLO A;  1TGX A;  2BHI A;  1VB0 A;  1KBT A;  1KS6 A;  1CB9 A;  3U74 U;  2OFS A;  1MAH F;  5EBX A;  2MFA A;  1COD A;  1KTZ B;  1F8U B;  1NYS A;  1B41 B;  2VLW A;  1LXG A;  2X8B B;  1IKC A;  2PJY B;  3QB4 B;  4UY2 C;  2LCR A;  2H8U A;  1M9Z A;  1FAS A;  1CVO A;  3U73 U;  2MJ4 A; 
#chains in the Genus database with same CATH topology
 1LJZ A;  1HOY A;  2ABX A;  4FAO E;  1NYU A;  1JGK A;  1QM7 A;  2UX2 A;  3KFD E;  1LSI A;  1CDR A;  1ERA A;  1FF4 A;  2CDX A;  1ABT A;  1KXI A;  2JQP A;  1BXP A;  2ERA A;  4P7U A;  1ONJ A;  1FSS B;  1KC4 A;  1CRE A;  3U73 U;  2LA1 A;  3NH7 A;  1KL8 A;  2CTX A;  2GOO C;  1L4W A;  2QJA C;  3KFD I;  1CXN A;  2BTX A;  2MHY A;  2MJY A;  1NTN A;  3EBX A;  3HH7 A;  1LXH A;  1CHV S;  1FSC A;  3PLC A;  4ZQY A;  2MUO A;  4IYE A;  5DO6 A;  1UG4 A;  2HLQ A;  3BT2 U;  1BTE A;  1RL5 A;  2JVE A;  1COE A;  5DZ5 A;  1HAA A;  2UWR A;  1CDQ A;  1LX5 B;  1FFJ A;  1TXA A;  5IMT D;  1H0J A;  4LFT A;  2CCX A;  2QJ9 C;  3FEV A;  3LAQ U;  4HQP F;  1QKE A;  1MR6 A;  4OM4 A;  1IQ9 A;  1W6B A;  1DRS A;  1CTX A;  1IK8 A;  1ERG A;  2H64 C;  3EVS C;  2H5F A;  4AEA A;  1F94 A;  1NTX A;  1IDH A;  2QC1 A;  2K3G A;  1CXO A;  1JE9 A;  2GOO B;  2QJB C;  1FRA A;  3ERA A;  1IJC A;  1KBA A;  2CRT A;  2H64 B;  5IMY C;  1CDT A;  1JBD A;  4BIK B;  2PJY C;  2MUP A;  2H7Z B;  2H7Z A;  2J8B A;  4DO8 A;  1IDG A;  1KBS A;  4XJJ A;  1NEA A;  2L03 A;  1IDI A;  1TFS A;  1YWH A;  1CRF A;  1G6M A;  4RUD A;  1I02 A;  1TXB A;  2HLR A;  2L5S A;  2MJ0 A;  1ZAD A;  3BT1 U;  2H62 C;  2FD6 U;  1CCQ A;  3NEQ A;  1NOR A;  1REW C;  2CRS A;  4OM5 A;  1XT3 A;  1S4Y A;  2N99 A;  2H62 D;  1NXB A;  1RGJ A;  4FAO C;  2I9B E;  2NBT A;  6EBX A;  1KU6 B;  1KFH A;  1CDS A;  5DU1 A;  4EY8 B;  1IDL A;  4BDT B;  1V6P A;  1QKD A;  4QTI U;  1HC9 B;  1HC9 A;  3NDS A;  1HAJ A;  3VTS A;  1ES7 B;  1PLO A;  1TGX A;  2BHI A;  1VB0 A;  1KBT A;  1KS6 A;  1CB9 A;  3U74 U;  2OFS A;  1MAH F;  5EBX A;  2MFA A;  1COD A;  1KTZ B;  1F8U B;  1NYS A;  1B41 B;  2VLW A;  1LXG A;  2X8B B;  1IKC A;  2PJY B;  3QB4 B;  4UY2 C;  2LCR A;  2H8U A;  1M9Z A;  1FAS A;  1CVO A;  4KSN A;  2MJ4 A; 
#chains in the Genus database with same CATH homology
 1LJZ A;  1HOY A;  2ABX A;  4FAO E;  1NYU A;  1JGK A;  1QM7 A;  2UX2 A;  3KFD E;  1LSI A;  1CDR A;  1ERA A;  1FF4 A;  2CDX A;  1ABT A;  1KXI A;  2JQP A;  1BXP A;  2ERA A;  4P7U A;  1ONJ A;  1FSS B;  1KC4 A;  1CRE A;  3U73 U;  2LA1 A;  3NH7 A;  1KL8 A;  2CTX A;  2GOO C;  1L4W A;  2QJA C;  3KFD I;  1CXN A;  2BTX A;  2MHY A;  2MJY A;  1NTN A;  3EBX A;  3HH7 A;  1LXH A;  1CHV S;  1FSC A;  3PLC A;  4ZQY A;  2MUO A;  4IYE A;  5DO6 A;  1UG4 A;  2HLQ A;  3BT2 U;  1BTE A;  1RL5 A;  2JVE A;  1COE A;  5DZ5 A;  1HAA A;  2UWR A;  1CDQ A;  1LX5 B;  1FFJ A;  1TXA A;  5IMT D;  1H0J A;  4LFT A;  2CCX A;  2QJ9 C;  3FEV A;  3LAQ U;  4HQP F;  1QKE A;  1MR6 A;  4OM4 A;  1IQ9 A;  1W6B A;  1DRS A;  1CTX A;  1IK8 A;  1ERG A;  2H64 C;  3EVS C;  2H5F A;  4AEA A;  1F94 A;  1NTX A;  1IDH A;  2QC1 A;  2K3G A;  1CXO A;  1JE9 A;  2GOO B;  2QJB C;  1FRA A;  3ERA A;  1IJC A;  1KBA A;  2CRT A;  2H64 B;  5IMY C;  1CDT A;  1JBD A;  4BIK B;  2PJY C;  2MUP A;  2H7Z B;  2H7Z A;  2J8B A;  4DO8 A;  1IDG A;  1KBS A;  4XJJ A;  1NEA A;  2L03 A;  1IDI A;  1TFS A;  1YWH A;  1CRF A;  1G6M A;  4RUD A;  1I02 A;  1TXB A;  2HLR A;  2L5S A;  2MJ0 A;  1ZAD A;  3BT1 U;  2H62 C;  2FD6 U;  1CCQ A;  3NEQ A;  1NOR A;  1REW C;  2CRS A;  4OM5 A;  1XT3 A;  1S4Y A;  2N99 A;  2H62 D;  1NXB A;  1RGJ A;  4FAO C;  2I9B E;  2NBT A;  6EBX A;  1KU6 B;  1KFH A;  1CDS A;  5DU1 A;  4EY8 B;  1IDL A;  4BDT B;  1V6P A;  1QKD A;  4QTI U;  1HC9 B;  1HC9 A;  3NDS A;  1HAJ A;  3VTS A;  1ES7 B;  1PLO A;  1TGX A;  2BHI A;  1VB0 A;  1KBT A;  1KS6 A;  1CB9 A;  3U74 U;  2OFS A;  1MAH F;  5EBX A;  2MFA A;  1COD A;  1KTZ B;  1F8U B;  1NYS A;  1B41 B;  2VLW A;  1LXG A;  2X8B B;  1IKC A;  2PJY B;  3QB4 B;  4UY2 C;  2LCR A;  2H8U A;  1M9Z A;  1FAS A;  1CVO A;  4KSN A;  2MJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...