1KBZA

Crystal structure of apo-dtdp-6-deoxy-l-lyxo-4-hexulose reductase (rmld) from salmonella enterica serovar typhimurium
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
298
structure length
298
Chain Sequence
MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVNAAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETDATSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVINDQYGAPTGAELLADCTAHAIRVALNKPEVAGLYHLVAGGTTTWHDYAALVFDEARKAGITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFDLILPQWELGVKRMLTEMFTTTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dTDP-glucose oxidoreductase
publication title Variation on a theme of SDR. dTDP-6-deoxy-L- lyxo-4-hexulose reductase (RmlD) shows a new Mg2+-dependent dimerization mode.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Oxidoreductase
total genus 98
structure length 298
sequence length 298
ec nomenclature ec 1.1.1.133: dTDP-4-dehydrorhamnose reductase.
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1kbzA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1kbzA02
1XSEA 3C7DB 3AY3A 3LLVA 1NR7A 3QWBA 5G0VA 3PHHA 4EITA 1V3VA 1CQJA 1YB5A 4BL5A 2CY0A 1AUPA 1GAEO 3H9UA 3I83A 1A5ZA 3QWAA 3TZCA 3I52A 4KUGA 2PH3A 1ZK0A 3JD4A 4E5KA 3C1OA 4CMBA 3PZBA 3KYDB 1LBEA 4JJIA 3LC7O 1F14A 1UUFA 1J5PA 2W2LA 4P8RA 3S55A 3AM4A 2P5YA 4BKPA 3WSVA 5A9SA 3KRTA 3KLPX 4LVCA 3ZU3A 1X15A 1G0NA 3C85A 3ZDFA 2RHRA 3WOHA 3PIDA 4OOFA 4Z3DA 4NK5A 5FWNA 2IZ0A 3GNSA 5MDHA 4DA9A 1U4SA 4NFHA 3MZ0A 1K6IA 1HDOA 2DQ4A 3ZNQA 1KVSA 2YFHA 1XQ6A 3I4FA 4FOSA 2CDAA 3PDJA 3IP1A 1AXGA 1XGKA 4NR0A 3VH4A 5KJFA 4ND3A 1PWXA 4CUZA 3RC2A 1NYTA 1BDBA 3R0IA 4WOJA 4EUFA 1PZGA 1AE1A 1EBFA 1HXHA 2PNFA 2C7VA 3LF2A 4D41A 2C59A 4KDEA 3OECA 1ZMOA 4FR5A 1JKFA 2GASA 1N1GA 5I7FA 1B15A 5I9MA 1UP6A 3JYOA 3E5RA 1H9BA 1VPDA 1XQ1A 3H7AA 3DEYX 4H15A 4A27A 4DL9A 1DOHA 3JQ8A 3OMLA 3I1JA 3ZWBA 1L1FA 1HE3A 3CZRA 4K6CA 4QFDA 5F1KA 3VZQA 5CDUA 1K2WA 3CMCO 2JHGA 3BZUA 1V0JA 5KKCA 1CETA 4E2ZA 2BI8A 3WBBA 2WE7A 3U4CA 4GMGA 3HFSA 3OJFA 3O9ZA 3CXRA 3BYZA 5KJ1A 2YQ5A 4PLCA 2Z1NA 4IJVA 4E2WA 4FJ1A 4OAQA 1PZEA 3WIDA 4PZEA 4YRBA 2Y68A 2ZTVA 1GY8A 4YQZA 4E2YA 1YS4A 4RPGA 4R41A 3D5TA 1Q0LA 3MJ4A 2V6GA 3RUFA 3AUUA 4BNXA 3PXXA 4OKNA 3HN7A 5G0UA 2BFMA 3H2SA 3HWRA 4CUJA 1D8AA 1H6DA 4RVUA 4XJTA 3DHNA 1NAHA 2XPCA 3VH3A 3S8MA 3VPHA 1U4OA 3EMKA 3LYLA 1I3NA 4R1NA 4Z6KA 1SZJG 5I7EA 1B14A 1U9JA 3FPLA 2IEBA 1N9GB 1ZXLA 3GLQA 3KZVA 1RWBA 3JQBC 4XYEA 3T7EA 5BSFA 1T2FA 3FRJA 5AOVA 1CF2O 2WYVA 4IQGA 4UUOA 2Q4BA 3JYNA 5EPOA 3IKTA 1YDEA 4ESOA 4FN4A 2D8AA 4W7IA 4RQUA 5U4QA 4J4TA 2OHXA 1PGOA 3K73O 1F8GA 3ZHXA 3ETGA 1N7GA 4WLFA 3QW2A 3GHHA 3GVHA 1GYQA 1H6CA 1LDBA 3BIOA 1I32A 2HK7A 1NVTA 2WD8A 3DO5A 3UCFA 1Y6JA 4RDHA 1WDKA 2X8LA 2I65A 4N5NA 2H63A 3ZV6A 2JAHA 1RM3A 1WZIA 3N58A 3A1NA 4KMSA 1MGOA 4CLRB 5AXBA 3L77A 2VHXA 2X5OA 1BMDA 5TJ9A 4DPLA 1T2DA 5I7SA 1IUKA 1KC3A 3PWZA 4P4GA 4ALMA 4B7UA 4A7PA 5A9SB 3SVTA 4YYZA 1DXYA 4RPHA 5MGBA 3QSGA 4TVOA 4R54A 3EYWA 1Y7TA 1YONA 2D3TA 5G0TA 3CEAA 4B8WA 4CR7A 1CERA 2X9VA 4QECA 4OSOA 1P31A 1IL0A 2AW5A 4IJWA 4DVJA 3DFUA 4CLOA 1EQ2A 3JD2A 1DRVA 1EE9A 3L6DA 4PLTA 3QWFA 5EL0A 4F3YA 2PKQP 2OP1A 4CM6A 1Z7BA 4NBWA 3WFIA 1ZK3A 4R1TA 1SCUA 1E3EA 3FNFA 5B1YA 4PIVA 4MP8A 3BTSA 4NBRA 4CMAA 4E21A 2VWQA 4M49A 3ZNPA 1UAYA 3ETEA 2ZJ1A 4FDAA 5DDIP 1HDXA 2YDYA 4MVJF 5L4SA 3RSHA 1EMDA 1IPEA 4NJOA 5AXAA 1FK8A 1GFSA 1U8XX 3ICCA 3RU7A 3WGOA 1IZ9A 4FSHA 4PG6A 4EZBA 4R16A 4ND4A 3RJ9A 4XYLA 1KEWA 2O48X 3ONEA 1DJNA 3WGIA 4CM5A 3BAZA 3I5MA 3GFBA 4B4OA 1VSVA 1E3JA 1Y8RA 4TZTA 1U28A 3F6YA 4BHTA 1YJ8A 2VN8A 2V6FA 3K31A 4CL8A 3UKOA 4Y8VA 1Y1PA 2UAGA 1VKNA 2O2YA 4B7XA 4KUHA 1I10A 1TT5A 3GQVA 3KTDA 2EHDA 2EKQA 1AGNA 4Y6PA 4IY1A 1LQUA 3NUGA 3P2OA 2PZKA 4A10A 3GF4A 4ALIA 3WJAA 1PR3A 5CAEA 4IDFA 2UVDA 4NNJA 4Y6SA 1EQUA 3MOIA 4IZIA 4W6ZA 1KYQA 4XYMA 2O3RA 3ENNA 3TJRA 2BFPA 5G4LA 5KJ6A 3NT5A 2PKQO 4UUPA 3TZQA 1PGQA 1JAYA 1LSSA 3F1LA 3WYEA 3B1FA 4ZQGA 1P1HA 3U0BA 4OOEA 1YBAA 2X1HA 4Y67A 1B8PA 1AN9A 3QHAA 4YACA 4I5GA 1T4DA 1GQQA 3AW9A 3TZ6A 4YAGA 1R15A 3IIEA 3RCBA 2Y0DA 3MJCA 5H81A 1P1JA 4CQMD 3H5AA 1JTVA 2FPIA 1H6AA 2P4QA 4D3SA 4OIMA 3DWFA 4MIEA 4OJNA 1JKJA 2Q2VA 3PHGA 1HE5A 2GUGA 4GVLA 5TS3A 1HRDA 4XGIA 2ZKLA 3IOYA 4E31A 4IQ8A 2X6TA 3TL2A 4B3HA 5BNTA 2UDPA 4L4RA 8ADHA 1ADGA 4OKIA 4EEXA 3QVOA 2B4RO 4JXKA 4EYEA 2I99A 2X0IA 2PWZA 3BTUA 5LDGA 3U62A 3ZWPA 5G0SA 3DBHB 4H3VA 4HP8A 1Y9AA 3LT2A 2P4HX 1C0IA 4J91A 2VOEA 5B12A 3HDJA 4R3NA 4LN1A 4ID9A 3GA0A 1PJCA 2Q2WA 3TN7A 4II3A 3FCOA 5C37A 3GMDA 1A7KA 2HCTA 4TRJA 4BKQA 4BQPA 2AQKA 3RKUA 2BGMA 4FIZA 5DZSA 4CQLB 1NQTA 3EDMA 3NKLA 4AJEA 1PJQA 4B79A 1GDHA 4IDBA 3ZNNA 1LQTA 2JFGA 4PLWA 3DC2A 4JBIA 3E6AA 5JLAA 1VE9A 1Q0QA 2PY6A 4O5OA 5A05A 3ZH2A 1MX3A 2NQ8A 1PR9A 4AVYA 5C7LO 3A4VA 4ALKA 2Q2QA 1YB4A 2A94A 4PCVA 5DOZA 4IDDA 2D2IA 1OFGA 2B36A 5I9LA 1QYDA 1GEGA 3O8QA 1WP4A 5EERA 3NTRA 3WGGA 2B4TO 4AJ2A 1JDJA 2CF6A 2EP5A 4CQMA 2O3JA 3EZYA 5L3ZA 2ZK7A 4LSMA 4A2CA 1VJ0A 1CIVA 2DBVO 2LDXA 2C5AA 4L74A 1QLHA 4Q3CA 1L7EA 3TZKA 4IUYA 2AG5A 3DL2A 4OGWA 3VPXA 4DRYA 4U8GA 2O4CA 1GV1A 3RASA 3ROMA 2VUTA 1E0DA 1RM5A 2DVMA 5DCUA 5ENVA 1YGYA 3KEOA 1BRMA 2IODA 4BO7A 3E1KA 4OXNA 4YT4A 5IXSA 3PQFA 2NM0A 1NAIA 2HAEA 2Y99A 1Y8RB 9LDTA 1EVZA 1H94A 3OQ6A 1XR3A 1H5QA 1PZHA 2ZTMA 4HX5A 3PP8A 1K89A 2O4UX 4CM7A 1B16A 3BMQB 1C0KA 2OP0A 1NBOA 3GOHA 4HKTA 2NSDA 5JMPA 3OA0A 2VOJA 3HZZA 2P91A 3CPSA 3I9KA 4FFNA 1Y8QA 4LVUA 2JL1A 1GQYA 3T4XA 1E6EA 1I8TA 2C2XA 2Q4EA 4XX0A 5ITVA 3C7CB 2EGHA 4BKRA 1R4NB 3U5TA 3RUCA 2Y1CA 2IEDA 3WGZA 2R6JA 3PJDA 1SOWA 4RVGA 3ABIA 4PRLA 4F46A 3GUCA 2ZB3A 4XA8A 3RUIA 2EKLA 2YDXA 4TRMA 3S2FA 1D3AA 3K5PA 1DFIA 1SEPA 3MTGA 1VM6A 1VJTA 2Y1GA 3FR7A 1E3WB 3HNPA 3QE3A 2GO1A 1HEUA 5DN9A 1GUZA 1I0ZA 5ILGA 1ENYA 5JDCA 3WXBA 3JYLA 4IGEA 3GG2A 3ZU4A 2EKPA 3DMYA 1PX0A 1GYRA 2WD7B 2FN7A 3FNEA 4YJDA 3RIHA 3DTTA 2Q1SA 5CDYA 1L7DA 3U49A 1E7SA 2VZ9A 3QV1A 4DUPA 2EG9A 4J49A 3I9OA 3JQGB 1XWFA 2CVZA 3BHIA 3CKYA 4M54A 4D79A 4X54A 4YJHA 2VTDA 3PQEA 2ZJ0A 3VTZA 4BNGA 5COBA 4KQWA 2X7HA 4L4XA 3WGQA 1T2AA 3RVDA 3VVBA 5JYDA 1P77A 4GKBA 3RUAA 1PJ2A 3ASVA 5FI5A 3DOOA 4YRAA 2AEFA 5DOVA 3V2HA 1WLYA 4RVSA 4FBGA 1DDOA 2P5UA 5L40A 2G76A 3SJ7A 4URFA 4GQAA 1HDGO 1P45A 2VHYA 2P68A 4XEHA 2VTEA 3SJUA 4GVXA 4LISA 1TA4A 1TI7A 4L75A 3ANLA 4TVBA 3K6JA 4NHEA 5GMOA 4OH1A 3RU9A 4U5QA 1QP8A 3WMWA 1WWKA 3AUSA 1WAMA 4CM8A 5HTOA 4YTEA 5HA5A 4XQ9A 3AU8A 4NH4A 4JJFA 4JNKA 3DZBA 4MVJH 3TDKA 1O6ZA 4EUEA 2Q49A 3SX2A 3WWZA 4XQEA 4YJGB 1MB4A 4YJFA 4CM3A 2VWGA 3UXYA 3OM9A 4W9NC 2A35A 3GRKA 4TRNA 5HS4A 3AUTA 3PWSA 2WDZA 3PIIA 1GZ3A 4CQMB 1FJHA 4EI2A 2C0CA 4WCDA 1NVGA 4DYVA 3I9NA 4DBVO 3M6IA 1ZXBA 2Y0CA 4BO4A 2GF2A 1ZZEA 3L4BC 3ULKA 1Z7EA 2PD6A 1GUYA 3K2BA 1E7RA 3NDRA 3DR3A 1XEAA 3OHSX 3ON5A 4DPMA 1LC0A 2B83A 2NACA 1AXEA 4E33A 5CDTA 5CFZA 5IZCC 4IS3A 5C7OO 4K26A 5F21A 4Z9XA 5L95A 1XCBA 4WCFB 4FQ8A 2GRAA 2Q99A 1OBFO 2HU2A 2OBNA 3VHRA 2YUTA 1O9BA 2VYVA 3X2FA 3L6OO 3AJRA 5DCYA 4BGUA 3NDIA 5HRUA 3ZGYA 3QRWA 3I9MA 2GNAA 4AJPA 1KS9A 3H6KA 2PD4A 2EF1A 3I4CA 4RORA 1WXDA 4Q9NA 3TZHA 1HE2A 1AHIA 1I01A 1Y8QB 2Z5LA 4E6PA 1U3UA 1JAXA 5THQA 4Q3NA 1LUAA 3JQ7A 1UXHA 3C7AA 3ZHZA 4B3JA 4Z9FA 1UDAA 3NDJA 3VDRA 5L53A 1AHHA 3WB9A 3RFTA 3AI2A 2QX7A 2CUKA 1E5QA 3D0OA 4Q39A 3ZW8A 3MOGA 2GCGA 1OZAA 4INAA 2E37A 1QKIA 1FDUA 4E5NA 4BV9A 1TB4A 1I30A 3ZWWA 3ZWMA 4PZCA 5KNLA 2OO5A 4HUJA 4CM4A 2I6TA 4WKGA 1ULSA 1U8FO 2NVUA 2QW8A 1E1NA 4XYBA 5L51A 5JC1A 2Q45A 5IAAA 4NMHA 2NU7A 4Q3BA 4GLOA 1LRKA 2X5JO 2I9PA 4TRRA 4OSPA 4E5PA 3U9LA 2Y66A 3O26A 3DZFA 1WNTA 1ZO8A 2ZB8A 3PHIA 2OORA 3QWIA 4RF3A 1W6UA 1PTJA 2FRDA 3DXFA 3UH1A 1ML3A 2ZQZA 4O6VA 1ZK4A 3F46A 1PJSA 1N5DA 1B0AA 5THKA 1YOVA 3FF4A 1U3VA 1K6JA 1MC4A 2OL4A 2FHSA 3JQBA 2PGJA 4Y9DA 4ALNA 1ONPA 2WSBA 3TFQA 2GN9A 2C07A 2HMTA 3GC6A 1PGJA 3DFZA 4YJHB 5DT9A 4F6LA 1U3WA 1E1MA 4RF5A 3DTYA 2BRUA 4ZQFA 4QEDA 3VTFA 2OGUA 3GGGA 2E49A 1GCOA 1T2EA 1ZSNA 5AVOA 3D1LA 1TLTA 4KZPA 4NFSA 1E1KA 2SCUA 3KO8A 1IOLA 1PJTA 1QMGA 3U09A 1GEEA 1U1IA 1YL7A 3F5QA 4WOKA 2H9IA 1SOVA 3GEMA 4Z9YA 1G1AA 1PS9A 1P1IA 1J0XO 4KQXA 2DBRA 1NNUA 4I5EA 4I1IA 2BGKA 1MFZA 1R4MB 2I67A 3NJ8A 2JCVA 2ZATA 4DLBA 3OA2A 1WDMA 3UUWA 1H6BA 3ZU2A 1Z73A 5TQVA 1RM0A 2A92A 3SXPA 1J49A 3B1JA 4MO2A 3HJAA 1ZFNA 1CYDA 1PL7A 3WR5A 4YJFB 1ONOA 3DB2A 5BSGA 3RC1A 5ICSA 3W4KA 1X0XA 2DBQA 3HB5X 3MJSA 1EVIA 1SO8A 5KVQA 4RLSA 1JWAB 2WM3A 3OQ1A 4Z3KA 1PL8A 2OXIA 4UUNA 1QV7A 3MJTA 3QY9A 5IG2A 2WEKA 4U0KA 4UREA 1IPFA 1HZJA 1WVGA 2J3KA 3L6EA 4IMPA 1NQ5A 3IP3A 4ZA2A 4WJZA 1OI7A 1DIRA 2GN4A 2HUNA 3DDNA 1C3VA 2RBEA 3EHEA 4YT8A 1Z6ZA 5A5FA 4CL3A 5IJZA 1DBVO 2P2SA 3D5QA 4CMHA 2BFAA 3PGXA 4ZVVA 4ALLA 4AJNA 4HFJA 1VL0A 4HFNA 4QXMA 3TNLA 4DXHA 2BKAA 1D4FA 3GT0A 4PG8A 3RJ5A 4ROSA 3CINA 2DKNA 3DAFA 4W4TA 1BW9A 2O50A 4QQRA 1XELA 2F00A 4CMGA 3RBZA 1PU2A 2Q3EA 4N5MA 1MXFA 3GZNA 1PS0A 4R51A 5T5QA 1LDGA 1PWZA 5TX7A 3JQ7B 2PGDA 4B4VA 1NFQA 4TSKA 1ZJYA 4NQZA 2HKIA 2AMFA 4M87A 5JAMA 4R9RA 1ZCJA 3IC5A 5L7TA 1SAYA 4CV3A 1X1TA 4GX5A 3KETA 1QR6A 1QRRA 1M66A 3G79A 3A9WA 4BNNA 2HO5A 2PLAA 4G5HA 3KYCA 2QRLA 1GL3A 1F12A 4QUKA 4CM4B 4AJHA 2PA3A 4WLEA 3ZV3A 3PLRA 3LT4A 4BMVA 1XHLA 2ET6A 5L7WA 3IJPA 1XIVA 1NXQA 5TSDA 1WDLA 4PLHA 4IJUA 2DTEA 4PLYA 4GAEA 3TOZA 2XF8A 3UFXA 4WK6A 4NG5A 2FZEA 5HS6A 2E6UX 1MG0A 4LMRA 1PIWA 2VZ8A 2FMUA 2IE0A 3GN2A 1YVEI 1LNQA 1I33A 1P33A 1YRLA 1RPNA 3DBRA 1LLQA 2CDCA 4J1NA 2QHXA 3VH1A 4XRGA 3COSA 4QO7A 5GZ3A 3E03A 4CMIB 2DAPA 4W99A 1IY8A 2J3JA 3LT1A 1ZW1A 4Q3DA 1U7TA 3OQBA 3R3SA 1PQPA 4L9RA 1VJ1A 1X7DA 3Q0EA 2JD0A 4A26A 5L45A 4OYRA 3T7CA 1GYPA 1PQUA 3PFFA 5ADHA 2OFPA 3Q9NA 1EDOA 1UH5A 3UHAA 3GR6A 3U4HA 5A5EA 1E3IA 2EEZA 1W73A 3VZPA 4O63O 3FWNA 3GPIA 4G2NA 3DAGA 1P74A 5KVCA 3BHMA 3HUDA 1NX6A 3LVFO 5JCJA 3WGYA 5JPIA 3F3SA 5BT9A 4FGWA 2GN6A 3INGA 3KLMX 3KXDA 4IZHA 4GSKA 3WG9A 3G17A 1W0CA 3CIFA 4FFPA 4KTVE 1SNYA 1YL6A 2DPGA 1YKFA 4Z0HO 4CLDA 4E3ZA 4EJMA 3QA9A 4AL4A 1QYCA 1HL3A 1A9YA 3K2EA 4M89A 3W4IA 5EQDA 1NHGA 2VRCD 4XDZA 3OJEA 1N2SA 4BNWA 4HXYA 4LCEA 4FW8A 1KEUA 5A9RA 3K92A 4IDEA 4PLZA 1U5CA 2WYUA 4WUVA 3WLFA 3BHJA 2J3IA 4YVFA 1QLJA 4XGKA 3L07A 2GERA 5AYVA 1I2BA 4H16A 1C14A 3TPCA 2EGGA 5IXYA 2FSVA 1ADCA 4IGFA 1C1XA 1CWUA 1H2HA 1DC5A 1E6WA 3AY7A 1X7HA 3STHA 1JVBA 4DBZA 3VDQA 2BI7A 1GR0A 3NX4A 3OH8A 4YBZA 3D3WA 3NTQA 1KVTA 3H3FA 4CODB 4BNHA 3C24A 1A4IA 1ZBQA 4BMSA 4BO5A 3HFGA 5C3MA 1XA0A 3I3OA 2YYYA 4Z0PA 3JQ8B 5ER9A 2FR1A 1O0SA 4JJGA 1CEQA 3WBFA 3ONDA 5I9NA 2AEJA 3SEFA 2HSDA 1FMCA 3BMCA 1A9ZA 2J5RA 4PLPA 3OJOA 5IN4A 3WTCA 5CP8A 1Z75A 2G0TA 5G4KA 2A9FA 3D4OA 3PHLA 4UAGA 5JBIA 4MDHA 1ZSVA 3PDUA 1IULA 2WJPA 3UVEA 3W8DA 2DC1A 3M2TA 5CEJA 2DU8A 4GWGA 1V35A 4CMKA 2NU9A 2OUIA 5DF1A 3VKUA 5TF4A 5EJ2A 1EVYA 1ZH8A 5H82A 1FDSA 4UULA 3WGTA 5JC8A 2X9NA 1DEHA 1DIAA 4K6FA 2JAPA 5FEUA 1DLIA 4TQGA 4F6CA 4D0SA 4GX0A 3V1UA 3DZIA 4E2XA 5JY6A 2UYYA 4QTZA 1R6DA 4P38A 4YRDA 3QVSA 5K9ZA 2VRCA 1X13A 3LLSA 3K30A 4A5OA 3K96A 1NTOA 4BGEA 3VKVA 3RKRA 3SLKA 3OEYA 3H8VA 3WTBA 4XGNA 3KSDO 2J8ZA 5JMWA 1ADBA 2EIHA 2FSSA 1K6XA 2YY7A 1BXKA 5JW6A 3DBVO 4KTTE 3OP4A 2HK9A 4AJJA 1EVJA 3FTNA 5TIIA 1T4BA 4DMLA 5KVVA 4XWYA 1JWBB 2X9GA 3A28A 3ONFA 3KEQA 5JYEA 1V9LA 3PFWO 4U6QA 5ITWA 4GX2A 2G82A 2GZ2A 2RAFA 3GPDG 1NVMB 1PL6A 1E7MA 3PJFA 4O59O 1Z82A 4IS2A 2PR2A 1BHSA 1FDWA 3DOCA 2R2GA 2X0RA 5HBRA 1NP3A 4B4UA 3E9QA 3GDFA 1BG6A 4NU5A 4W82A 1LSUA 3IKVA 5EESA 4WNCA 5JAZA 3PLNA 2AQIA 2BHLA 2NQTA 1B8UA 4MVJI 1ADFA 3VAZA 4DPKA 1LRLA 1OMOA 3ADPA 2VQ3A 5BNIA 3EY4A 3KB6A 4J1QA 3RWBA 3FNGA 4D44A 1KY5A 1ONNA 2HJRA 3RBXA 3JYQA 4TKMA 5IN5A 2C20A 3L9WA 1BSVA 1ENZA 2I3AA 4PVCA 5COQA 2JCYA 4J9VA 3HN2A 3GEGA 2VWPA 4A73A 1Y81A 4CLOB 1MP0A 2JD2A 2HJSA 4Q3EA 1ULUA 5IDXA 1HSOA 3LSYA 1KVRA 1NFRA 2NU8A 1MLDA 1N8KA 2B69A 3CE6A 4J16A 3JQAA 3JQ6A 4GKVA 5F1OA 5CPFA 4CMCA 1LLDA 1JA9A 1LXCA 4D42A 1U2DA 3R1IA 1EFKA 4D0RA 3TL3A 3GH3A 4WNIA 3ZW9A 4CM1A 4L0QA 4NDNE 3HADA 4J2HA 4XQCA 3AI1A 2GPTA 2NTNA 2NUAA 1E92A 1JQBA 1DIHA 2DUWA 1HYHA 1BVRA 4L76A 4EJ6A 4ZU3A 3KV3O 5EQFA 1C1XB 4PZDA 4W9NA 4BNUA 2PD3A 4CJXA 4WLUA 1NQAO 1EK6A 1GQ2A 1LI4A 4PLFA 3D3WB 3ZWCA 1LEHA 2PZMA 1DRWA 3H2ZA 1UP7A 3GVPA 4XJSA 1NPTO 2EJWA 2ZIZA 4N54A 4L8VA 3WQSB 2FWMX 2DLDA 1FXSA 3L4BA 3E82A 5L4NA 3F4LA 1W4ZA 1LLCA 1UXIA 3VVCA 2BFOA 1PGNA 3LF1A 3RFVA 4BNJA 5T6BA 5IZCA 1SBYA 2O3QA 4J7UA 3BMCB 3U4IA 4OL9A 4FS3A 4WLVA 3WLEA 4QO8A 3W1VA 1XU9A 1TT5B 2HLPA 4ZD6A 4NZ9A 1MC5A 2FPPA 2Y0EA 2GD1O 3V1YA 4YPOA 3HHPA 4EBFA 4RJTA 3AOGA 1Y9EA 2EERA 2GZ1A 2X23A 3BTOA 4WLNA 3VPSA 1K0UA 1YBVA 2VUSA 4LRTB 4K9DA 4P4LA 4RQTA 1Q2XA 3E8XA 4IQ0A 3ITKA 5A4DA 1GU7A 2DFDA 3RROA 1A71A 4LSWA 2RH4A 3AWDA 1HLDA 1V6AA 2QQ5A 4XCVA 3SLGA 3PEFA 5T64A 3WICA 4BO8A 1SB8A 2O3SA 3H9EO 3VPFA 4DWVA 2VCYA 3O4RA 2EJVA 3EGOA 3ROKA 1NPYA 3WS7A 2I3GA 1I3KA 1ISHA 3M1AA 4GSLA 4RO0A 4GMFA 1VL6A 1KEPA 4HNGA 3W8EA 2AE2A 1ZSYA 2QIOA 3WFJA 1LSJA 5AXDA 3WX0A 1NWHA 2NVWA 4IJKA 4IINA 4IMRA 1NR1A 3TSCA 3VC7A 2IYOA 2BGLA 2G1UA 1IB6A 1HWYA 4DLLA 5T57A 4E5YA 4MKZA 4QFCA 3LK7A 2V6MA 1DHRA 4BO1A 4ND5A 3ITDA 4R69A 4AJIA 3D4NA 5KWEA 4YWJA 1UDBA 1EFLA 1T1SA 3NJ4A 2VYVD 4DC1A 4TWRA 1EE2A 3GMSA 2GR9A 3BMOA 3JQ9A 1E6UA 3FBGA 1LX6A 3EVTA 3UGKA 4YT5A 5K0ZA 3V5NA 1OC4A 3ANMA 4ND1A 4BNZA 3NTOA 1HDZA 3IJRA 2TMDA 3FTPA 1PJ4A 2JHFA 5ER6A 3UF0A 1EDZA 3NRCA 4R3WA 4KWIA 2PKRA 2RCYA 1I5RA 3V1TC 3TF5A 4AG3A 1E3SA 2ZCVA 1BWSA 2O7QA 3JQEA 2VHVA 3FHLA 3NAQA 4RZIA 1B2LA 3OETA 3RFXA 3JQAB 2WYWA 5COAA 1RYEA 1WZEA 4E12A 5ES3A 4CPDA 3JQFC 4JP3A 4J4HA 5JS6A 1Y5MA 2YV2A 2QZ9A 3O8QB 4GPD1 4C7KA 2GGSA 3L0DA 4ZN6A 1O89A 1PEDA 3A14A 1U3TA 1VL8A 5JAIA 3ANNA 4LGVA 3JD0A 3PRJA 5A02A 3SC6A 5JNLA 4GWKA 4UVHA 2I66A 3GVXA 4FC7A 2BF7A 3OFSA 2B5VA 2BLLA 3WYCA 3Q6IA 5C7IO 1R0LA 1PJ3A 3W6UA 4ZICA 3CZMA 2I5PO 2RIRA 4WE3A 4QX6A 1KVUA 4UEJA 3OEWA 1ZKMA 1ENPA 5DP2A 1SB9A 1TXGA 4ITUA 1DC6A 1M67A 5T8KC 3GZ4A 1LC3A 1GCUA 2D5AA 4XRRA 1YH3A 1NPDA 2HRZA 1F8FA 3NT2A 3Q2KA 4MVJA 2AE1A 1V3TA 3FSRA 4OO3A 2PFGA 1T24A 2O3TA 3D64A 1E77A 3AFNA 1YDWA 4PG7A 3GK3A 1HE4A 3MWDB 4XIJA 3E5MA 4C7JA 5KIAA 2H5LA 3U3XA 1VLLA 4LRSB 4HNHA 4D7AA 1HDYA 1HYGA 5LC1A 3QWHA 4CLEA 3O38A 4JK3A 2IXBA 3CSDA 2PGLA 1T26A 5GY7A 1SEVA 3FI9A 4YQYA 1QXSA 2FPGA 4BNYA 1Q7BA 2OOSA 3LZ6A 4II2A 5G2OA 1A4UA 2J5QA 5IFLA 2BMAA 1DIGA 4RVDA 4ZGWA 2NNLD 3RD5A 2W8ZA 3PYXA 2AG8A 3OSUA 2YW9A 4NJMA 4PG5A 3RC7A 2NTVA 3Q11A 4CLHA 3NGXA 2JJYA 1PQWA 2D1YA 3AOEC 4DYDA 3FWZA 1NWCA 3IAHA 3JD1A 3ST7A 3OJ0A 4AICA 4BIIA 2CVQA 3PK0A 1OOEA 4K28A 3FBTA 2P9CA 4DQUA 4E13A 3GDGA 3PI7A 5F5NA 4K1LA 1IZ0A 1S7CA 4JBHA 4UVGA 3R6DA 4UEOA 3WYBA 1QG6A 4Q3AA 4BV8A 5I8ZA 2O7SA 1P3DA 1R12A 2YQ4A 4MKXA 4BNFA 3JQ9C 3KSUA 5A3VA 2EWMA 1CQIA 1YQDA 4YR9A 1PS8A 1YO6A 4ZQHA 4IPTA 2EW2A 2DUUA 5FFFA 4D3FA 4FJ0A 5FF9A 4BOYA 2W2KA 2J6IA 3KUXA 5L9AA 1KC1A 4JIGA 4HWKA 3CMMA 2B4QA 4N7RA 4RPJA 3GGPA 2X58A 4ZJUA 1UXKA 4RPKA 3QVTA 4BNTA 4MIYA 3F47A 3CH6A 4XR9A 2OMEA 1T2CA 3QLJA 3QVXA 1DJQA 1JW9B 4XD2A 5KJEA 4I5DA 3WJ7A 3QP9A 1EBUA 3ZWXA 4GX1A 4WPGA 2GZ3A 4YAIA 4CM8B 5A1TA 4CV2A 1HYEA 3B1KA 4CMEC 2VYNA 2G17A 1U7HA 4PLGA 1Q0HA 3AUAA 1DC3A 5A3JA 1YQGA 4CLRA 3TQHA 3EW7A 4J0EA 2VNSA 3GHYA 1D7OA 2X86A 4XQGA 3JV7A 2FR8A 1K3TA 1XG5A 3HE3A 1UZLA 4XDYA 4D3DA 5IDWA 4EW6A 4PN3A 5JDIA 1ZK1A 3ROQA 1BXGA 1E7WA 3INRA 4AJ4A 4RCVA 2CSUA 2IZZA 3I9JA 3N74A 1VRWA 5JXWA 1M6HA 2HMSA 4KP7A 5DBIA 1KVQA 4BO9A 4DMMA 3IDSA 4Y98A 4OMUA 3DONA 2DTDA 1R66A 4IIUA 3RAJA 3I23A 5A9TA 1RYDA 4J90A 4RLHA 4D46A 5K6AA 1CDOA 2WMDA 3GY0A 3S2IA 1HSZA 2P9GA 3BMNA 1QYVA 1P1RA 4MIOA 5IF3A 2GDZA 1O5IA 3MTJA 4BO0A 5F3RA 1HT0A 3VOSA 4D43A 3X2EA 1LDYA 2OZPA 5I8WA 3GDOA 1KOLA 4M1QA 1I2CA 2ZB7A 1OAAA 3INTA 4WEQA 1IHYA 1ORRA 2NADA 5A03A 4D45A 4CR6A 1NM5A 2E82A 4P4NA 1N7HA 4RGBA 1O8CA 3A06A 3ZV4A 4UVIA 1E7QA 4WEOA 4IXWA 1JN0A 3PWKA 2JFHA 1VI2A 1ID1A 3C8MA 3GFGA 2EW8A 1B3RA 3IQDB 4FGSA 3RBVA 5B4UA 5CPBA 1DLJA 2DTXA 4Z0TA 5JCJD 4TZKA 5JY1A 2BELA 1HF3A 4MJLA 4Y6RA 3OIDA 2R00C 1HLPA 4LCJA 4S1VA 2XXBA 1W8DA 4BNMA 2YZ7A 4BGVA 4UEKA 2Q46A 2J3HA 1GUFA 4MINA 3Q9UA 1LTHR 1E7YA 1UZNA 1KERA 1V8BA 5JAQA 1PJBA 3BA1A 3FPCA 2V65A 4NJMB 2YJZA 1ISFA 2NVUB 3B20A 1NFFA 3ENKA 3PPIA 3PGJA 4J1TA 1XU7A 2Y1DA 4GLLA 2XXJA 3UOGA 3KOUA 4DGSA 3AY6A 3GUYA 1U2GA 2X4GA 3IUPA 4HV4A 3ZU5A 4MPDA 5TT1A 1C0PA 1A7AA 1X14A 2B0JA 2XAAA 5B4VA 3TWOA 2NU6A 5IZ4A 1GTMA 2FZWA 3ZHYA 1YOVB 1GD1O 2AQHA 4NPCA 2VWHA 4BQRA 2Z1MA 5F1PA 3RUHA 3ICPA 4YT2A 4WECA 3ZNOA 5JFOA 1F17A 4NFYA 4H7PA 1JVSA 4U7WA 2Z95A 1WMBA 4HFRA 4J6FA 1R37A 4GBJA 4YDRA 5DCWA 1GZ4A 3ROPA 4U6SA 1X1EA 2Y93A 4G65A 2X0JA 1K5HA 4RVHA 1VC2A 2D59A 1YJQA 2W2KB 1KETA 3LDHA 3GN1A 3IL2A 2C7GA 4BO3A 4KOAA 3MJVA 3ZHBA 1LA2A 2B37A 5BR7A 2FOIA 3E9MA 1O94A 2PTGA 3D7LA 1XYGA 1H0KA 5BNFA 4XZ3A 2ZTUA 3QVWA 3KSZO 4E5MA 1E1LA 4OXYA 5TRTA 3HDQA 1BGVA 2VHWA 1F0YA 4JP2A 2Q50A 4MOWA 2Y67A 4NBTA 2HMUA 3IS3A 2C2YA 3B70A 4YAEA 2HDHA 2IZ1A 2QG4A 5JDIC 4IDCA 2DPHA 5IDQA 3DBHA 3O03A 1ZEMA 2D0IA 3G49A 3LC1O 3S1LA 4F45A 5B4TA 5HWSA 5KTKA 3C1TA 1IE3A 4YAJA 4FFOA 2NVBA 4LK3A 2WTBA 3EAGA 3EUWA 4JCOA 1BXGB 5JO0A 2POQX 3SBOA 4CQLA 5K6AC 2C82A 3MJEA 3SC4A 4BNLA 4FB5A 3LQFA 4R5HA 5I7VA 2FP4A 4KDFA 3T4EA 1JKIA 5U1PA 4FPXA 1DSSG 3AM5A 3VH2A 5J23A 3ORFA 3RC9A 3W8FA 4RZHA 4YB8A 4MP6A 9LDBA 3I6QA 1P0FA 1Q1NA 4BNVA 3Q1LA 3QJ5A 4J1SA 3RUDA 3FR8A 4E30A 1Q7CA 3GRPA 2P9EA 8LDHA 4AFNA 1LDEA 3BMNB 2GN8A 3WIEA 3P5SA 2NV6A 3AU9A 2PV7A 3HB4X 4XB1A 5TC4A 1YXMA 3G1UA 4YA6A 1E5LA 1PGPA 1BW9B 1EEHA 1X0VA 3UCXA 3TFOA 1P1KA 3DZJA 3RUEA 2VT3A 4J2OA 2QZZA 4BO2A 3GZNB 3UAGA 2HK8A 5ILOA 4RL6A 1UXGA 3U4DA 4J7XA 2UUOA 4J4BA 4OQYA 2V6BA 4BS9A 3ZWVA 5GZ6A 3GVIA 4ZRNA 4I08A 5KVSA 3DHYA 1LSOA 4JGBA 2C54A 4CR8A 3PQDA 4DTIA 1TT7A 2NLOA 1IHXA 3BMQA 1T25A 1TEHA 4EUHA 1S6YA 2J5KA 3EVNA 5DBFA 2CFCA 1CJCA 1UZMA 2GYYA 1QSGA 1M76A 2A4KA 1G6KA 1VSUA 3KYCB 3K9QO 3JQAD 2QYTA 4AJ1A 1UDCA 4NIMA 1WW8A 2DM6A 2JFFA 3JQDA 1H2BA 1B26A 4GI2A 5BSHA 3H5RA 3F5SA 4NBVA 1MV8A 5TNXA 1LJ8A 3Q3CA 1N92A 3GGOA 1DAPA 1R4NA 1XLTA 1DFGA 3OJLA 4XKJA 1QORA 1I3LA 3AK4A 1OC2A 1YQXA 3DZGA 3LC2O 4BB6A 3PVZA 4MVJG 2ZTLA 3WNQA 2O23A 3PYLA 3DZKA 1BTOA 3M2PA 4I9NA 1DIBA 4IIVA 3DMTA 3D4PA 3DBRB 1HETA 5TT0A 1E3WA 4IDGA 2Q1UA 2ZQYA 3FNHA 1DO8A 4R1UA 2ZYGA 1MUUA 1R16A 2ZYDA 2HMWA 2WD7A 3S2EA 3NGLA 3IMFA 4EDFA 2YHIA 4KWHA 4PRKA 2AQ8A 1MA0A 3KYBA 1N1EA 5FYDA 4BNKA 4YAKA 3AI3A 3JQGA 3V8BA 5EINA 4GGOA 4DREA 1ISIA 3ZI0A 4NU6A 2VHZA 5JE8A 1P9LA 2GSDA 4I5FA 4M55A 2C29D 2Q1TA 4NBUA 1KEVA 2HQ1A 2YV1A 2CMDA 4R01A 1HKUA 1NHWA 1P1FA 4YXFA 5KCZA 1UXJA 3HDHA 4LW8A 1QYXA 4DIFA 1NQOA 4BUCA 1ZVMA 4AJKA 2AA3A 1SC6A 1T1RA 3NT4A 2VUUA 1EUZA 4L73A 3WDSA 1J4AA 3P7MA 3FN4A 2EP7A 3BXXA 3PJEA 4RV9A 4WLOA 1M75A 1LDMA 1PSDA 2AEMA 1D1SA 1QYWA 1GV0A 4R4JA 2FR0A 2W98A 3GAFA 2W4QA 4FFRA 3UN1A 1B3BA 4I8XA 1QV6A 3S2GA 4CV0A 2VT2A 3W4JA 4FD3A 3NEPX 2X0NA 4RDIA 1YWGO 2HMVA 3JQFA 2O3UA 3G3EA 5JSFA 1U5AA 2Y1OA 5H83A 4YJGA 4CLXA 1HDRA 2CZCA 4CUKA 1HZZA 7ADHA 3L4SO 2JKVA 1JU9A 4JN6B 2PZLA 1JLLA 4PG4A 4R9SA 1WPQA 4IXTA 5IDYA 2LDBA 2XOXA 2PK3A 1Q7GA 2RHCA 3WSWA 4OM8A 3ASUA 4BKUA 4CMJA 1Y5RA 3H4VA 1IYZA 1O95A 3H3JA 4S3MA 2IDZA 2E48A 6ADHA 5G4KB 2O2SA 3QIVA 5T8KA 3VZSA 1KY4A 4HY3A 5TGDA 2IYPA 1HDCA 4YEDA 3I6IA 1BDMA 4PGFA 4WCFA 1XDWA 1R0KA 2D5CA 4J0FA 4MVJM 5G0WA 2CNBA 5JCXA 3AFMA 3C1AA 4ZHSA 1RKXA 1YBMA 4R1SA 3DAPA 3HG7A 2WE8A 2EXXA 5CEFA 3JD3A 3WWYA 4E4YA 5EMHA 3M1LA 3DHEA 3UW3A 4ALJA 4PVDA 1MXHA 3F1KA 3OIFA 4FJ2A 1ZMTA 3LT0A 5A04A 3ADOA 3TRIA 2X22A 4FC6A 1B7GO 3ZWYA 2B5WA 3G1TA 2JCXA 4EJ0A 3ETDA 2VNAA 3DMTC 5CDGA 1TVEA 3NV9A 1YL5A 5JO9A 3KM0A 3B6ZA 1ENOA 1P44A 1BVUA 2I76A 1G0OA 1MFPA 3AOEA 2RH8A 4AJOA 3PHJA 4MP3A 1NASA 2EV9A 3WQRA 5KJCA 1H9AA 3RI3A 2IRWA 3JTMA 1Z45A 4WASA 3TOXA 4A03A 4HBGA 2G5CA 3E9NA 4LMPA 4NI5A 4O0LA 1KBZA 4J7CA 4AJLA 1GPDG 4HADA 5CG1A 4GGPA 2VZ0A 4OHUA 5GZ1A 4WGGA 1M2WA 2ZCUA 1C1DA 4JROA 3WQQA 3Q2IA 4MVJD 4R68A 3PTZA 2DFVA 3QQPA 1F06A 3DBLA 4J3FA 1A27A 3IUSA 2YHIB 4P22A 3RQSA 4DQXA 2DT5A 3ZWAA 4ND2A 3MCVA 2UV8A 3ZWOA 3G0OA 4PFJA 1E3LA 4YCAA 1I24A 4ZQBA 4I9HA 1CRWG 3FD8A 4O1MA 4OQZA 4DLAA 3GNQA 4DC0A 3V2UA 3H9QA 1ZUD1 2TMGA 1FDVA 3DZHA 2AXQA 5CG2A 2AHRA 5ENDA 1UP4A 1UR5A 4FCCA 4JBGA 5DNAA 1FF9A 5B37A 4I9UA 2HRBA 1DRUA 2ILTA 4J43A 4RF4A 5EN4A 1FDTA 1EZ4A 4E32A 3H9GA 4BO6A 3VZRA 1LU9A 5DULA 2PZJA 1UJMA 2B35A 1RM4A 3CUKA 3DOJA 4CMEA 2DBZA 4B7CA 2CF5A 3KYDA 1I36A 1R4MA 4DIOA 1VKOA 3F9IA 1ZEJA 2QRKA 5TJHA 3GAZA 1MG5A 4ILKA 3DQPA 4CM9D 1ISGA 3F4BA 1PJLA 4JQCA 1R0SA 4J9UE 5KOIA 1WMAA 4ZQEA 5CEEA 5L7YA 1XKQA 2CVOA 4U0JA 2H6EA 1YB1A 5AQ1A 4ZRMA 3JCZA 4JLWA 1KIFA 5C5IA 1J6UA 3AM3A 3P19A 3GNTA 1ZK2A 3R3JA 4TROA 4BB5A 4XIYA 4E0BA 1B8VA 3CTMA 1X7GA 2YFQA 4WCFC 1Z74A 2Y1EA 3HSKA 2GLXA 4C4OA 2JD1A 4BMNA 3ZWNA 4IM7A 3WMXA 3KHUA 4B3IA 4N18A 4TKLA 4GH5A 4MVJP 3NYWA 3H9JA 6LDHA 4CV1A 1DHTA 4FFMA 3HDYA 1DFHA 2ZB4A 3GVCA 2UUPA 3UICA 1SMKA 7MDHA 1EUDA 4L4SA 1LLUA 5CHEA 1A72A 4TMFA 1BXZA 4BNIA 5AXCA 1EUCA 3OF2A 3GEDA 4B8ZA 2F1KA 5KKAA 2VYND 1ZJZA 3EK2A 3KVOA 1PZFA 4IDAA 3WNVA 3H65A 4BVAA 2QRJA 2X5KO 2OBYA 4RF2A 4UUMA 2NTJA 4GL4A 3VPGA 5A06A 1DAOA 4IBOA 4ONEA 3MEQA 2Q1WA 4B4WA 3H5NA 2CDBA 4FOOA 4BGIA 2C5EA 4RPLA 2CD9A 2R00A 4XB2A 1DPGA 4PLVA 3JSAA 2H1SA 5F5LA 4XYGA 3GG9A 1YE3A 2W2LD 5LCXA 2QYSA 2VRBA 1ZIDA 1GADO 1RJWA 1C0LA 4MVJE 2IXAA 2ZYAA 4RVFA 1DC4A 4BKOA 4CM9A 3OICA 4QT0A 3OIGA 5JDCC 5BSEA 3PYMA 2YV3A 4G81A 1ISJA 1GZ6A 4FFLA 3PJGA 3V2GA 3MWEB 5L4LA 2PH5A 3HQ4O 3E18A 5ICMA 5T67A 2Y1FA 1N9GA 3EZLA 4UVDA 1HTBA 4W7HA 4DIBA 3EC7A 3W6ZA 3ZZNA 3KBOA 3ZN2A 3UCEA 3OBBA 1ISMA 5EIOA 1H93A 1I3MA 5FI3A 1C1DB 5BQFA 5DP1A 3BMOB 5U9CA 4EGFA 2BH9A 2W90A 5DBGA 3DBLB 2E4AA 1P0CA 4R5MA 3WGHA 1GPJA 4M86A 1M6WA 3C3XA 3PZRA 4KUEA 1SPXA 1ZNQO 1EK5A 4UVEA 1I2ZA 4MKRA 4EEZA 2D4AA 4JX8A 5HM8A 4M8SA 2NWQA 3BTVA 5LDHA 1LRJA 4HFMA 5CDSA 4NK4A 1V3UA 2WWRA 4CMIA 3ZV5A 2Y05A 2FY8A 3I9LA 3K8ZA 4QSMA 1ARZA 3LU1A 2BD0A 3N7UA 3E48A 1D1TA 5TLSA 3P2YA 2YHUA 1LDNA 3JQCA 4XR4A 4A0SA 3L9XA 3JYPA 3D3EA 1DB3A 4OXKA 1UAGA 3ZCXA 4N5LA 4DQVA 2V7PA
chains in the Genus database with same CATH superfamily
1V8DA 2H18A 3KDPA 2P2NA 3GGJA 3QWBA 3VQTA 1N2OA 3FLMA 3EIXA 4QELA 4MV7A 4ZOLB 4BL5A 2CY0A 4I1UA 1AUPA 1KXZA 1GAEO 4KYIB 4RZXA 2IITA 1HT2E 3J7TA 1WL8A 2V7GA 3P4XA 4DMHA 1AV7A 2JEZA 5K4GA 2WTMA 1Z56C 3C1OA 2Q9UA 3PZBA 4CMBA 4H6PA 4JR0A 4PZZA 1Z2PX 1P39A 2ZJ6A 4P8RA 3S55A 2P5YA 5SV2A 3H83A 4EY3A 4ENTA 3C85A 1H4TA 4G8BA 1TMOA 5LD2C 4RX1A 5ED0A 3HBMA 2BZ1A 4PS0A 4UNQA 4DA9A 5MDHA 2HA7A 1K6IA 4IIFA 1V37A 2DWOA 5AKYA 1JA1A 2R8PA 3KWFA 4G1VA 3DE3X 4LI3X 3EEQA 2YFHA 2DHRA 4J0HA 4FOSA 1HTWA 1XCPA 2XKKA 3CVVA 3ILSA 2WJIA 4BX0A 4G0VA 2XCSB 1XPUA 1Y7IA 2A2ZA 4FFBB 4FNMA 4GOKA 3CLSC 5ALVA 2WUVA 4P98A 5K0JA 1AXGA 1UEXC 5DJ5A 3VH4A 1FCJA 3ABQB 5KX5B 2Y6UA 3NBYC 3CF0A 5JSQA 4CG0A 3LQRA 3KOMA 2RGDA 3DMNA 1BDBA 2HJGA 3FDIA 2BCJQ 4HLUC 3S68A 1Q91A 4N3BA 2LIPA 3T1VA 1PZGA 1O94D 1EBFA 1HXHA 1MQ9A 2PNFA 3LF2A 5GIPE 3KB8A 2EP8A 4O8CA 2G0AA 3N7TA 3D7SA 2VHCA 1UJBA 1B6TA 1T5HX 2AJTA 3GJ8A 4FYIA 6ABPA 3RVKA 1MGPA 5IKMA 1LVUA 4FEEA 5LYYA 3E5RA 1JSCA 1H9BA 3B9PA 3H7AA 4H15A 3DEYX 4KR6A 4C7OB 2B7BA 1DADA 1NOJA 1DOHA 2KBEA 3HFJA 5B36A 3ZL9A 1AQIA 1T5DX 1HE3A 2DLNA 2ZR7A 3MB5A 1A5AB 1SG6A 2HRQA 4LVNA 5AM4A 5EUQB 5CDUA 4RTJA 2C7PA 2IOFK 1D2GA 4OFZA 3V8NA 1EAYA 5P8WA 1Z6AA 5KKCA 1T5BA 2BI8A 4HYTA 3EG9A 4X6XA 4ZEWA 2P79A 2P7HA 1GGHA 2WHXA 2XMRA 2CWDA 2JIDA 3HYSA 5FBKA 3W7VA 3IQXA 1HYBA 3HRKA 1DKQA 3KPUA 3OJFA 3OPYI 4HRYA 4MKIA 5DCWA 5HK9A 1RQLA 4E2WA 2NSLA 2BWJA 4E7PA 2Q3MA 2EATA 3K4HA 5ULLA 1PZEA 2OAGA 4QOJA 3WIDA 5JR3A 3M4NA 3VTKA 1VXOA 2XB9A 3ND5A 5DT2A 3O8BA 2FPWA 2I1VB 2NVOA 4WX2B 5LXTB 3EPJA 2NN3C 3C6KA 1XPOA 3D5TA 1KYVA 1Q0LA 2V6GA 4J76A 1VHDA 4D0GA 2AXPA 3FYDA 4L9WA 1KMNA 3MJRA 1V4NA 3DYBA 1VKJA 3W3AH 1LI7A 3IBGA 1YQ9A 5KOHA 3FTFA 1QRSA 4KHPB 4CUJA 1ZUNB 2WABA 1CQXA 3DHNA 2H1WA 1QGAA 3OHPA 2D1RA 2XPCA 4I7EA 3MS2A 3ILXA 3LYLA 1I3NA 4R1NA 3PFBA 1VHJA 1SZJG 1YDMA 3LH5A 1QQ6A 1CQIB 1Z28A 1U9JA 3LW7A 2RHMA 3FPLA 4P7GA 3H97A 4WXHA 3GRZA 1E3DA 2OOKA 2RGNC 4ZU1X 1V7ZA 3HO8A 1KPIA 3LL7A 1QK4A 3Q72A 5F2NA 5EWMB 3KAQA 1SVUA 1VTKA 3P2JA 1BD3A 4HYYA 1TYCA 1GITA 5IJXA 3T7EA 3VDNB 4PX5A 4TM8A 3G13A 4P0PB 2WYVA 4IQGA 4EHJA 5BV2P 2MT9A 2Q4BA 5EPOA 3RQIA 2BRUC 4ACAA 5CXQA 4ESOA 4JYPA 5DLDA 4RLFA 3WRYA 3PQ4A 4J4TA 2OHXA 3K73O 3KQUA 4EA8A 4EK9A 4ZEOA 3ROGA 4B76A 4WLFA 1EKXA 3AR6A 3UC9A 2PYIA 3GVHA 1ISSA 5IJ0A 4O2AA 4ZCTA 3KDSE 3DE7X 3TOCA 3TQTA 4YV2A 4ZYUA 5LQCA 2QMOA 5F7OA 1HORA 2RKBA 2EJTA 1GPKA 1P7YA 1VQ1A 3UWSA 1FB5A 3CT4A 3WJAA 3DEIA 1WDKA 1NL3A 3K9LA 2WWGA 5HIKA 4OA8A 1SHTX 3M4ZA 2F9MA 3A8TA 1KJNA 1G9TA 3KELA 3AF2A 2J33A 4LDPA 2BMFA 4HH0A 3N28A 2QM8A 1E9EA 2JJ1D 2YRFA 4GI7A 1JH8A 2J6BA 4LDAA 5AXBA 5H16A 4C0QC 4CFYA 4G86A 1EM8A 2BGUA 1NU8A 1KJZA 2X5OA 3PA6A 1PNTA 2V0NA 3PPWA 3QY0A 4ZOLF 3TRDA 4JYAB 4DG8A 3HKDB 1USVA 4P4GA 5ALRA 4A7PA 5K6TA 1JPVA 2V8OA 4FMPA 3QSGA 1L5ZA 2HV8A 3ELYA 4IIJA 3RPEA 1QQBA 4JXZA 1YONA 2D3TA 2JJ2A 1IY1A 4Q1FA 4BQEA 4XWTA 1CERA 1OXKB 3G8AA 3SAJA 4OSOA 1KDTA 5FULA 2EEPA 4OBXA 3BGIA 2H2WA 1QGUA 1EQ2A 2LBPA 1DRVA 3RK0A 1IK4A 3RYFB 3QWFA 2ZRJA 1OLSB 2PKQP 3LZDA 2OSBA 2OP1A 2OZVA 4YFVA 3CX7A 1XQVA 4HWTA 4CM6A 4KR3A 3CJRA 2P6PA 5I7WA 2QTAA 5HQ3A 4X94A 4KQ2A 3BREA 3VU9A 4KQ6A 3LCRA 1SCUA 2M6LA 4E88A 1KZGB 3FNFA 4NS1A 5AVSA 4MP8A 4IOMA 4CMAA 1RAAA 2GJAA 4TTVA 4M1TA 1G5TA 4M49A 1TIKA 3ETEA 3ZNPA 2ZJ1A 1S3IA 1XZFA 2GB4A 4ESHA 5DDIP 5KX5F 1EIWA 5J2TF 1J39A 1RT9A 2HLHA 4MVJF 2BUAA 1EMDA 5L4SA 3HTXA 1L0BA 2CXSA 2QR5A 2QXTA 3L1HA 5AXAA 4BAGA 1Q1QA 3ICCA 3RU7A 2X13A 4K6HA 4D25A 1RJEA 4R84A 4XDHA 4N49A 5IS2A 2A9OA 3NS7A 2G0NA 4PG6A 3S29A 3U1VA 2VPPA 421PA 1JR6A 1TQHA 1QHFA 3LRTA 5BWMA 2J1LA 3JWEA 1ZD2P 3FRHA 2ID8A 4G07A 3TDNA 2O8EB 3L1UA 3I5MA 4B6SA 1QRDA 3IH5A 1RVDA 1VSVA 2K5UA 4G8DA 1AO0A 3BB3A 1U0EA 3L8ZA 3STXA 3MELA 4MAFA 4BHTA 3GJ7A 4HXGA 3FTEA 3GUZA 1F2DA 2FUG6 4O4LB 4CL8A 4JCCA 4MQEA 2JI4A 3NFYA 3IE1A 4B7XA 1SZCA 1Z2OX 2WILA 3KTDA 4TOIA 1BCRB 3IP6A 1AGNA 4Y2XA 1OASA 4IY1A 5DMHA 2WNIA 3WFZA 1RZRA 1G5HA 3P2OA 2PZKA 3TQFA 3OPXA 2FW9A 4IEIA 3ZLTA 3GZTB 5LXTF 4ASUA 5FOQA 3QE4A 1U1CA 2UVDA 3GLHA 1EQUA 2JIZA 3QUBA 4IZIA 4W6ZA 3JWHA 4XYMA 3TM5A 2BFPA 2PIAA 5NULA 3O4GA 4AG5A 5KJ6A 4UUPA 4DNPA 1PGQA 4TTTS 1JAYA 2EFDB 2G8NA 2NU6B 4OLHA 4AECA 3TH5A 3VV3A 1IXSB 5C8YB 1VPVA 2X1HA 5DLEA 5ADUS 3EB9A 1B8PA 3G2HA 2Q29A 4TTAA 1E5VA 1MT3A 1CZRA 5FPTA 2Z98A 3M8KA 1GQQA 3RTBA 3V7UA 1COWA 3WSTA 4DY4A 4BX3A 1XTIA 1XEXB 3IIEA 4YAGA 1PW5A 2ZWIA 1IG3A 3AFHA 3RCBA 2Y0DA 2H2HA 3EUAA 3MJCA 3QFRA 5EWJA 5EA2A 2A5DA 3W5HA 4NE2A 4EPVA 2NP7A 1YE8A 4P34A 3K2IA 4BEBA 4MW2A 1VL1A 1BE8A 5DMXA 5CA0B 4GZ6A 1UPBA 3KKLA 1DBRA 1MB9A 3WRVA 3PHGA 3SJCA 5FL3A 2QEQA 3P1JA 1MRSA 1YD7A 3TTUA 3VU1A 1U0RA 2QVCA 5TS3A 4RTKA 1JZSA 3QYPA 7GPBA 2OV6A 4UU8A 1YZLA 2OGTA 1SJ9A 1ZRHA 2WUEA 5FLYA 5FP0A 5BNTA 3EA5A 2C8VA 1OXBB 2UDPA 4MICA 5SYNA 8ADHA 4OKIA 4EEXA 3LNCA 5A3SA 2KHZA 1E2MA 4JXKA 3O0DA 2FSIA 2OECA 1N0IA 1FSSA 4CRWB 2AFIE 3FSJX 3KZCA 3NETA 4JSRA 2ONJA 1U0OC 5K01A 3ZWPA 2GFIA 3O8OA 1D6NA 1Y6QA 5G0SA 4HP8A 4HPJB 4CNQA 1X1QA 3UG7A 1FFGA 2PTHA 4LNUB 4R3NA 2DP4E 1RAEA 2I6UA 2XUJA 4ID9A 1PJCA 4CVNA 2WU0A 2XTAA 4UDNA 4EPWA 3ORRA 4II3A 3UOWA 2XXAA 2R3SA 3KB2A 5C9ZA 2ICAA 2QGZA 3GMDA 1A7KA 5LB2A 1ZDMA 1XU4A 3K4PA 2AQKA 4RZ3A 3S5JA 3WL4A 4A6DA 4ADSG 5AD1A 2BGMA 2ZSBA 3G02A 5EJIA 1M8KA 4CQLB 2UUCB 1QQ5A 3U44B 4REQB 3ZIUA 2BSAA 2IXTA 1EM6A 5LUBA 4QUJA 3CSUA 4B79A 1GDHA 2IE8A 2JFGA 5JCOC 3JVEA 3AKZA 1M5TA 4DJAA 1R6UA 3I0MA 1Y6RA 2WT8A 5FXMA 4G84A 5K0EA 4YFYA 4ND8B 4C1NA 5AESA 3R5SA 1JDTA 4JLBA 3ZHTA 4EPTA 2HLDA 3BXOA 3CLKA 1XDBA 2CJXA 2D2IA 4IIDA 4Y30A 1X7YB 3AJ8A 5JWOA 1MW8X 1VL5A 3KLNA 4UM8B 1RAHA 2GN2A 1XKTA 4MJ3A 3WZLA 2P0EA 4F84A 2MR6A 4P3YA 3KE8A 1WP4A 1E66A 1IXKA 1DWUA 3NTRA 3OTHA 4S35A 4AS2A 4BVHA 4PWZA 4CQMA 2HSGA 1ZH6A 5CT5A 2JDID 3C6XA 1DBSA 4OGFA 2DR2A 1DX9A 1LPBB 1VJ0A 2P30A 3GFSA 4AX8A 5I4BA 4KAAA 3I1YA 1N3BA 2BTOA 4UFOA 3C3YA 2QLNA 3HKCB 3QEAZ 5LR6A 5LZ8A 1IBMB 3DL2A 1L7MA 3TOVA 2REXB 2J30A 3H99A 2IPOA 2VG8A 3DT9A 4ML3A 3RASA 3ROMA 2VUTA 5IH7A 5JSUA 4YDQA 1I14A 4A23A 3B1VA 3KEOA 3PD7A 3HK2A 4WFJA 2OLKA 3M0EA 2PUEA 1EVQA 4Y9UA 2V7UA 4YT4A 1X7WB 2QRGA 1I0LA 1Q44A 3IA2A 1OH6A 3UK1A 1H94A 2GBGA 3VISA 2I7XA 2O9JA 2ZS8A 1H5QA 2VDLB 1PZHA 3L06A 4HX5A 4BTLA 5L3VA 5B1SA 1ZVQA 3ONNA 4GLJA 2RAPA 3BMQB 3R5FA 4G0OA 4K87A 3DS8A 4KRYA 3GRFA 1QFMA 1QB7A 1OZHA 1JXAA 1J8DA 2VOJA 3RFFA 1M1XB 4N7MA 1OWNA 3CPSA 5J63A 5M7EA 3I9KA 5G3YA 3KOZA 3IOBA 2G04A 2OZLB 4PC1A 2JL1A 4R83A 4LZAA 1YS9A 1A5BB 2X6QA 2ZR0A 3T4XA 1Z2AA 2IYRA 5GOTA 4XX0A 3QTTA 2PGNA 1W4LA 3VJLA 1CUDA 4ZDIA 1R4NB 3U5TA 1K8RA 1KK0A 2BEJA 2IEDA 2AFIB 4KMRA 4QEKA 4IRXA 2VQFB 3A3NA 1ZN8A 2DKOA 4PRLA 5C8YF 5B7QA 2XE4A 1TQ8A 2H9AA 2OHIA 2UZ1A 2HA3A 7REQB 4I1PA 2Z2IA 1YA6A 2DUNA 4TRMA 5D7NA 2Q62A 2VQDA 1N2EA 2H52A 2ZDHA 3A27A 3DV2A 1EI9A 2FW6A 4ZT7A 5E4JA 3K5PA 4RH1A 2Q0HA 4INJA 2UUAB 4EMTA 1DFIA 1SEPA 1X7XA 4LF9B 1VM6A 1OAOA 3FNRA 3BOSA 1P29A 3RNLA 4TYPA 1HEUA 3BRCA 4KE8A 4DNXA 2P3SA 3U60B 3NHRA 3QXSA 5ILGA 1UF9A 4F2PA 1J5XA 1JJIA 2F3UA 3EIFA 3TE6A 3WXBA 4XVUA 4B73A 4C2AA 3W9YA 1JJBA 3FNEA 2WD7B 1W88A 2FN7A 4BZZA 3ENQA 5CNIA 5BVHA 1UOPA 3E3LA 3A4MA 3I30X 2EG9A 2FPMA 1DRKA 1V11B 3VTAA 1NV8A 1B43A 1NI4B 2QN7A 4FFSA 2JAOA 4ZCMA 2VKTA 3PUXA 3BHIA 4M54A 5LA6A 1UQRA 1WBBA 4X54A 2ENWA 5GTDA 1B23P 1TJPB 3AETB 3D6JA 2IYTA 4G67A 2CEAA 1FEZA 3VTZA 4BNGA 3E22B 4KU4A 5COBA 1QNLA 2IYFA 3NYIA 4RA6A 4ZMRA 2X2FA 3E1SA 2XUKA 4RHYA 3QKIA 2X7HA 3OI7A 4L4XA 4EIWA 3RVDA 3NAZA 5JYDA 3S99A 2P2YA 3GZJA 1USIA 1ZUWA 2DPYA 2QP9X 5FI5A 5DOVA 1OD6A 2AOXA 4HRXA 1A82A 4E14A 1FA9A 4LF7B 2P5UA 2O2EA 1C3LA 1VSTA 3SJ7A 2YQZA 5LU8A 5AHRA 1P45A 2VHYA 1Z26A 3C5WP 2GCEA 2CK3A 2VTEA 4EF4A 2FDRA 3BJEA 1V26A 1T8RA 4O0MA 3K6JA 1GGJA 4UNPA 1L4BA 4U5QA 3VR6A 2O8DB 1G6OA 1QP8A 1N2BA 4F2HA 2GMWA 4BC1A 1C7ZA 1FTSA 3B8EA 5EP2A 3SC3A 2FLKA 3RYTC 2KLBA 4Q9IA 3MCAA 2O2JA 3JS5A 2O8BB 4Z4IA 3DZBA 3BH0A 4FLFA 4H0CA 3RRXA 2B8NA 3VBEA 4C20A 1O6ZA 2Q49A 3RFCA 4N76A 1UK9A 1R8SA 1A88A 2W2MA 4YJGB 1MB4A 5JCZA 4YJFA 1Z2DA 2CVHA 3CUVA 4E5UA 2QLFA 3F8TA 4POAA 4JFRA 5CFLA 3R3VA 4TRNA 5HS4A 3PWSA 1G9SA 2HQOA 3MNFA 4FYHA 4EI2A 1PKXA 3WWPA 1FVOA 4FB4A 3A04A 4FZ5A 4DYVA 3MK31 3RABA 4HHEA 1WV0A 4M99A 3HCBA 1CFZA 3IHWA 3I39X 1ZZEA 2AB0A 2H5IA 2DB3A 3C6ZA 3WA7A 1O0CA 1NJ6A 2A9RA 1BS9A 4P6VF 5KWIA 2CJWA 3NDRA 3DR3A 1XEAA 4HDOB 3RLIA 4C6HA 2NACA 1AXEA 5CFZA 3IKLA 5A7GA 3TAUA 2AUMA 4RADA 3S27A 2X6RA 5JISA 4D97A 4WCFB 3FZYA 4MR7B 5AKHA 2GRAA 2CUZA 1WXQA 4J6EA 3TECE 1O0BA 1OBFO 1QX3A 2HU2A 2OBNA 5H4GA 4BP1A 2YL2A 2XGSA 3X2FA 4FVTA 4YAOA 3AHHA 4BDTA 5KOJB 5HRUA 1NXOA 3QRWA 1JNYA 1VYUA 5KSYA 2C2OA 1NN1A 4KPFC 3AF4A 3Q8WA 3S2YA 2FQWA 1I4OA 3RRBA 3TZHA 1AHIA 1JA0A 2XHEA 3NTVA 3VX4A 3CH7A 3H7IA 4BFSA 2Q1XA 3DLIA 3OQPA 2BHRA 3ZHZA 3C7AA 1JBEA 1ODTC 2YMLA 4F5ZA 4JVMA 3P9YA 4NABA 5L53A 3GGCA 2FFBA 5JJIA 3WB9A 3OE7D 3D0OA 2D1SA 1GZ7A 3E3NA 3CS3A 4Q39A 5FUVA 2CZQA 3O92A 4WY2A 1OAOC 1T9AA 1U8ZA 3DGEC 2GCGA 2EWVA 1QKIA 1FDUA 4LY6A 4EQ6B 1QHYA 4U63A 4ZI7A 2VI5A 4EJ2A 5AOBA 2IY7A 3RV4A 3C16C 1C4WA 2YVKA 5BSMA 2YXEA 2NZVG 3EZ9A 3TIFA 2TECE 2I6TA 4WKGA 1U8FO 3AUFA 2NZ8A 4IVQA 3UWMA 5F98A 2PS0A 1KE1A 4KK4A 1K97A 1A7JA 2Q45A 2FWJA 2XX3A 3ID6C 2NU7A 4UBLA 3T15A 1CZNA 1IEXA 4TRRA 1LS1A 1GOTA 4MNTA 1FPMA 4RD6A 5F2EA 3O26A 3IDAA 4PC2A 3CV3A 3DZFA 4WHMA 4D3YA 4JENA 3C3PA 5EJ9A 4WESA 1H5UA 3PNQA 3CCCA 3UH1A 3UB4A 4MPPA 1E79A 5LQUA 5FKJA 2E89A 4LYGA 1EWVA 3ESAA 1PJSA 4M9CA 1N5DA 4CIWA 2HBQA 4GVPA 3A9UA 1K6JA 3IEMA 2WA1A 1TEVA 3I64A 2QJWA 4LBZA 2X0FA 4ERNA 1AKYA 1UZUA 3KQQA 3P52A 4Y9DA 5GM2A 2WSBA 3KG2A 1WZUA 4FILA 3FYUA 1L7AA 2C07A 2CFRA 5DM70 3DFZA 4OAOA 4YJHB 5FWDA 3DCNA 5AI8A 4F6LA 4X90A 1E1MA 2QUZA 5CURA 3UHJA 2OHOA 3DTYA 1KAMA 4OKSA 4QEDA 2DYKA 2YXBA 4U3JA 4XUEA 2AJBA 2PT5A 4COOA 4Z4QA 3GGGA 3SYLA 3C3KA 2BR3A 5DBHX 5LLSA 2PLRA 3IAAA 1OYYA 3IBFA 4A0RA 3D1LA 5L6LB 1C9KA 2XT0A 1JU3A 2GD2A 1Q1EA 2VJMA 1QMGA 2QR3A 3JX9A 4HQRA 4F5DA 4RHUA 1E2PA 1TRHA 1YL7A 4G5OA 3HB0A 2C4KA 4TXNA 1NUAA 4HNTA 1ESEA 1P1IA 3L6UA 1ZUHA 5TVKA 1NJFA 1NNUA 1C8BA 4I5EA 5C34B 5CDFE 4YCMA 4I1IA 2IW1A 4L22A 3U9TA 5DTEA 4A8TA 4PBSA 5A3QA 2I67A 4RXMA 2DPXA 3PUVA 1U02A 3GLFA 4XSVA 2XCOA 2BEUB 1Z73A 2XD4A 3GCDA 4NATA 1FNBA 1RM0A 4K6KA 3R41A 5DRYA 3DLBA 1RJGA 2A1UB 3B1JA 4MO2A 1HL7A 2ZSEA 4BE4A 4CL0A 5HKOA 1O5OA 1Y6FA 1JQAA 4FFVA 4EPRA 3DOUA 3OIUA 3P0IA 5EYPA 2BUCA 2MYNA 3DB2A 3ONWA 4HRAA 2H54A 3T06B 2YMQA 1X0XA 3TUJC 3RR2A 4EL0A 1QZUA 3MJSA 1R8XA 1EVIA 3MLAA 4N9WA 4BBPA 2BTEA 2BW0A 5AUPB 4Z3KA 1PL8A 5AH0A 1DT5A 2BISA 4JLKA 5IU6A 3OJWA 3EJ6A 1GILA 1VPEA 2AN3A 4O4JF 3SSOA 4LS3A 1IPFA 1WVGA 1WDWB 3QVGB 4RDCA 3C3CA 2QX9A 4B85A 1ZL2A 1YJBA 3QLUA 3WNDA 2HUNA 5I7HA 1C3VA 1GT91 3EHEA 3HVUA 4KRXA 5IJZA 2PMEA 1DBVO 4H9GA 3SI7A 2X9QA 4IDNA 3THYA 4LECA 5FJJA 4ALLA 2AFHA 3PNVA 1BDJA 1NBAA 4HFNA 3ZE0B 4QHTA 4DXHA 3EH2A 3W5VA 3GT0A 3VX3A 3RJ5A 2C0PA 1R0WA 3DAFA 2RE8A 3V97A 5AO9A 3ZIDA 1KFJB 2PMCA 5LLDA 4MCHA 4L8GA 2O50A 4W8GA 4WNYA 3R7LA 1XELA 5IKOA 3H8JA 1JJVA 2ERYA 3KUKA 1V7CA 3BEOA 3SSMA 3NG1A 3LKBA 5JH7F 1XRPA 2Q3BA 1PS0A 1SG0A 1RCUA 1N2JA 1SC9A 1LDGA 4QJBA 3HBLA 2H2AA 5DYGA 5TX7A 1NFQA 3LLUA 4LE1A 2EZTA 4V3CA 2C3UA 5JTTA 5JRDS 1HK7A 3ENZA 4GZLA 4V1CB 1FLVA 5JAMA 1G3IA 3UY4A 2BMWA 4QXRA 1ORDA 4R9RA 1RRCA 4L5AA 3HEAA 3CWZA 1E99A 2N1MA 4DSOA 3FWKA 4EMBA 4NDAA 5EIHA 4F6RB 5EWLB 4CV3A 2PXCA 1B6GA 1P18A 1X1TA 2Q3DA 2QXYA 3PXAA 1H3EA 2F1RA 1QR6A 3MUOA 3ZBPA 3ZZTA 3L7IA 3B3AA 3MQ4A 4PU0A 3G79A 3ZJ5A 1ST3A 1QHSA 3A9WA 3NV7A 3OUTA 3HV2A 5EXPA 1ZXXA 3TX6A 4C03A 2PLAA 5TXGA 3C43A 3DE1X 3KYCA 4G5HA 1GL3A 4DZTA 3BGOS 5KC8A 4NCAA 3CZCA 4CETA 1ULAA 5A7HA 3LMKA 4A8PA 2OILA 1NMXA 3PLRA 1YJ5A 4BMVA 2ET6A 2QQEA 3K15A 2QS9A 4FSDA 2VQ6A 1G8SA 2E55A 2XKAA 5EXXA 1Q16A 3TQQA 1E8NA 1NXQA 5DWVA 1M2GA 3BK7A 4PLHA 5F76A 3G2JA 4PLYA 5HCIA 1G42A 4UZEA 4YRJA 3HCFA 4NG5A 4WK6A 2I6XA 1LW7A 3RVJA 2RBKA 2V9PA 3UFXA 3SKXA 1RYYA 1Z0UA 2PU5A 1QHNA 4UCXA 1JQEA 1YVEI 3QEBZ 3PNOA 2XB8A 5J2UB 5CLFA 3VJRA 3QM1A 1JKXA 1U9ZA 1YBFA 2QM3A 1LWOA 1QPBA 3ZX4A 1YRLA 3K0FA 2ZVDA 1AUOA 3WV4A 1NMZA 3FF1A 3RANA 3E9ZA 1GTZA 1TJ3A 2ZWVA 3COSA 4A6XA 3E03A 2DAPA 1K92A 4QYTA 4NE7A 3U3ZA 2EJBA 2EBHX 2ZSAA 4EO7A 2P3QA 5ALSA 3R3SA 2R96A 2C92A 2OHHA 3VR5D 4ZZIA 3TXXA 3G0IA 3GO4A 5HE8A 4DDWA 1NZDA 5DN6D 2C2WA 2JD0A 4A26A 2WSSA 1XWWA 3MT8A 3RSFA 4FWTA 4OYRA 3T7CA 1RPZA 1QDUA 4FI3C 2F8TA 4Q9AA 1JIVA 2WKRA 4L6CA 2O2ZA 1NLZA 3GGDA 4D8UA 1CQJB 1D2RA 2YNMD 3BMXA 4QASA 5DCLA 3UJ9A 3DF7A 4GPIB 4BBZA 3A32A 1SA0B 1Z3IX 4DUZB 1YNSA 3EXIB 2QX8A 3GPIA 3P9NA 4X95A 3UWOA 4W5QA 4R0VA 5DHSA 4JV5B 1NX6A 3LVFO 1ZQ1A 1O4VA 3FHOA 1X86B 3A1TA 4O1HA 5BT9A 3RJMA 1T8TA 2GN6A 3INGA 2Q9AA 3CUYA 3KLMX 5JXJA 3WG9A 4UNSA 4E3ZA 3CRW1 3ZDQA 1XRNA 3IUBA 3AEUA 2QGNA 1PLJA 2XI4A 1NZJA 2HD4A 3K2EA 4RE5A 5E1MA 3UK7A 2J85A 4XDZA 3C3EA 1PLLA 1I0IA 3OJEA 1N2SA 1PVOA 1KEUA 5A9RA 3EGWA 1V8ZA 3OSZA 1HY3A 4DZRA 3L02A 3O4VA 3BHJA 3QLUC 2GERA 4D57A 4G26A 2YKGA 1C81A 3QZUA 4K05A 4ZODA 3H1PA 2XDYA 5EZQA 3JVDA 5C4IA 3V48A 2O20A 1FBTA 3F6RA 1H2HA 1DC5A 1E6WA 4JWKA 4MUBA 3BCHA 2FCRA 4UZSA 1RRMA 5DE3A 2JATA 1RLTA 1GR0A 3DOFA 3GLTA 1DKNA 1T1EA 4ARIA 3CPJB 4C0BA 4QQNA 1KVTA 3OCUA 1WF3A 2XD9A 1PN3A 4HEHA 4OK5A 3SG0A 3UUFA 4HUQA 4RQBA 3LM8A 1ZBQA 3SYTA 5IM4A 1IY9A 1FE8A 2XCQA 1O4WA 4LYDA 1YZHA 1XA0A 4FYWA 3WLHA 2YYYA 3FKQA 4O4IB 3MGCA 1PUJA 4Z0PA 5EJEA 1T6NA 5ER9A 2VTBB 1MJ5A 2I71A 1YF3A 1GG2A 3BMCA 4TTRA 4I36A 1A9ZA 1PFGA 2V59A 4G97A 3OJOA 4ENQA 2W6ZA 4KRGA 1L7QA 4QQFA 3QJGA 4NZNA 1Q0TA 1IC6A 3D4OA 1BJKA 3LHKA 4HDSA 5JBIA 3I72A 3CONA 1KAEA 3IP8A 1NRJB 3R23A 4W63A 3RT1A 3G9TA 3SHTA 1RTTA 2OAP1 3K5WA 2OBLA 1U7ZA 4FNOA 2XQJA 2I22A 2OUIA 3DUFA 5TF4A 5A7FA 2IPNA 5CVVA 1FLDA 1RU3A 2AKYA 5I9SA 3RRNA 3IJ5A 4UULA 4CI9A 2IZOA 2QRVA 2X9NA 121PA 2IDJA 2G9QA 1E1RD 3QXGA 3UOAB 3UANA 2XH8A 4TQGA 1CUUA 4D0SA 3ML1A 1GZ5A 5JY6A 1UBTS 2UYYA 1W4AA 4GPTA 2F2TA 3DEAA 4R7ZA 4KYTA 5AJVB 1DXHA 3K8QA 3MWLA 3VKVA 3BXFA 1S1CA 3EZXA 3RKRA 3DZCA 2E4ZA 2ES4A 1OV4A 2EJUA 1M8FA 3OEYA 3WTBA 4KDRA 4NMMA 1P8AA 3OIWA 2YY7A 5HRCA 1OH5A 3A2KA 3ZCPA 3DBVO 1ZJ4A 3OP4A 4KTTE 4MRMA 1LWNA 4AJJA 3TRKA 3TG8A 5JU6A 3N59A 3AVVA 2W8BA 4JLOA 4AC9A 4AROA 4Q66C 5TIIA 1JT2A 1JWBB 4HJRA 5JHHB 2RHJA 5LQJA 5J2UF 3AQ4A 3LO8A 5LM3A 4B43A 1I7DA 2I4IA 2BM8A 3P9PA 1C3EA 5ECYA 5B1EA 4DR6B 1Q95A 3UXMA 4MWTA 4LX0A 1O9HA 3TSAA 2XUHA 3ZIAD 2QOEA 5LWHA 1W7AA 5EVCA 5KQPA 5DEOA 3EOZA 3GJ6A 1O94C 1IATA 3GROA 4Y9TA 4IVNA 1AS3A 4MV4A 5FFMA 1NT4A 1N2CA 1VG8A 4DLZA 1GAXA 2R2GA 2N0SA 1JBKA 4Q9DA 5HMLA 4HVCA 4GNRA 4NBLA 1NP3A 2I1WA 4EW2A 1Z63A 3PXGA 3T3PB 3GEBA 4XCQA 1DELA 4WNCA 4I1OA 2J0VA 4E07A 1ZN2A 5DSZA 1VIYA 3HNRA 1WCXA 2FVXA 1T1IA 1QJ4A 1TPZA 1CNEA 3C5EA 2WK1A 4TTQA 1Q50A 4IUCS 3ADPA 1TCAA 3EVBA 3H2HA 1LV7A 2DFLA 1JXOA 1ORHA 1ONNA 1UKBA 4DLRA 5CCEA 3JYQA 3L9WA 1EEXB 1VE5A 1B74A 2I3AA 4PVCA 5LZ2A 2WYIA 2ZBVA 1TCCA 3G8DA 4IZOA 1HNNA 4UHEA 3U48A 5I4CA 4A73A 3GEGA 4CT0A 2P9BA 4PYKA 4CLOB 1CU1A 3KVRA 2D0PB 5D6OA 5DH9A 1BX3A 1HSOA 1KVRA 3I1FA 4KXFB 1J8VA 1W30A 4R31A 3CE6A 4J16A 2NU8A 5BVGA 1NF8A 2J9FA 1OLUA 3H2IA 4JC4A 4KW7A 1G5IA 3UHFA 1LLDA 1KJWA 1JA9A 1LPAB 2IPXA 3D1VA 2FEMA 1KE2A 1EXWA 1CVIA 1EFVA 1B0PA 1U2DA 4D42A 1BWQA 3PSHA 4LTNA 1R5NA 4DZZA 3B9RA 4U7JA 5JT1A 5JZOA 4KHZA 2P9HA 1J21A 4L0QA 4YNBA 3ZTWA 1RKUA 3U39A 4WMLA 4YR7A 4JR2A 1KDPA 4OYLA 2IGBA 1WKCA 3AI1A 3LV8A 3QE9Y 2EWWA 3FAZA 2L69A 5D2CA 1E92A 4BLRA 2AN1A 1I6WA 5FBHA 3FUTA 4ZZ1A 1QO0D 1IEWA 3CW9A 3NC4A 5EQFA 4NCIA 4QUBA 2PD3A 5BV7A 3TW8A 1CZKA 4WLUA 1NQAO 3AHJA 5K51A 2FJPA 1EFUA 3EQ7A 1CHDA 1N2ZA 2FH5B 2X19A 2A3RA 4BLOA 3KR2A 5C35A 4TLMB 3R76A 4V0NA 1PJZA 2ZIZA 3TSYA 5AVTA 2X3FA 4L8VA 3WY9A 3WQSB 1RIFA 4LZLA 2XWBF 3WVNA 1Z5OA 2VZLA 5JD3A 2CXQA 5CX1B 4PGGA 4ITRC 5TR9A 5AI5A 4MW4A 3C48A 4O2BF 5FL7A 3RFVA 3KQPA 4DMGA 1SBYA 1U5BB 2CNWD 5HFNA 5LPNA 2E87A 4QDTA 1QHXA 2AR0A 1OT3A 5AKEA 2RHDA 3T34A 3U17A 1VYHA 2PGXA 1EINA 2FMXA 2QTVB 2C1XA 3TTTA 1YZKA 4RJTA 3W2GA 3AOGA 5EIWA 5T7BA 4URVR 3OM8A 1Y7HA 1A9SA 2QSZA 2GZ1A 4HXFB 4OYYA 3WLQA 2X23A 1KBQA 1N9KA 5FLKA 4LRTB 3QOWA 4GOJA 1Q2XA 2H8KA 2IJGX 3D8RA 2ZB2A 4LYAA 2ZU0C 3WV5A 3KZKA 2ZITA 2JH9A 1TMYA 3HB1A 5J4KA 2RH4A 1G20A 1YVDA 2Z5FA 1RIIA 3AERB 1X7ZA 2RC6A 5E9AA 1N75A 4XCVA 5KU7A 4KQEA 2FFHA 3SLGA 5T64A 3U3KA 4KAJA 1UOOA 5FIUA 4BO8A 4MX8A 1MABB 1KR5A 3I3SR 2R7MA 3OURA 1NVUQ 1SVOA 4MJXA 1SB8A 3EVGA 2TYSB 3LXRA 3VPFA 3WYDA 3MJDA 1M73E 1N8SA 4FONA 3KHKA 1Z8HA 3ROKA 2QE6A 2WI8A 3WS7A 3WB1A 1II8B 3UMVA 1UWLA 4GMFA 3A4IA 3W8EA 2IBSA 1ZSYA 4C21A 3IR5A 1NWHA 1CNMA 3B82A 1XZMA 4JL6A 1KEEA 3VC7A 2V7BA 3N0WA 2WOOA 4UFPA 3WMRA 1IB6A 3KL2A 1S2OA 1G21A 1HWYA 1Z0SA 1DBPA 1QIIA 2JGKA 2MSWA 3QKRB 4DCSA 1GKIA 5AOAA 2O5RA 2C4NA 2FZ5A 1QGDA 3EDRA 2NTEA 3LK7A 1A69A 3O5AA 3VNBA 5AW0A 1TZKA 4FDUA 4R69A 3T9DA 3CZ9A 2YW2A 2NUTB 2E3JA 4YMVA 5KWEA 1GPBA 3PC8C 4L8WB 1K8YB 1Z34A 3R4CA 2HRCA 4GMXA 4YWJA 1RXEA 3KS9A 2GAAA 3LBAA 5DK4A 2VYVD 3IQZA 4TWRA 2R6R1 5TVGA 3UQZA 4MS4A 4CF7A 3HSSA 5PGMA 1J97A 4P31A 1S5PA 3A9TA 3RSOA 4UD2A 3U4AA 3FBGA 3EVTA 1GSIA 1EHIA 1MEEA 2GBFA 4FTWA 2FEXA 2PA0A 3L7BA 2WD9A 3V5NA 2DQSA 5CFPA 1OC4A 3PRKE 5K0ZA 2BCGY 2GI4A 3PRYA 4G5XA 3QPWA 4B48A 3QFHA 4BNZA 1HDZA 2EZ8A 1MB0A 3IJRA 3UF0A 1W93A 3UZUA 4LDRA 4RD1A 3FZQA 2F3TA 4DUGD 4B33A 4EJSC 4R3WA 2DGDA 3EULA 3O4JA 3OAAA 5I5EA 5BN1A 5HEKA 2PKRA 4MYRA 4JI6B 3HU5A 2RCYA 3L8EA 5EXEA 1EWQA 2C5LA 3V1TC 1X38A 2HCRA 5ALDA 2J4FA 3AEQB 4B3GA 3U6BA 2EBUA 2F59A 2O59A 1E3SA 3LL4A 1NONA 3A6FA 1W85A 1K7CA 1STOA 3FCXA 4RESA 2VHVA 3MAJA 3S4YA 4HAYA 1A2QA 4RZIA 1V16A 2Q6TA 2QM0A 3BJRA 3DG9A 3OETA 1C3OB 3JQAB 1AUXA 2FK8A 5COAA 5IPFA 1RYEA 1WZEA 4E12A 3ROZA 5CM2Z 2BM0A 4JP3A 4CTOA 1TC1A 2PVSA 3Q12A 2WFMA 3I01M 4PYMA 2R6AA 1WY5A 5JAHA 3O8QB 2B8EA 1U63A 3BCSA 2ECQA 1WDTA 2GGSA 2EFYA 3L0DA 2C3MA 1UPXA 3G0BA 3Q3VA 3A14A 4MR9A 4PNPA 1VL8A 1JYSA 3ANNA 2FJUA 4LNHA 3SPXA 5JAIA 2XE8A 4FBMA 5DTMA 4K1XA 2CNNA 3N3AC 1BX0A 2I66A 5DNYB 3OOEA 1EWRA 1FP1D 1MHPA 2BF7A 3LE8A 3OFSA 3DVAB 1L4MA 2JJMA 4NMWA 4S24A 4BFWA 2LGJA 2NYRA 3IR7A 2VDNB 2BY4A 4ZICA 2I1LA 4WK0B 4UU0A 1T8SA 2WYOA 3HO1A 5EG5A 5E2AA 4UEJA 3UENA 1P5HA 5EE9A 1ZKMA 1TJYA 1NVKA 4YQEA 3DHVA 1ZU4A 1N0VC 4RJIA 4X1OA 3GZ4A 5CBKA 1E61A 5ECDA 4WY8A 1YH3A 3B36A 9MHTA 3SF8A 2ODAA 2WM8A 1M54A 1NPDA 2IYXA 1GTRA 1N5LA 4UPVA 3Q2KA 3BKXA 2JVJA 1V3TA 2YWHA 1DARA 3CN7A 1K7YA 1KI8A 2O3TA 4CXMA 3CNOA 3K5IA 1JMKC 2PRSA 2VJLA 4H6VA 4M60A 1S8NA 1UK8A 2REBA 3AFNA 4G0XA 4XIJA 2AZXA 3ZJ4A 1HE4A 3MWDB 1WETA 2G06A 2RB4A 2H5LA 5BMVA 5EC8A 3T9AA 1VLLA 4NZYA 4DC9A 3LQ1A 3T3EA 3TW0A 3VKHA 4LJRA 2Q2OA 4Q21A 2C2ZA 4FU0A 4P4SA 1HDYA 2R2AA 3W90A 4D4IA 2GBIA 4UC0A 4H4EA 2IXBA 3L0BA 1SG9A 2PGLA 4M2LA 2C1EA 4V3BA 3LDAA 3A31A 4RKYA 2AOTA 4YQYA 5C46F 4EHKA 1K3UB 5IH3A 1YR7A 2OOSA 3LZ6A 4KH1A 5A4AA 3U19A 3VNQA 2PM8A 5EP4A 3EIQA 821PA 1M2VB 4RVDA 5LVAA 1X94A 3TZEA 2AG8A 3DP9A 3PDIB 4NJMA 4PG5A 2X9LA 2NTVA 3SX4A 1AHPA 4OJQA 3FZEA 4HAXA 1IQUA 1ZA2A 1JEYA 1G3MA 1Y37A 3PRHA 3CVYA 3V1LA 1NWCA 2QM7A 3IAHA 2EKBA 1BHQ1 4Y0NA 2A9VA 3II6X 4HDMA 1PG5A 4PX2A 3ST7A 3OQMA 2Z6UA 2IHNA 1KJ8A 3T1OA 3VI3B 4E13A 3L41A 1CJSA 2ORED 1TVMA 1IEQA 1J90A 2EARA 4MXDA 2YWDA 2O07A 3JXEA 1TW2A 1U7UA 1IZ0A 2VDWA 1G3RA 3P8ZA 1VGRA 5CLIA 2J9RA 4ZCPA 4C7VA 2BIFA 1P19A 2P9JA 4MGYR 2QDKA 3F6BX 3QPAA 3WYBA 3K1JA 1N2GA 4BV8A 4F56A 1IPHA 2VR1A