1KBZA

Crystal structure of apo-dtdp-6-deoxy-l-lyxo-4-hexulose reductase (rmld) from salmonella enterica serovar typhimurium
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
298
structure length
298
Chain Sequence
MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVNAAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETDATSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVINDQYGAPTGAELLADCTAHAIRVALNKPEVAGLYHLVAGGTTTWHDYAALVFDEARKAGITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFDLILPQWELGVKRMLTEMFTTTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Variation on a theme of SDR. dTDP-6-deoxy-L- lyxo-4-hexulose reductase (RmlD) shows a new Mg2+-dependent dimerization mode.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Oxidoreductase
molecule keywords dTDP-glucose oxidoreductase
total genus 98
structure length 298
sequence length 298
ec nomenclature ec 1.1.1.133: dTDP-4-dehydrorhamnose reductase.
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1kbzA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1kbzA02
2HU2A 4Z9XA 3A14A 4FB5A 2NADA 5JLAA 4FGWA 2QRKA 4R3NA 1UAGA 1I5RA 5EPOA 2DBZA 1O8CA 4R1TA 4DVJA 4PLTA 1ONOA 2W90A 1P1RA 4J7XA 1ZNQO 2TMDA 3ZU3A 3CTMA 2JD2A 2X86A 3DZBA 3RUIA 3HFSA 1NVGA 4UVGA 5LC1A 2EG9A 1DJNA 2OP0A 1YH3A 2VRCA 4BO6A 4PVCA 1MGOA 1DHRA 2WE7A 1NQTA 1NX6A 3BTSA 1GCOA 3WQRA 4Y98A 3VPGA 3KSZO 1N1EA 4CLDA 3KTDA 1T25A 2IE0A 5I8ZA 1P74A 1HWYA 3DHEA 3FRJA 3NTRA 4CMGA 4E2WA 3SC4A 1YWGO 3OA2A 4GBJA 1D1TA 4J9VA 1KOLA 4EUHA 5JSFA 4AJIA 2I99A 1XEAA 3V2GA 3V2UA 2Z1MA 1HDXA 2ZB4A 5A3VA 2HQ1A 1H5QA 4B7UA 4YTEA 2C82A 2NU6A 3PLRA 4N7RA 5ADHA 4PZDA 1B15A 3IKTA 1NAIA 3AM5A 4OOFA 3S8MA 1E1MA 3HE3A 1MUUA 3D0OA 4PLFA 3QP9A 3WMWA 1GDHA 5JDCC 3FWNA 1E0DA 1HSZA 4BKOA 4NBWA 1BXZA 5T5QA 2ZTLA 3GGGA 2VOEA 1UR5A 5JAIA 2DKNA 2R2GA 3JQ9C 3GVIA 1ZMTA 2NU7A 3ENKA 3NDRA 3HUDA 1PZHA 1XELA 4NJMA 3AWDA 5A9SA 1GCUA 2JAHA 3I6QA 5T57A 4BV8A 3C3XA 4NJOA 2NTVA 1FDWA 4GH5A 4L4XA 4MIYA 3UICA 5KWEA 3D64A 3DBLA 4GMGA 1UXGA 4GX5A 2BFAA 4N5MA 1J4AA 4PLYA 5T64A 1IZ9A 2NVUA 4B4OA 2Y99A 1ULSA 4G5HA 3ZWYA 4E5PA 1MC5A 3OQ1A 2JCVA 2WYVA 3K9QO 1SAYA 3O4RA 2DTEA 3JSAA 1A27A 2QRJA 4CR7A 3ZWAA 4RGBA 4RVHA 1WDLA 2EGHA 2RIRA 1R37A 3ANMA 4Q3BA 3RC7A 4X54A 4FFLA 3M1LA 3DFZA 3W1VA 4BKQA 5BNFA 2OXIA 5B4UA 4D44A 3GG2A 3JQ8A 3DAGA 1H2BA 1T24A 5JDIC 4R69A 4MPDA 1YVEI 3EC7A 2DM6A 3KYCB 3MTGA 3JQ7A 1I2CA 1U9JA 4JIGA 3S2IA 1YB4A 4IQ8A 1A72A 4YXFA 3E9QA 3AUUA 5A03A 2GLXA 4RPJA 1SZJG 1MG5A 4DLAA 4RJTA 4HUJA 3TZCA 4R51A 1P0FA 1P33A 2GD1O 2PK3A 3DR3A 3GQVA 1TB4A 4KWIA 2X6TA 3BTOA 1T26A 4GX2A 1LJ8A 5KVSA 3G49A 3NGLA 1CRWG 4KQWA 4NMHA 1IPEA 2Y68A 3OIFA 1FMCA 4IDBA 2ZJ1A 3V1TC 4JXKA 1I33A 1PS8A 5EINA 2O4UX 4NI5A 4ZQGA 2I3AA 3FBTA 3P5SA 4E32A 2Q1TA 1E6WA 3ULKA 2CNBA 5JS6A 2XF8A 3B70A 3T7CA 4CMKA 4E30A 1TA4A 1HRDA 2VTEA 2ZTMA 5TT0A 2FR1A 4E5MA 1M6HA 3IC5A 4J49A 1YL6A 2VYND 1YRLA 4YQZA 3VVBA 2C2XA 3ZI0A 1ISIA 3WS7A 5K6AA 5T8KA 4QSMA 1XQ6A 3AOEA 3I23A 3JQGA 1AN9A 3IP1A 3NX4A 1KEUA 3CUKA 2GGSA 3GEMA 2FSSA 2HJSA 2VUSA 5JC8A 1T2CA 2W8ZA 1ZXLA 2EKPA 5KVVA 3H65A 4R3WA 4N5NA 3VPHA 2X0RA 5DDIP 1UDCA 3I9LA 3CZRA 2GYYA 2Q1SA 2Z5LA 2NVWA 1HZJA 2PV7A 5U4QA 4XYMA 1KC3A 2JFGA 2VHYA 3TZKA 1Y7TA 1Z7BA 3C7CB 3I3OA 4CLHA 4HFRA 3VH4A 3UCFA 1SMKA 1DLIA 3LU1A 3WNQA 1KEPA 3PQEA 4QT0A 1PJQA 2VNAA 1GUFA 3V8BA 3AUTA 4I8XA 4CM3A 1R4NA 2VTDA 4EZBA 4BO2A 2WYWA 2C59A 3PJFA 5DN9A 4RDHA 3SLKA 4MVJF 3WSVA 2GRAA 1H9AA 1UZLA 5KJEA 1YE3A 5CG1A 1W8DA 4CM8A 2QX7A 6LDHA 3WICA 3DWFA 4UEKA 3SBOA 1EEHA 4NK5A 3V2HA 4WECA 1Y5RA 4B7XA 1QKIA 2BGKA 2CUKA 4GWGA 3QWFA 2Z95A 2E6UX 4WKGA 2VHWA 5TT1A 2G5CA 3HZZA 5F1OA 4PN3A 3H8VA 1LC0A 3N74A 4HY3A 2BKAA 4NBVA 3TOXA 4J0FA 4I1IA 5TC4A 4D43A 3GHYA 3INGA 4EDFA 1C1DA 2VZ9A 1P3DA 3F5SA 2YDXA 4J1QA 4FFRA 1DRWA 3K8ZA 1NR7A 1H6BA 1NAHA 2J3KA 2P5YA 1YOVB 4BNZA 5F21A 4R9SA 5IN5A 2X5OA 1PJCA 1NTOA 2X0JA 3B1FA 3RFVA 2PZMA 3L6DA 4W99A 4MIEA 1T2EA 3ZU4A 2TMGA 3W6UA 4A03A 1EVJA 1E3JA 3ICCA 1DC6A 5H82A 5L4LA 3F46A 2YDYA 2GN8A 1O6ZA 5AQ1A 3U4IA 1QV6A 4FFOA 1ISMA 3Q1LA 5A02A 1Z73A 2HMVA 3MZ0A 4BGIA 1H6AA 4YA6A 3SC6A 4YRDA 4PG5A 2OHXA 1PZEA 3TZQA 5TQVA 3ZNOA 3A06A 3GDGA 5IDXA 3KM0A 1N2SA 3F5QA 4J1NA 3UOGA 3OQBA 3FBGA 3GF4A 2DLDA 1GL3A 2EERA 5A04A 1S6YA 4AVYA 1SCUA 3TPCA 1X7DA 3PDJA 1NWCA 5DP2A 3GGPA 1SEPA 3GVCA 3IJPA 4RL6A 5DBGA 4FFNA 1PS9A 2R6JA 3CMCO 2HRBA 1PGQA 2VNSA 4B79A 4ZRMA 4CQMA 5J23A 4KUGA 2IEDA 5IFLA 2ZIZA 1T2DA 2Y1DA 4BQPA 2V7PA 2ZQYA 1NHWA 3O26A 5DULA 4B8WA 4P4GA 1KC1A 1LEHA 1LRKA 3OICA 3I9OA 3KYCA 5KNLA 1E7QA 1GPJA 5IG2A 4IMRA 3FNEA 2X22A 4IJUA 1WMAA 3S1LA 1DB3A 1ZK4A 5IDWA 5JCJD 2Q99A 4HNHA 4IJVA 1ADCA 1W4ZA 1L1FA 1OZAA 5BSHA 5CG2A 1MLDA 1XQ1A 5COQA 1ADGA 4Y67A 5G2OA 3RFTA 1P45A 3HN7A 5L3ZA 1IY8A 4P8RA 3FF4A 3VKUA 2D5AA 1CWUA 5JC1A 1NQAO 3MEQA 1F17A 3FTPA 4B3HA 2ET6A 1U7HA 2Y1CA 4FN4A 1LLCA 2Y1EA 2QHXA 9LDBA 3NV9A 3DBLB 3FSRA 2ZCUA 1JTVA 3MJTA 1JKIA 3ZV6A 3GNQA 3K96A 2E4AA 2O3SA 4RPHA 5FF9A 2P4HX 1KS9A 4H15A 5B37A 2G82A 3RUEA 5IZCA 2NSDA 5F5NA 4J4HA 5IAAA 4WOKA 4BNHA 4CUKA 1XU9A 4FS3A 2X4GA 1N8KA 3K2BA 4QO8A 3HG7A 3MTJA 3UCXA 4IXWA 3QJ5A 3QIVA 1UP4A 4WLOA 3TOZA 5BT9A 3DMTC 2WMDA 3G1UA 3KRTA 4G2NA 5KKAA 4EJ0A 1ZH8A 1ENZA 4R9RA 4CM6A 1CETA 1BWSA 2O7QA 1EK5A 3GUCA 1I2BA 4MKRA 4CMCA 4DRYA 2ZATA 1EVYA 1XLTA 1H6DA 3NGXA 2P91A 1H2HA 1VJ1A 3TRIA 3VOSA 1MB4A 4XA8A 5JY1A 4IZIA 3JQDA 3W8EA 1UZMA 3U4DA 4UAGA 3W8DA 1PIWA 1K6IA 4XQCA 2OP1A 3NDJA 2HMWA 3ZH2A 1BXGB 2I3GA 2O3TA 3KLMX 5I7VA 2JFHA 4ZA2A 4A5OA 1M76A 3VC7A 1U7TA 1NXQA 3L6OO 5DCUA 5A1TA 2C07A 4BNYA 3OEWA 3QVOA 2D2IA 5HM8A 3WWZA 2RH8A 4DMLA 3P19A 1HETA 1YDWA 1HE5A 3OP4A 1I10A 2X8LA 1BSVA 3PJDA 4BO0A 1IL0A 1ZEJA 4E5YA 4I9UA 4M55A 1EDZA 1FK8A 3RU7A 1SOWA 1OC4A 2OOSA 4K9DA 3KYDA 1EE2A 4TZKA 3ABIA 4I5EA 5CAEA 3JQAD 2I66A 3MJSA 5K9ZA 3PJEA 1LQUA 1U1IA 2H1SA 4QFDA 2AQKA 4CLEA 1GQ2A 1H93A 1ZK2A 4KP7A 4OIMA 4BHTA 1GYRA 4QECA 1DFHA 2HLPA 1GFSA 4JJGA 1VSVA 1MFZA 3DAFA 4XR4A 2GZ1A 2IZ0A 3B6ZA 3IP3A 1NPTO 1KEVA 3D5QA 3GZNA 1R16A 1PWXA 2I5PO 3JQBC 2ZYAA 5I7SA 5DZSA 3V1YA 5KTKA 1M2WA 2EW8A 4RORA 3DMYA 3ASVA 3OJFA 1KVRA 3LLVA 5JNLA 5ILOA 1LTHR 2CF5A 4LRTB 1GZ4A 1SNYA 4OKIA 1MC4A 1GV1A 4CR8A 3ZZNA 1P1KA 2PR2A 1QYCA 1SO8A 3T7EA 1VKNA 3PGXA 3PIIA 2X9GA 1DIBA 1ONNA 1PZFA 1ZXBA 4E12A 1DIGA 1X1TA 1DBVO 2GDZA 3ZDFA 4BOYA 3QWBA 1AXEA 4TROA 4BL5A 1NPYA 1NFRA 4BMSA 4E2YA 1KVUA 5MDHA 3B1KA 4HXYA 2CVQA 3UAGA 5KIAA 4Z0TA 4CV0A 3E6AA 2I6TA 3SVTA 2QIOA 2RHCA 1PL8A 2W2LD 4QTZA 4CM7A 1KEWA 4AJKA 1ADFA 2Q3EA 2Q4EA 3E03A 4EUEA 4IM7A 5A06A 4XJSA 5HTOA 4P4LA 4UUMA 2I9PA 3KUXA 3AUAA 4DQXA 2WEKA 4GLLA 3HB5X 4GVXA 3RIHA 2PH5A 2PKQO 3QW2A 2AMFA 1C1DB 2BLLA 2WJPA 3S2GA 1WZIA 2DFVA 1PGJA 3KXDA 4ID9A 1DHTA 3E9MA 3WQQA 4D41A 4CL8A 4AJEA 3BYZA 4BNJA 1E3SA 4YJHA 5JMWA 3E9NA 4BO8A 1CEQA 1PGNA 1YQXA 4IJKA 2JHGA 4LCEA 3LT1A 3AM3A 1R4MB 1WLYA 3DTTA 3WBBA 3GUYA 3EVTA 4CQMB 4BNFA 1PQUA 5JXWA 3JD4A 3I83A 3ZWWA 3R3SA 4CV1A 1GAEO 2BFOA 1U5CA 2YFHA 1TXGA 4O0LA 4NBRA 4BNVA 1V3UA 2YJZA 4M8SA 4CQMD 1QMGA 2P9GA 4FGSA 1ZZEA 4BO7A 4XD2A 1WPQA 2AQ8A 1NVTA 2VQ3A 1DAPA 1PQWA 4L4SA 4YCAA 1XGKA 3NDIA 3EY4A 3VH2A 4FW8A 4E31A 2I76A 3TN7A 3WDSA 1JN0A 1E3EA 1FF9A 1EMDA 3WXBA 5CDSA 4QEDA 3P7MA 5TIIA 3AM4A 3PQFA 4DQUA 4B4WA 4MP3A 5JYDA 2Y05A 3WLEA 3CINA 4BNGA 3CZMA 4P22A 1IZ0A 1GR0A 4LMRA 1T2AA 5IN4A 2DT5A 1DFIA 1P44A 4IGEA 2FR0A 1R15A 1U28A 2FN7A 1HLPA 4IIVA 3RQSA 8LDHA 5I9LA 4G81A 5KJ6A 2VWQA 5JAZA 4BB5A 4XRRA 3V5NA 1BXKA 3A4VA 3WGZA 1KVTA 1B14A 4GMFA 4ALLA 3KOUA 3GVHA 2HDHA 3LVFO 5B1YA 4L73A 2A35A 1IPFA 3ETEA 2R00C 5IXYA 1RKXA 4W7IA 3D3WB 2UYYA 3G3EA 3GFGA 4GGPA 2PZKA 3HDJA 1JDJA 1F0YA 4IQGA 2ZYGA 4YT4A 3IQDB 4C7JA 2YHUA 3U4HA 4II3A 3O9ZA 4HWKA 1DDOA 1HDOA 3QVWA 2NVBA 4Y6RA 1NYTA 2BH9A 2AE2A 3CE6A 4H3VA 2AHRA 4FIZA 2X7HA 2WD7B 1H6CA 3PXXA 2IZZA 2QZ9A 1J6UA 2F1KA 3ADPA 4QQRA 1FDSA 1HF3A 1ZIDA 3AFNA 3FTNA 2DUUA 2GN6A 4R5HA 4JGBA 2JHFA 1ZK1A 1LSJA 4YAIA 4YJFB 3GAZA 5TNXA 5C7OO 2GN9A 3CEAA 4NU5A 1H9BA 4OAQA 5BNIA 3NEPX 4YAKA 1P31A 3OECA 1YQGA 1HTBA 1U3WA 4OOEA 4A27A 1B26A 4A26A 1DC5A 3OH8A 2FR8A 2Y93A 4UULA 2WD8A 3EDMA 3OA0A 1I8TA 4KDFA 1HDRA 3WG9A 1U3TA 4PG4A 4EJMA 4TQGA 4IJWA 2CSUA 2W98A 4G65A 5ICSA 1L7EA 4D3SA 4BMNA 4FR5A 3W4JA 2V6MA 5JCXA 1GZ6A 4NU6A 2C5EA 4UUPA 1RYEA 2O7SA 2Y67A 2CY0A 1OAAA 4MKZA 3X2FA 1TVEA 2CD9A 1VJTA 2Y1OA 4KDEA 3RC9A 2VUTA 3ZWOA 5A05A 4DC0A 1Z7EA 2D8AA 1PJ3A 4DUPA 4LW8A 4URFA 1GEEA 4UVIA 3U62A 2NTNA 2B0JA 1K5HA 4UEOA 4GAEA 3FR8A 2DFDA 3AU8A 3JD1A 4A73A 4I5DA 3UKOA 4YAJA 5IZCC 3H6KA 4J43A 4R5MA 4CMIB 2P9CA 4KQXA 4FC6A 2OGUA 3RUCA 2F00A 1ML3A 4FQ8A 4PLVA 2YZ7A 2LDBA 3IJRA 3ZHBA 4XX0A 1FDVA 3ADOA 4KTVE 3KETA 5TJHA 3TZ6A 4GSLA 4RLHA 1HL3A 1ISJA 4WOJA 3RJ9A 4ALKA 2FSVA 4PRLA 1JVBA 1EUDA 1Y1PA 2DBQA 2P68A 3GZ4A 4IXTA 3U5TA 2DBRA 3VDQA 2VYNA 4F6CA 1U5AA 1VL8A 4KZPA 1WWKA 2FHSA 2NTJA 3DB2A 1QYVA 2D0IA 1DC3A 1HYEA 1EFLA 5KKCA 1EVIA 8ADHA 4DBZA 1JKFA 2X9VA 3GY0A 4YJGB 5KJ1A 1LDNA 2NVUB 3I9NA 3RJ5A 1A9ZA 2AEJA 3HHPA 3KBOA 4RVDA 3A1NA 3PRJA 1EZ4A 3ZW9A 1N7GA 1HDCA 1Y8RB 2A94A 4KTTE 5GZ6A 1EBFA 1I36A 3H9JA 4H7PA 1LBEA 4OGWA 2AA3A 4XYBA 1EFKA 1ID1A 2D1YA 3HSKA 4RF3A 3WX0A 1TT7A 5A9SB 2EP7A 4PCVA 3ZNNA 3FPLA 3SJ7A 4E3ZA 3ROMA 4DREA 2FY8A 4OKNA 5A4DA 3WGIA 2WM3A 1YKFA 2UAGA 3EMKA 4PLWA 4TVOA 1O0SA 1N92A 5COBA 3DL2A 1EBUA 3TFQA 4D42A 2Z1NA 5JAQA 1JAXA 2CVOA 1PR3A 1PL6A 1U4OA 3Q0EA 3AK4A 4Y9DA 1WW8A 3ZGYA 2O23A 5AXBA 1Q0LA 2OORA 2VHXA 1VI2A 1I24A 4CLRB 3BZUA 3D3WA 3RROA 1A7KA 3QVSA 4QUKA 4O5OA 4XYEA 4J90A 5ILGA 5L7YA 4YEDA 1OBFO 4E21A 3OM9A 1F12A 2ZQZA 3HADA 5G0WA 4RF4A 4YAGA 3IOYA 3Q11A 1DJQA 3DQPA 1YJ8A 3AY3A 4PG6A 3H9GA 3KSUA 4XGNA 2Q2VA 1YXMA 4DBVO 3ST7A 4AICA 2J6IA 2XPCA 4LK3A 3GPDG 2AW5A 3MWDB 1IE3A 4E5NA 4YQYA 3CKYA 1U3VA 3F4BA 3PQDA 3WQSB 2OL4A 4A10A 4DMMA 3ETDA 1QP8A 3GHHA 4MVJI 4BNLA 1X7HA 4U5QA 1QORA 4WASA 4CL3A 2AE1A 1YB5A 3QSGA 3GRPA 2AG5A 1U8XX 2EEZA 4IIUA 5BQFA 4FPXA 5GMOA 1VL6A 5AXCA 4XRGA 4ZGWA 1MFPA 4RDIA 1JW9B 3RUDA 5G4KA 1WAMA 4TRJA 1C3VA 3PHJA 3WJ7A 4TVBA 3UGKA 4WNIA 3H5AA 1KERA 1PEDA 1UXIA 3BMCB 2P2SA 3S2EA 2PH3A 1ENPA 1C0LA 1YO6A 2AEMA 1C14A 1EVZA 4IZHA 2JJYA 4D0SA 2QZZA 4LGVA 4R16A 1JLLA 3GA0A 4P38A 4UVDA 2SCUA 3IDSA 1E92A 3RFXA 4IDAA 5TLSA 1LQTA 3C7AA 2DVMA 4RZHA 4NZ9A 2JD0A 3ZNQA 2ZB3A 4K6FA 5KCZA 4EEXA 1B3BA 2VUUA 3M2TA 2C54A 3EVNA 3BMOA 2I65A 2PTGA 4ROSA 2GUGA 4OH1A 1QYXA 2VHZA 3LF1A 4TZTA 1Y8QB 2EV9A 1GYPA 3AU9A 5AOVA 1BDMA 3WWYA 7ADHA 5HRUA 2RAFA 4IMPA 4HFNA 3AW9A 3S2FA 3KV3O 1XG5A 4CLOB 3AUSA 4JJIA 3OJ0A 4HBGA 3L4BA 3BHMA 4WCFC 1LX6A 4L74A 1GADO 1XR3A 2E48A 3L6EA 1ENOA 4R4JA 2Q4BA 1PGPA 2Y0DA 2W4QA 1NQOA 3PYMA 2IXBA 1M75A 1XU7A 4HV4A 2PNFA 2HMSA 3ON5A 1XKQA 1N5DA 3PYLA 4UREA 4CJXA 1ONPA 3GNTA 3ONDA 4WJZA 3WYCA 5CFZA 4GVLA 1DRVA 1QSGA 3FPCA 2GO1A 4CLOA 3VZSA 4J0EA 4KMSA 4J6FA 3TNLA 1FXSA 3ZWBA 1IHYA 1TLTA 2UV8A 3MJEA 1T2FA 4S3MA 2EF1A 4OYRA 3COSA 1GUZA 1UP7A 5THQA 3UW3A 4EUFA 3RAJA 1P1JA 1E3LA 3RUFA 3PI7A 1LI4A 2NQ8A 5HS4A 4E2XA 3L9XA 4F6LA 3QWIA 4DIFA 3IL2A 2VYVA 5A5EA 3D3EA 5L51A 2P5UA 4DXHA 1DIRA 2POQX 2HRZA 4BO5A 1WVGA 2IYOA 3BMNA 3OJLA 3WJAA 3OMLA 4NHEA 3OEYA 3ENNA 3K31A 2VT3A 2X23A 3IIEA 5CDGA 4RPGA 2GR9A 3R3JA 1MV8A 2Y66A 5U1PA 1DEHA 4BGVA 4L8VA 2EIHA 1ZK0A 4M1QA 1RPNA 2HK8A 3G0OA 3BMCA 3JYPA 3WTCA 3BHJA 3SJUA 1EDOA 1DFGA 1MX3A 1WNTA 2NWQA 3EZYA 4ZICA 5A5FA 1E7WA 1V9LA 4ESOA 3VZQA 1V3TA 2WYUA 2XAAA 1HSOA 3ZU2A 2WSBA 3KO8A 5FI3A 3VPXA 4AJNA 5KVQA 3MWEB 3FNHA 5KJCA 4Z3KA 4WEQA 4HADA 1RWBA 3ETGA 4JP3A 4L76A 4KUHA 3GVPA 1T4DA 2QYTA 3H2ZA 4YACA 4ND2A 2DTXA 3VPSA 5FFFA 5DBFA 2B4QA 3ORFA 1PU2A 3LF2A 4ITUA 3D4NA 4M86A 5IF3A 1BGVA 1JKJA 2YW9A 4DTIA 1E1NA 1VSUA 3DHNA 3BMOB 3JQCA 4XWYA 5F5LA 5HBRA 1K2WA 5CEJA 3H9QA 2RHRA 4MP6A 1LRJA 5EL0A 4CLRA 1LDGA 1PGOA 4M87A 4E6PA 1AHIA 5LCXA 1AXGA 1D4FA 1PTJA 2E37A 3HDQA 3UF0A 1BW9A 1SPXA 3GN1A 4YJFA 2HMUA 5GZ3A 5FI5A 1NQ5A 3UFXA 4BNMA 3L4BC 3AOGA 4F45A 5EQFA 1XWFA 4RVFA 2PLAA 4CMAA 3L4SO 1LLDA 2X5KO 5ER9A 5JFOA 2ZCVA 5EERA 1EUCA 4LRSB 4BB6A 1X1EA 3ZV3A 1BDBA 1KETA 3LQFA 1B8UA 4WCFB 1GZ3A 4XYGA 1PR9A 4DA9A 2JCYA 4XGIA 1XDWA 3CXRA 5JAMA 5C3MA 2JKVA 1I01A 3NT4A 2VZ0A 4NNJA 3M2PA 3H5RA 3GLQA 4FDAA 4AJPA 4I08A 4WLEA 2QYSA 3EAGA 3QHAA 3MOIA 1LU9A 1QLHA 3PHIA 3QV1A 4MOWA 4BO1A 3LSYA 3ROPA 4DPMA 3R6DA 1AHHA 1F14A 4R41A 2WDZA 3PIDA 3WR5A 2DAPA 4YDRA 1I2ZA 4R01A 2FPIA 4NK4A 1RM4A 3WTBA 4ND5A 3W4IA 3WGYA 1VC2A 5CDTA 1CF2O 3ICPA 2PD3A 2EKLA 3QLJA 3QRWA 4OO3A 3OQ6A 2PGLA 3ZWVA 4JROA 4PVDA 4HNGA 4J7CA 2EHDA 1BTOA 2FP4A 5HWSA 4MP8A 1UUFA 1I3NA 4R68A 3QA9A 4YT8A 1PWZA 3BXXA 4WK6A 4OJNA 2V6GA 3EW7A 1NHGA 3L07A 4BMVA 3VVCA 1PZGA 2VT2A 3WGQA 4Q3AA 4GX1A 1U2DA 3FCOA 4D3DA 3WB9A 1K3TA 2ZB7A 4XDYA 2BI8A 1N1GA 2V65A 4WCFA 4IS2A 4LN1A 3RBXA 3R1IA 2RH4A 3DBHB 3MOGA 1LNQA 2X58A 3L0DA 5JY6A 1GQQA 4FCCA 1K0UA 3WGHA 1E77A 3WYEA 1NVMB 2VRBA 3EYWA 3SEFA 2GZ2A 1NPDA 3C8MA 3C1AA 3K5PA 2B83A 2HSDA 3LT2A 2Y1GA 4NPCA 3ZNPA 1N9GA 3H5NA 5THKA 4I9NA 3U3XA 5F3RA 3NTOA 1HEUA 4GSKA 2G17A 1S7CA 3PWSA 2XXJA 1LSOA 4PLHA 1Y8RA 4QO7A 4W9NC 3PVZA 1DSSG 1B3RA 1Q0QA 4YJHB 5IDQA 3KHUA 2C7VA 4YJGA 3ITDA 2YQ4A 1O89A 1LA2A 3ROQA 3V1UA 5B4VA 1ISFA 1PJTA 3B1JA 3JQFA 2FOIA 3A9WA 3LT0A 4B4UA 4LVUA 1MXHA 3OETA 1YOVA 4J1SA 4N5LA 3RUAA 2NNLD 4Z6KA 1B16A 3ZWXA 4E4YA 1CIVA 3WSWA 3DAPA 1VPDA 1KVQA 3U4CA 1QYDA 4JBGA 4Z0PA 4C7KA 4R54A 4EW6A 5HA5A 3UUWA 4CMEC 4PLCA 2Q2QA 2O50A 4R1NA 2HMTA 3HDHA 1PSDA 4BKPA 3BIOA 3HQ4O 1BMDA 1NP3A 1A9YA 3ZV5A 4GLOA 3Q9UA 3PHHA 4OQZA 1CYDA 4FC7A 4XGKA 1GTMA 2W2LA 1ZEMA 1YL5A 1VKOA 2PWZA 4CMIA 4E0BA 1WZEA 1VL0A 4DIOA 4M49A 5AYVA 5GY7A 5ICMA 5COAA 1JQBA 4XQ9A 1TT5A 3GMDA 3KB6A 4H16A 5DT9A 3CIFA 2NV6A 5I9MA 3DO5A 1FJHA 4TKMA 3ZCXA 1EE9A 3VAZA 3DZGA 1R4NB 3I5MA 5A9TA 4EBFA 1LSUA 1E3WA 3H3JA 4RQTA 3MCVA 3NT5A 1DRUA 3IKVA 2HAEA 5DF1A 1ZSNA 1H94A 2C5AA 2VHVA 4M89A 1IB6A 4CQLB 3FNFA 4FJ2A 1SEVA 3WGTA 3K92A 4D3FA 2IYPA 3WMXA 1AE1A 1Z6ZA 2DQ4A 3AI1A 2GN4A 1PJ2A 2GASA 4XKJA 2HO5A 4J91A 2J8ZA 1YQDA 4BO3A 5FYDA 2OMEA 3OIDA 5DBIA 4DPLA 4RVGA 4J1TA 1R12A 1XA0A 3HJAA 3NYWA 1ZSYA 4JN6B 1YBAA 3D5TA 2VWGA 4JQCA 3H4VA 2UDPA 5EESA 3TQHA 5L45A 5L4NA 1UDAA 4BO9A 2NACA 4WLVA 4D45A 1F8FA 2BI7A 2XOXA 4EEZA 1DPGA 1HYGA 1PJBA 1RJWA 4YPOA 2BHLA 3VTFA 4FFMA 1HLDA 1KVSA 1WXDA 1O95A 2GCGA 3GN2A 3OSUA 3WOHA 4BNUA 3PEFA 4BKUA 1OMOA 1W73A 5IXSA 2D3TA 3VH3A 3T4XA 1FDUA 4YB8A 5TRTA 2Q1WA 3TWOA 4YYZA 1ZCJA 4FOSA 4U6QA 1B8PA 3BTVA 4MVJG 5DOZA 3PFFA 4WEOA 1UZNA 3QVXA 4IS3A 2B69A 1BXGA 1CQJA 3WIDA 5ES3A 4ALIA 2NM0A 4W9NA 1C1XB 4TWRA 5CPBA 1TI7A 3JQEA 1M67A 1SBYA 4NFYA 4PZCA 3LC7O 1IHXA 1IUKA 3UCEA 3EHEA 3ITKA 1C0IA 5JDCA 1NR1A 1G0OA 1RM3A 2IXAA 5CP8A 4PGFA 2BD0A 2C29D 3OFSA 4XIYA 1UDBA 3QVTA 3ANLA 2AQIA 4HFMA 4RPKA 3QQPA 4MVJP 4RVSA 3GZNB 3WIEA 5JMPA 3JQ9A 4IY1A 2ILTA 3GG9A 5IJZA 1D8AA 4RLSA 4O59O 1SC6A 3RD5A 1A7AA 1DO8A 2I67A 4B3IA 1ZJZA 2P9EA 5TSDA 4GQAA 3H9EO 1VJ0A 1A4IA 3RKUA 4CPDA 2FRDA 4R1UA 1OFGA 1HE2A 4AL4A 3JQFC 4TKLA 2IRWA 5IDYA 5A9RA 1HDYA 3D7LA 4DL9A 3W4KA 3PWZA 5G4KB 4Q3NA 5EN4A 1V35A 3GGOA 1ZVMA 3G17A 3WYBA 3KEQA 4FBGA 1YB1A 3INTA 5B12A 3DZKA 3JD0A 1IOLA 1T1SA 4DLLA 3JCZA 2NU8A 4PLZA 2J3IA 3CPSA 3P2YA 1NM5A 1GU7A 4Q3CA 3KSDO 4MVJH 1DLJA 1A5ZA 5H83A 3ZU5A 3I1JA 4PIVA 4JLWA 4QFCA 3FI9A 1V6AA 1EK6A 2YV3A 3NAQA 3FHLA 4TMFA 5G0VA 1P1IA 1P77A 3G1TA 1A71A 4E5KA 3NKLA 4CODB 5L53A 1XIVA 2B36A 2WE8A 4ZQBA 1R66A 4BO4A 5A3JA 2X9NA 4RVUA 5LDGA 4XIJA 1EQUA 3BA1A 4Z0HO 2O2YA 3UVEA 1NASA 2Q1UA 4A2CA 1BW9B 2QG4A 3BMNB 3ZWNA 1RM0A 4AJJA 1Q7GA 1R4MA 3IMFA 1FDTA 3LDHA 2PY6A 3Q3CA 4Z9YA 1AUPA 5AXDA 5FEUA 3LT4A 1K6JA 2UVDA 3EGOA 3ZV4A 2D4AA 3IS3A 2GZ3A 1OI7A 1LDMA 1Y9AA 5ER6A 1CDOA 3K2EA 1GEGA 1DC4A 4O6VA 1JVSA 1B7GO 2HJRA 3DFUA 5L7TA 1ARZA 1ZO8A 3W6ZA 2O3RA 3E82A 4TRMA 2R00A 3F3SA 4RV9A 1Q7CA 1Z45A 3RWBA 4KWHA 2O3QA 2Q45A 1QLJA 3DZIA 1TEHA 2IODA 3E48A 3SLGA 2PZLA 5BR7A 3G79A 4FSHA 1U8FO 1YDEA 2E49A 3C1TA 3PPIA 4RZIA 3O03A 3KYDB 4U0JA 4ZJUA 3H9UA 5T6BA 1N7HA 2BELA 3KZVA 4XQGA 3N7UA 4WPGA 1C0PA 2AEFA 1UJMA 4EGFA 3GT0A 3WLFA 5I7EA 4CLXA 3JQAB 3ZHYA 5G0TA 2A9FA 3I9MA 3HFGA 1V0JA 3DMTA 3F9IA 3N58A 4IINA 5JPIA 5ITWA 1JWAB 4ALMA 4E33A 4CMBA 4MIOA 1K6XA 3RVDA 3UXYA 2EJVA 4UUNA 1ZUD1 4ONEA 1D3AA 5TJ9A 4DYDA 2FWMX 4E2ZA 4XDZA 3VHRA 5G0UA 4BVAA 4BV9A 5JW6A 4BUCA 2EXXA 4BNKA 4FJ0A 1A4UA 4PG7A 1ZSVA 1J49A 1ZBQA 4FOOA 2QRLA 4YT5A 1QV7A 4A0SA 1O9BA 1EUZA 3BHIA 3H2SA 4GGOA 4CQLA 1MP0A 2ZB8A 1E7MA 1B2LA 4OXNA 3GDFA 5CDYA 4FD3A 1X0XA 1DXYA 4LSMA 3RBZA 4NBUA 4BNTA 4NG5A 2HCTA 3DBRA 4NDNE 4KUEA 4KOAA 4W7HA 1C1XA 3TFOA 1G1AA 1U4SA 2Q50A 4J4BA 4IDGA 3NJ8A 4BKRA 3LLSA 1YJQA 2CDCA 3DZJA 1UP6A 2ZK7A 2PFGA 3JYNA 1X13A 2LDXA 3S55A 1F8GA 4XR9A 4DPKA 4UVEA 5F1PA 3ONEA 5GZ1A 1W6UA 1O94A 2QQ5A 1Y81A 4BNIA 5BSEA 5KVCA 4J2OA 4N18A 1OC2A 1VE9A 4ZHSA 5L9AA 1HYHA 1XYGA 1I0ZA 1UXHA 3TL3A 4IQ0A 4DC1A 5BSGA 2BMAA 3LK7A 3BMQB 1WDKA 3DZHA 2UUOA 3GDOA 4IDEA 4B8ZA 1LLUA 4ZVVA 3PLNA 4YRAA 3PHGA 1UXKA 2JL1A 1HDGO 3GRKA 3GFBA 3CH6A 4YVFA 1KIFA 3DHYA 1O5IA 2C7GA 2W2KA 1WDMA 3C1OA 4JCOA 3SX2A 2XXBA 2V6FA 4U6SA 5CPFA 3OF2A 4D7AA 4NFSA 1IYZA 3GPIA 3NRCA 3TF5A 3RC1A 4B7CA 4NQZA 3F1KA 4Y6PA 3UH1A 3EZLA 1PQPA 4CV3A 4EI2A 4TRNA 3ZHZA 5ITVA 1E7RA 1JU9A 2GNAA 1IULA 3LZ6A 1V8BA 1ADBA 1MG0A 3H7AA 2VYVD 2CMDA 1SOVA 3LC1O 3GMSA 2NLOA 3PGJA 4JP2A 4II2A 1PX0A 4OXYA 4LISA 1R0KA 3JQBA 4W82A 5ENVA 1R0LA 2BGMA 4AG3A 2VCYA 4UUOA 1LC3A 1LDBA 2GPTA 5MGBA 3WNVA 1PJSA 5EMHA 3NT2A 1LRLA 4YT2A 1TT5B 4OSPA 2DUWA 1E1LA 3H3FA 3Q6IA 4JX8A 4WE3A 5H81A 3TDKA 4PLPA 4D0RA 2YQ5A 5C5IA 1CJCA 1SB8A 1ULUA 2A4KA 2X0NA 3ONFA 5DCWA 5DNAA 4AJ1A 1HXHA 3STHA 2J3JA 4OQYA 1T1RA 2A92A 2C2YA 4XB2A 4ND1A 4AJLA 3JQ7B 2E82A 3TSCA 3UHAA 2VWPA 3PDUA 4EJ6A 2ZTUA 2BFPA 2J5QA 3CSDA 1I3KA 3NUGA 1WP4A 3JV7A 4NIMA 4IDCA 4WGGA 4MKXA 3U9LA 4YBZA 1LUAA 2H63A 2PD6A 3L9WA 3GAFA 1X0VA 4WLUA 4CM9D 3JQGB 1U2GA 4F46A 1X14A 4Y8VA 4AFNA 1ISGA 1QG6A 1BG6A 2FPPA 4YJDA 3ASUA 1RYDA 1WMBA 3WGGA 2EGGA 1E5QA 2YHIB 1Q1NA 1T4BA 4XJTA 4ND3A 4YRBA 1M6WA 4GX0A 4EITA 4AJ4A 1HT0A 4BGUA 4CM4A 3INRA 2YY7A 4CR6A 2CZCA 3QWHA 1W0CA 5C37A 2VOJA 2O48X 4OXKA 4OL9A 1GD1O 1HDZA 1ZJYA 1E3WB 3DOOA 2UUPA 3MJCA 4U7WA 1AGNA 4K28A 4D79A 4OHUA 4N54A 3HN2A 5TX7A 2PZJA 4I5FA 4Y6SA 1C0KA 3DZFA 1SB9A 4LSWA 3DOJA 4XCVA 2IDZA 5EIOA 3AY6A 2EW2A 1J5PA 2C0CA 3DBHA 3DXFA 4J4TA 2YFQA 2HK9A 1PJLA 1JAYA 1X7GA 2CF6A 4XYLA 3FR7A 4WUVA 1L7DA 4GWKA 1G6KA 1BVUA 1ZKMA 1VLLA 2VRCD 3DTYA 4L75A 2J5RA 4J7UA 2ZYDA 5TF4A 1Q0HA 2BGLA 4XQEA 3VZRA 5I8WA 4CM9A 3GNSA 2B37A 3O8QB 3ZW8A 2DBVO 3F47A 4IGFA 2PA3A 3OJEA 1E6UA 3WBFA 3PFWO 4O1MA 4W4TA 4DYVA 2J3HA 2W2KB 3E18A 1E5LA 4MVJE 4RCVA 1P1HA 3K73O 1QRRA 4OM8A 3JD2A 4U0KA 3PP8A 2O3JA 3FN4A 4GPD1 1UXJA 4BNNA 1DAOA 2G76A 1QYWA 2NQTA 4B3JA 1UAYA 2IEBA 4ALJA 4L0QA 3GVXA 3U49A 3D4OA 4HKTA 4CV2A 3I4CA 3O8QA 3C7DB 3ROKA 2EKQA 3SXPA 2OO5A 3RCBA 3ZHXA 4DLBA 4ZQFA 4BGEA 4K6CA 4Q9NA 3RI3A 1M66A 4RF5A 4YWJA 2C20A 3K6JA 4I9HA 3U09A 2NU9A 3E8XA 1N9GB 3KYBA 3LC2O 3OHSX 1YBVA 1LXCA 2O4CA 4DGSA 4IUYA 4B4VA 4JJFA 4J2HA 1E3IA 1R6DA 1GQYA 2GSDA 3RASA 3IUPA 3C24A 4M54A 3I52A 2B4TO 4F3YA 4BNWA 1LDEA 3VDRA 3JYQA 1P1FA 4MVJA 1KY4A 2WTBA 4O63O 4AJ2A 2HUNA 3OBBA 3M1AA 4Q3EA 2BRUA 9LDTA 3P2OA 4BQRA 5BNTA 2OBNA 2IZ1A 2YV1A 4NBTA 5JE8A 4J3FA 4FFPA 2YV2A 1F06A 2O2SA 2VZ8A 3AY7A 4CUZA 3GC6A 4D46A 2P4QA 5AVOA 3DONA 3E5RA 3HB4X 5L4SA 1D7OA 4WLFA 2YHIA 3U0BA 3WFIA 2JD1A 1B8VA 2FMUA 5T67A 1R0SA 2B35A 2HKIA 2PGDA 3HNPA 1I32A 3MJVA 1BRMA 1Y5MA 3A28A 3JQ8B 3Q2IA 5C7IO 3OJOA 3DC2A 5CEFA 3CMMA 4QXMA 4DIBA 2OBYA 2PKRA 3B20A 5L40A 4A7PA 1B0AA 2ZJ0A 4MVJM 3QY9A 1ZFNA 2DU8A 4CMJA 1DIHA 2X1HA 4JBIA 1H0KA 3D1LA 5B4TA 4W6ZA 5JO0A 4RQUA 3JQAA 1YONA 3VPFA 3GK3A 2YUTA 5JYEA 2H5LA 4E13A 4FJ1A 4XZ3A 3ANNA 5ENDA 4JBHA 2BF7A 3OIGA 1KYQA 5I9NA 3LYLA 5HS6A 3JQ6A 1Q7BA 3I6IA 5JCJA 4MJLA 5TS3A 2V6BA 1UH5A 2RBEA 5G4LA 4GI2A 5L7WA 3WGOA 2CFCA 1Q2XA 3PWKA 1NFQA 1P0CA 4EYEA 1ZW1A 3IAHA 4LCJA 4NH4A 4MO2A 1KBZA 2WD7A 1QXSA 5DP1A 4IBOA 2OUIA 5CEEA 1JWBB 5K6AC 4IDFA 3X2EA 3DBRB 2ZKLA 2D59A 3AOEC 2PD4A 1I30A 4J16A 2CDAA 3JYOA 4CUJA 5JO9A 1ISHA 4BNXA 4XEHA 4PRKA 1Z74A 4QX6A 5IZ4A 4IPTA 3TJRA 2YYYA 3EUWA 4CM4B 1XCBA 4IDDA 4JK3A 1HE3A 2FPGA 1ORRA 3C85A 3L77A 1Z82A 2WWRA 1HE4A 5F1KA 1ENYA 3KEOA 4HFJA 5KOIA 1NBOA 4GKBA 3JTMA 5DOVA 3PK0A 3VZPA 3QWAA 1XHLA 1D1SA 3GOHA 3DDNA 3K30A 2GF2A 4MDHA 4HX5A 3Q9NA 4MINA 4RO0A 4WNCA 3DBVO 1Y6JA 1Y9EA 4J9UE 1E7YA 1PJ4A 1X15A 5BSFA 1P9LA 4ND4A 3RC2A 4ALNA 3RU9A 3PYXA 3F6YA 3IUSA 2X0IA 4PLGA 2Q2WA 2H6EA 3Q2KA 4PZEA 3F4LA 4ZQHA 3AI2A 1NFFA 3AJRA 1QR6A 1YL7A 4UVHA 5TGDA 4TSKA 3AI3A 5T8KC 5CDUA 3FD8A 4Q39A 3GR6A 4YR9A 4Q3DA 4OMUA 2G0TA 4OSOA 2EP5A 2HK7A 3FNGA 5LDHA 2AXQA 4WCDA 2D5CA 1ZMOA 1MXFA 4NJMB 5EQDA 1HKUA 2CDBA 4RPLA 1PL7A 4INAA 3GEDA 4C4OA 4ZRNA 5I7FA 5G0SA 4I5GA 3RKRA 4ZD6A 4ZQEA 2Y0EA 4AJOA 1NNUA 2FZWA 5JBIA 3HWRA 1JA9A 1PS0A 3MJ4A 4ILKA 4UEJA 1RM5A 3TL2A 5L95A 3R0IA 3WFJA 1GV0A 4HP8A 4NR0A 2AG8A 3I9JA 4LMPA 1GYQA 3KVOA 3PHLA 4CM1A 4DWVA 5FWNA 3RSHA 2VWHA 4U8GA 3D4PA 4PG8A 4GKVA 3FWZA 5KJFA 3T4EA 2GERA 4CM5A 1VRWA 4JNKA 1KY5A 5K0ZA 4CMEA 2DPGA 4P4NA 2H9IA 2Y1FA 1Z75A 2BFMA 2NUAA 3RUHA 3I9KA 1YS4A 1CERA 1LLQA 2JCXA 3BAZA 1E6EA 3EK2A 1MA0A 3BMQA 4RF2A 2AQHA 1GPDG 1GY8A 5DCYA 4AJHA 3VTZA 1K89A 2G1UA 1E1KA 2JAPA 2OZPA 1CQIA 3KLPX 3O38A 1DIAA 4PFJA 2EJWA 3DEYX 2B5WA 2X5JO 3ZN2A 2RCYA 3NJ4A 3F1LA 7MDHA 4Z3DA 1LDYA 3AFMA 4L4RA 3JD3A 3PJGA 4BIIA 3HDYA 1NWHA 1LSSA 5EJ2A 2CVZA 2OFPA 4S1VA 1DOHA 5JDIA 1BHSA 2B5VA 3ZWMA 3W8FA 2DPHA 6ADHA 3JYLA 1GUYA 2J5KA 3TZHA 3GH3A 1VM6A 1U3UA 4MVJD 2ZTVA 1Y8QA 1ZK3A 3I4FA 1OOEA 4R1SA 3RBVA 1XSEA 5CHEA 1I3LA 4YAEA 2PKQP 1BVRA 2B4RO 2EWMA 4XB1A 1HZZA 4ZU3A 2FZEA 4WLNA 4ZN6A 4K1LA 2PGJA 5U9CA 3ZWPA 3M6IA 3VH1A 2O3UA 1E7SA 3QE3A 4TRRA 3E1KA 2Q46A 3E5MA 2JFFA 1I3MA 2Y0CA 2Q49A 4DQVA 2VN8A 1G0NA 3GEGA 3PTZA 4CM8B 1J0XO 3PZBA 4K26A 1YBMA 4LVCA 2DC1A 4BS9A 4NFHA 5AXAA 4CMHA 5C7LO 4GL4A 3UN1A 3DOCA 4Z9FA 1V3VA 3VKVA 2QW8A 3NTQA 4L9RA 1EQ2A 1YGYA 2DTDA 3ZWCA 3BTUA 3PZRA
chains in the Genus database with same CATH superfamily
3B7PA 3SIPA 1SR8A 5AW2A 3GI1A 3LQYA 3PS9A 2CBGA 4B40A 2CL7X 1T2NA 4XFKA 1RADA 4X8LA 4Q4LA 1I5RA 5EPOA 2DBZA 1O8CA 1FOEB 4R1TA 4GC9A 4XVUA 1NMQA 3FTCA 4G0VA 2IHZA 2VTVA 2TMDA 16PKA 3OFVA 4LEIA 2BEWB 2JD2A 3S0JA 3UC5A 4BX0A 2WM8A 1EJ2A 4PAGA 1USGA 2QUIA 1V1RA 1NVGA 2UZIR 4XCQA 1SKAA 1GGKA 1HORA 1NJSA 3WWOA 2J0EA 2YIVX 4OK3A 3H1PA 3UV3A 4JI8B 2VRCA 4BO6A 4PVCA 4O25A 3UT5A 1X8JA 1MGOA 2WD9A 2GJ4A 1DHRA 4V0KA 4FKMA 2XQJA 5E6RA 1NQTA 5AICA 3S28A 1TK3A 3O2SB 3WQRA 3BEOA 4GYYA 1N1EA 1ZGBA 3FIJA 2I62A 2ZIAA 3W9UA 1F4LA 3I2YX 3FRJA 3NTRA 2XHZA 1AN0A 3SC4A 3DR5A 2BKEA 4QTXA 1D1TA 4FEGA 4ZO6A 1BGWA 2JCSA 1GG8A 1V4BA 3T95A 1TU4A 2C83A 5FBRB 3UJNA 4DV7B 4LNAA 1EGVB 3TAXA 1HDXA 4N7MA 5LPNA 2CJYA 1ECPA 1T34A 1KJWA 2VQSA 5A3VA 1W36C 2HQ1A 4URUR 1JIJA 2GK4A 4B7UA 2C82A 2VDPB 3PD7A 3Q0IA 4CIXA 4OK6A 3F90A 2F3TA 2GZSA 4QXAA 3F78A 3FCSB 5ICCA 2CFOA 5AKZA 3KZMA 1E1MA 3U17A 3QBVA 4RTOA 4GOLD 3RIGA 3WMWA 1HQDA 2Z8YM 4DMRA 1E0DA 1HSZA 4BKOA 1SUDA 5CK5A 4RD3A 1DTSA 5CT4A 5T5QA 2IH4A 4D9BA 2OO5C 1NC1A 1WB5A 4IIEA 4BVKA 3KWJA 1TF7A 5D7BA 3C43A 1ZMTA 5C52B 3X0DA 4G63A 4RXUA 2JLXA 2L0XA 2XYRA 4KVFA 1NJ8A 4Q34A 1TGVA 1XELA 4GKAA 3AR3A 4WXHA 3AWDA 2A0YA 4EW3A 4P86A 1RYYA 3O3NB 1P2DA 3Q1KA 4IHJA 4O2RA 5E4JA 5AKKA 3HKDA 3L7YA 1MW9X 3T5BA 1SUBA 4R7GA 4LHEA 4D8VA 1NBWB 1M54A 1FP1D 1YQTA 3EODA 4GMGA 2QTFA 1J4AA 3VR6D 3R6TA 1Z0IA 5T4EA 1NC3A 4YP1A 4B4OA 2Y99A 4EB3A 3ZWYA 4LXHA 4DSUA 1ZMRA 2C96A 4IKOA 4C1BA 3K9QO 2GVNA 1BCRB 2FSPA 1NJ5A 2GCEA 3QX9A 4BFCA 4EUNA 2BPOA 2CNWA 4HNQA 4X1KA 5FUMA 1WDLA 2RIRA 1E2LA 1R37A 4E2WA 3W1VA 4FFLA 3M1LA 1Q22A 4D97A 3C7KA 1AKNA 2ZJYA 3GG2A 3KWFA 4PF1A 1OFIA 3DAGA 1MOQA 3I45A 4UXHA 1CW2B 1Q83A 1T3ZA 2P69A 4JU9A 4MPDA 5I7AA 3TGWA 4GZ3A 4ENSA 2AD5A 4F1KA 4NY1A 1X38A 2JLUA 4CF3A 3DZCA 4F5ZA 8MHTA 1GNRA 2C1EA 4P0PB 1T10A 4CTMA 5K2OA 3WLPA 5BSMA 3ZCRA 2GLXA 4HDAA 1AKTA 4RPJA 5A62A 4KYIB 4Q9JA 4ZT7A 1WJGA 5LQRA 3TZCA 4EFMA 1FFSA 4IEIA 4BX9A 4B6GA 1P0FA 1G7RA 2PK3A 3GJSA 4NBLA 3NTVA 4PBTA 2L2QA 3PFIA 4Y7DA 5IKOA 1EH5A 3F6RA 3H84A 1U4NA 2VNKA 1LJ8A 2YFYA 2VCEA 3G49A 3NOQA 1Y5NA 1DU4A 2NW6A 2GRJA 3QPWA 4K3VA 1W1WA 1OAKA 3AG6A 3QTLA 3RG8A 4M60A 1V47A 2OD9A 3K8OE 3NHAA 4KQWA 1IPEA 3REGA 4KWTA 2DH6A 1AU9A 3KB8A 3V6MA 1HG1A 3TLZA 1I33A 3UJHA 1MJFA 1J23A 5EINA 4XWWA 2Z43A 3NV7A 4PNPA 3UPTA 4LHWA 4DR6B 2I3AA 1OFUX 1QF9A 3AFIA 3N2IA 3RE1A 5BRJA 621PA 3ULKA 1KGSA 1XJ0A 3QEKA 3QKIA 3R4VA 4NCKA 1KRHA 1NSTA 2QUBA 4O8ZA 3B70A 2JRCA 5AVZA 3F5FA 1U6KA 5AIAA 5TEWA 4RY2A 4RTKA 1Y48E 3HNRA 1CB0A 2INGX 3O1JC 3M4ZA 4U2CA 1CZOA 4AY2A 1YL6A 3A31A 1KO1A 1KYYA 1RFGE 1YB7A 3UMVA 3ZI0A 1ISIA 3MFYA 3WS7A 4LC1A 2DFKB 5CLJA 3JQGA 1CJTC 2K7FA 4MGYR 5FLEX 1KEUA 3CUKA 3ROEA 4AKHA 1MB3A 3BXGA 1T2CA 3BGIA 4LBZA 5KVVA 4F3KA 2ZVJA 3TLCA 1E59A 4I4CA 2GX6A 5IX8A 5DDIP 3UT5B 3T52A 3WGVA 1ZP6A 5EZ6B 5M29A 2GBGA 2GYYA 4O4IF 2Q1SA 3OX2A 2Z5LA 3HCAA 2JGRA 4US0R 1E9RA 4FDVA 1DOAA 1KEEB 1RW4A 2QK4A 1UBMS 4FOLA 4XYMA 4Q1EA 2XGMA 3TZKA 4FBMA 1W0KA 1Z17A 1SXJB 3K0AB 3NTUA 1F20A 2PAFA 3C87A 4OQFA 3H86A 1SMKA 3ITNA 2VHJA 2QRQA 1DIOB 1JIQA 2EX1A 1MAUA 1PR2A 4H18A 5IW8A 4RIIA 2F43A 4QT0A 1FXUA 1J8VA 2OSBA 3QMVA 3V8BA 1O08A 4KPGA 2HXYA 2HJWA 4TTIA 1OR8A 2HF7A 3O0TA 1LX7A 4LSZA 3I8SA 4X8MA 3UGQA 4EZBA 1TYCA 5LSAA 1ADYA 1IDOA 1T5SA 2CLSA 2WYWA 2PV0A 4LQCA 2F90A 1DXHA 3DT6A 1SH7A 5EXEA 3KR9A 2DLCX 3NAGA 1H9AA 1NVXQ 1UZLA 2ZUVA 1A97A 1YE3A 3DJFA 3H97A 3TFWA 1U0OC 4DCTA 4DN6A 4CM8A 2XDQB 2QX7A 1VG0B 4CTOA 3K0SA 5BW8A 2VSNA 2D2XA 1B1AA 5F9FA 3EMDA 1EFHA 3MT8A 2H1LA 3SBOA 3O21A 1VHDA 2FGJA 4U9UA 3BE6A 2P5TB 3U40A 2JI4A 1EEHA 1BCSA 2HWWA 3CV3A 3DWIA 4NK5A 4WECA 3EEIA 3EA4A 2PT9A 3G0GA 3V2HA 4DS3A 4B7XA 2CUTA 2R1TB 2CUKA 1YZHA 4J1GA 4OQQA 3QUQA 3H11B 5CD1A 3JTEA 4UBNA 4F5WA 4D9GA 1YACA 2E6UX 2XMCA 3DBOB 4LGMA 5JROA 5TT1A 2GETA 4YAWA 1XEXA 3BZBA 5F1OA 1QC5B 2GUWA 4M4SA 4ATNA 4FYMA 4HY3A 2G0AA 2WHYA 3P5BA 4G24A 1OFUA 4J0FA 3TOXA 1KAHA 4I66A 2PUFA 1N2HA 1NQXA 3INGA 2ZRLA 1EXDA 3ZZUA 5K4HA 3R9WA 1YS7A 2YHSA 2FPSA 2VJAA 4PBRA 4F71A 1LB1B 2HSEA 5JSQA 4FFRA 1CQXA 3T3PB 2V6JA 3OZIA 1NR7A 2J3KA 3AKCA 2P6MA 1N0HA 3JWEA 1ICIA 1OYWA 5EGSA 5F21A 2HRRA 3EIUA 4X97A 4RTMA 10MHA 4KN8A 4PFKA 1KI6B 4E1AA 2BFNA 4RVOA 3TYXA 3V8MA 3L6DA 2B6HA 2ZVQX 4Q1FA 4E6EA 4MIEA 2ZRPA 2J6CA 3BCHA 3QKTA 2G07A 2X0KA 4NV0A 5IM4A 4I55B 4GGMX 1G21E 2QVBA 3ICCA 5H82A 2JFQA 4KO4S 4OQEA 1JSRA 3WLNA 1U63A 2EFYA 3LTEA 3IO5A 1W4RA 2O5RA 5A02A 1V5GA 1K8ZB 3Q1LA 2HMVA 5C46F 3U4QB 3RS0A 4BGIA 1H6AA 4YA6A 3SC6A 4MUEA 1VG8A 2PX5A 4EQ6B 1QIIA 4TXMA 5F76A 4BZWA 1PZEA 3PT5A 3TZQA 5HQTA 2EZ8A 1P81A 2DECA 2DE0X 1QRUA 2QX6A 1N2SA 3L8MA 4OF4A 4Q1CA 3GJTA 1SZDA 2HIHA 3OQBA 3GF4A 2RJNA 3TRDA 5PNTA 1JAZA 4EARA 5CYOA 2ATCA 2ZUCA 3CW2A 4HJXA 3PQ6A 3TPCA 4B6QA 1X7DA 1NWCA 1IHPA 1GRNA 1YI0A 5ESWA 4TZ6A 5KTSA 1D2HA 1VLJA 4P98A 3WK8A 4AG6A 1FYWA 5ABPA 3CMCO 2HRBA 1QZTA 1XFAA 4YCMA 1VCMA 3IEXA 5EP4A 1UINA 3HABA 1FFGA 1GGFA 1P19A 1GPH1 3VV2A 5ICEA 1UPCA 4YMGA 5J23A 4WINA 2FG5A 4KUGA 4MQEB 4KQMA 2BFEA 4JEIA 1T2DA 1KARA 3P9NA 3R5XA 3ANSA 2RG7A 3QKRB 5C35A 3ZLTA 3E70C 3LO5A 2ECFA 4HYEA 2RGEA 3I9OA 4C3ZA 3DV0A 1NZFA 4P3OA 1V8FA 4MUMA 2EDAA 2R0QC 5F7OA 5KNLA 1E7QA 2YYSA 3EFBA 3LYHA 2A5DA 1EP2B 1M6YA 4I1SA 3FVQA 4HSGA 5E3IA 2JLYA 4AC9A 4IMRA 2Y92A 1EM8A 4RY8A 1GDDA 2DFPA 1HX7A 2XNDD 1JECA 1Z6YA 2OBMA 1UKVY 1ZK4A 1CVIA 4IHAA 1LY1A 2BY4A 3SI7A 3VYSB 5AVKA 1G8GA 1UKZA 1Y7IA 2XNJA 5IDWA 1YFJA 1ADCA 1W4ZA 4CDNA 5BSHA 1MLDA 5AVJA 3FAZA 4LDRA 1MJHA 1UPUA 1QH1A 3IKJA 1YHZA 2FWJA 1N25A 3HJTA 4ESHA 1N6HA 2I2XB 3AJDA 4H1VA 1BWPA 1NF9A 4OHBA 4D98A 1E8MA 4LQLA 1OROA 1XPJA 3ZVMA 3QVKA 2ET6A 5FB3A 2Y1CA 1Q2UA 3FUWA 4CWAA 5CT9A 3QJYA 5IDVA 1R9JA 3ZV6A 4ZVNA 1E9BA 3OZAA 3PKJA 2CLKB 3RW9A 3KXIA 2IHKA 3K96A 4NYIQ 3PDIB 5DISB 5K0BA 4GKJB 2EWVA 1W4LA 1KS9A 4H15A 1JA0A 5CW2A 4B5LA 2XRMA 2FMFA 3QPBA 5F5NA 3ZR4B 2RONA 5IAAA 1FYDA 2ZSHA 3P9YA 2IKSA 2OUKA 1KTIA 2YJ5A 5D6OA 1FS6A 1N8KA 1XDUA 3QXGA 2H5IA 4FOPA 2GCIA 3X43A 4DLNA 1P9WA 3DCNA 4L51A 4Z86A 1T9ZA 5GM2A 3UAYA 3G9QA 4KH0A 1OLSA 4HWTA 3FROA 4PYNA 3WDMA 3C3MA 4GFDA 5DYWA 2WMDA 3KRTA 4S1PA 1HC7A 1GVHA 5JS8A 1AK2A 1M5UA 3R5TA 2V03A 2Z57A 1SVWA 1U7PA 2CEAA 3GUCA 1I2BA 5I48A 4ENVA 5KU7A 2WMOB 4EPWA 3D2AA 1UZAA 1XLTA 1H6DA 4G0ZA 1B41A 1II8A 3V4ZA 5FLXA 3NM4A 1H2HA 3TRIA 2G5GX 3HYLA 5B1SA 1ND6A 3WLQA 4RTQA 1CFZA 1TW3A 2ASEA 3KR1A 1E2UA 5KAMA 4C4RA 5JY1A 4ZREA 3U4DA 3WK6A 1K6IA 3IEUA 2QA5A 4ASUD 3K20A 2WKSA 3VNUA 3NDJA 5EIWA 2HMWA 1BXGB 1Z47A 1UC5B 2BM0A 2O3TA 3A58B 1Z3IX 2JFHA 2XNCA 4Y3UA 3SBEA 1MORA 5CU7A 2AFIB 3PC8A 2CNKA 3AUJB 5CVCA 1VE5A 3H04A 3FUUA 4A0GA 4BXOA 4BNYA 2RJ3A 5HM8A 4UM8B 1US8A 3ANTA 3D6HA 4HQFA 1EK0A 1M2NA 1HETA 2VT6A 3K9LA 1ZOSA 2EL7A 4AS3A 4IMJB 4LDZA 1V45E 4OHWA 1MJ5A 1Y9DA 4JKIA 4E5YA 1EIWA 4M55A 5AHWA 1OJ7A 4DUGD 2PS3A 3RU7A 2CKMA 1SOWA 1OC4A 2OOSA 7REQA 1EE2A 4TMYA 2WJZB 3ABIA 4L72A 4NZZA 3U3OA 3EXIA 1O03A 3VYUB 5AOAA 1G18A 1W2GA 3MJSA 5HFNA 4TGLA 1IQUA 4A0RA 1Z4MA 4ECAA 1GQ2A 3OFNA 4DA4A 4UBMA 5DGIA 3BIWA 1S89A 1ZK2A 5JD4A 3FZNA 3OPVA 4BHTA 4KNWA 4AP9A 4TXNA 4QECA 1S8NA 3AF5A 3CJTA 4JD5A 3EIOA 4QDZA 1GFSA 1JV2B 3Q9SA 4ABYA 1YS2X 2JFPA 4B3TB 1G2IA 1P73A 1XZHA 1ZJ5A 2XZTA 5AKYA 1XJ5A 3V80A 1ZVVA 4ZKDA 2NZXA 1URPA 3HBAA 4GLBA 8GPBA 3ADDA 1U3FA 2I5PO 3JQBC 2ZYAA 4IAOA 1ABBA 5JI2E 4LX8A 1N2IA 3TQRA 4YLGA 1JPVA 1P7VA 1Q95A 3BD6A 4Q48A 1KE2A 5FDFA 2ZRMA 3DMYA 1AZTA 5BV7A 3MS2A 4BVJA 1KVRA 1JDVA 2EARA 3LLVA 2J6HA 4K6HA 4EYGA 5JSUA 3AP2A 4LRTB 1UBFA 3STUA 4CF6A 4OKIA 1WV0A 1MC4A 1XAJA 3FPJA 1ZVQA 4IH9A 1LBTA 3QI2A 1ESZA 1I7PA 1QYRA 4YI5A 1VKNA 4L07A 3T7EA 1XZAA 2X9GA 5DTMA 4A6DA 5JZBA 4IDUB 2NO0A 4F5DA 3GCGA 3GWZA 1W9MA 2BH2A 3KP1A 1PZFA 1JZSA 4A0QA 5BQXA 4LOKA 4LVOA 1DIGA 4GYWA 3RHSA 1IWBB 1PK8A 2AUMA 1X1TA 4HCJA 2I2AA 1OWLA 4FMDB 4LY9A 1ZQ1A 4PRYA 3QKSB 4BOYA 3A4YA 4PGHA 1L4YA 4WOCA 1NFRA 1YZTA 1KVUA 4QASA 3ZDBA 1S0UA 1PVDA 4DSZA 2QQFA 4GDMA 2C7QA 1YZQA 1FUYB 2CVQA 3GLVA 3AIKA 1D2CA 1U6IA 2VJLA 4Z0TA 1YR8A 3SJBA 3UAGA 4BX3A 1FX1A 1G3QA 1E6LA 1MENA 4ER7A 4OY3A 1R88A 2W2LD 1RC1A 2WMYA 1DJPA 1KEWA 4JYBA 1YDFA 1O7JA 2FQYA 3E9RA 3G8DA 1KQGA 3OFKA 4G4JA 3SDBA 3E03A 1VLMA 1UC4B 3UHJA 1XMSA 5HTOA 3AEKB 2D62A 4YYEA 4CI9A 4UUMA 1Z6XA 5I3ZA 3RBAA 3AUAA 1CPYA 4DQXA 4HAVA 2QZ4A 1IIBA 5AJTA 3GT4A 3HB5X 5EJ9A 3Q8LA 4AY6A 1QB7A 3RIHA 1N5KA 3QW2A 4RLFA 3WLSA 4DJ5X 4Q1BA 3G5TA 1W4CA 1D03A 3IOCA 1M6VB 1XAGA 5C1BA 2XUPA 1U2ZA 2I2WA 2FPOA 5FLYA 2FPXA 1F0NA 3QLVA 4AJEA 1PNRA 3VKWA 3BYZA 1U0GA 2YXDA 4G8BA 4YJHA 4HVCA 4WESB 5BQ5A 1X7WB 2QTNA 2QSUA 1QG2A 2JHGA 3GMTA 1WS6A 2L42A 2P7IA 3L7NA 4MKGA 4MZXA 4PZUA 2IU4A 4ZZ3A 1TO1E 4MCJA 3JARA 3WBBA 4CFZA 4JFAA 2GTHA 5A3RA 1GARA 5ECDA 1Z5OA 5JXWA 5FUVA 2XDQA 1GN8A 2A88A 2WF6A 3R3SA 4AXXA 2H8KA 1GAEO 1U5CA 1QHEA 3AO0B 4O0LA 4OB7A 2FWAA 4RJ2A 4NBRA 1G291 3QPUA 2YJZA 3E3OA 4WL0A 1IJBA 1RR6A 3DZDA 2QGFA 2O8EB 4QVGA 5I45A 3IODA 1ZUHA 3G6WA 5HIIA 1INLA 3R5KA 1VE6A 2VLBA 4H7KA 1JT9A 1NUAA 1U11A 1T3TA 2NZWA 1Q92A 3IJ5A 1U81A 3T3NA 1DAPA 1PQWA 4G84A 1TZMA 4YCAA 1XGKA 5J2TF 4ZV4A 3IIIA 2BHSA 5EJMA 3ROGA 1UK7A 3VH2A 1JH8A 4FW8A 4E31A 4IVPA 2CFTA 1LPAB 1WQ1R 5KNDH 2A9OA 2P4EA 2YH2A 3OMXA 5G41A 1M2VA 1XUOA 2VUHB 4D02A 2ZUSA 1BOOA 4GW3A 4GC5A 4B4WA 3HYNA 4M0MA 3TDNA 5KAPA 1JDBC 4RAQA 3GLFE 2QEQA 3D0QA 3H5WA 5ALHA 1FU4A 1IZ0A 1GR0A 3EWSA 2WZDA 3OPQA 3NEJA 4QBTA 4RXTA 4QFBA 2DT5A 5L7WA 4IGEA 3DVAB 3BDVA 2FN7A 1U28A 1DS6A 3LRTA 4IIVA 5E4FA 3RQSA 4BPRA 1SKBA 1XD9A 2Z04A 4W9RA 3JALB 5FV4A 1BAPA 2PZBA 4XRRA 3V5NA 3DXXA 4GE0A 4TLCA 2WHXA 1QUEA 3MGBA 1B14A 4UKDA 3ZW7A 3EOBI 3OPXA 3KOUA 1Y6ZA 3CLTC 5LMNB 4WQMA 3ZX5A 4TKVA 1RPZA 1SCQA 1E60A 1Y3FE 1D2RA 2HDHA 4X92A 5B1YA 3HFJA 4KFUA 2A35A 3I34X 4U9IS 4EA9A 1O4WA 1BWRA 5IXYA 1EA7A 1RKXA 4N8EA 3D3WB 4AG5A 3G3EA 1U7UA 3GFGA 2YFKA 5CXSA 2JHPA 3WMEA 1F0YA 4NF2A 4BFLA 4Q7EA 3EPHA 3WGUA 1IEVA 2NO7A 5KQMA 1RC0A 3O9ZA 2BT4A 3D2LA 2Y3IA 3C3JA 1NYTA 4RUKA 2AE2A 2HADA 3CE6A 2HEGA 2AHRA 4FIZA 3HCRA 2YBDA 3PXXA 3QNMA 4R2XA 1J6UA 2OFOA 3ADPA 3I04A 4GVPA 2OWDA 4QQRA 1PR4A 1DAGA 1W0JD 3NU1A 4HK4A 4EHFA 3FTNA 2C42A 2HUPA 3UB2A 1GAQA 3VA7A 1LVGA 2CVFA 1GPMA 5LZ5A 1RIFA 1S7GA 1E5DA 4MV1A 5KOJA 5TNXA 2ATVA 3JASA 3FPBA 4QU8A 4RHYA 4BFSA 3IBSA 3PA6A 4RTLA 1XXHB 1M0EA 2CYBA 1OXKB 5LJLA 4DSOA 4IV5A 4NZMA 1CY1A 3NXSA 4OAQA 4OI4A 4PSCA 4UFNA 5BNIA 3NEPX 5LYJF 1C2TA 1KXZA 1KH1A 3ZGZA 1P31A 3RRNA 4N0DA 2PL5A 2PM8A 2VBGA 2ZZKA 3GUZA 3ZIUA 1YQGA 4IH4A 3O8NA 3CEJA 4GXRA 2PZGA 4Q66C 4S05A 4N03A 3WC4A 2A58A 2VF4X 1XWWA 3NC1C 3AR6A 4YMHA 1KEZA 1PDOA 2FR8A 1IZ7A 2UYGA 1FDOA 3BMXA 4ISBA 2JZCA 2WD8A 2D5BA 3B85A 3QEAZ 1F2TA 3E9DA 5DPMA 2G4LA 3HVIA 1NBME 2HTEA 2EQBA 2W98A 3A6ZA 1GA4A 2V6MA 1LZLA 3R0JA 3QELB 1DCMA 4NCIA 2XVMA 2Z08A 1EI9A 1XCPA 4FYHA 3RVPA 4CG3A 2QGZA 4ERNA 1GZ6A 2C5EA 2OENG 3WL5A 2D8MA 1TYDE 3C4QA 4C29A 3FGNA 2YW2A 1P9NA 1I1NA 3B52X 2IYQA 4U1RA 4CCAA 1UBGA 3TK1A 4DLZA 4S1WA 2WSYB 3HR8A 2QT1A 3HRKA 4F96A 3RC9A 3LL7A 2BE9A 4MGIR 4ON9A 4YCLA 3ZE1B 3L5OA 4KIGA 1L5HA 3TECE 1R0WA 2OG2A 1YA6A 4QOIA 1V8PA 4DUPA 1JTEA 4RACA 3O7WA 3DE6X 3SQNA 2G9QA 4URFA 1SHLA 3VMMA 2CMHA 1OAOC 3BK2A 1CY4A 1GEEA 3NHKA 4MLDA 3U62A 4R9UC 3MCZA 5L6MB 2JFZA 4MHTA 4L9AA 2WKPA 3UYKA 2DFDA 2ZYUX 4NMMA 3AU8A 3RV4A 3DMNA 2CBXA 2YX1A 3JD1A 1J22A 2QPTA 4MWDA 4A73A 4B2YA 4ZMRA 5JMOA 3D6VA 1A8IA 2GPJA 3UJPA 3F3MA 1N3YA 3MMPA 9ABPA 1ANKA 1UMKA 1Y3CE 2OQ2A 3Q7SA 3D3QA 4J43A 1VPTA 3W0LB 4AO7A 2NZ2A 2YKGA 2IYRA 4F2HA 2PWBA 2ZSFA 4XARA 1ML3A 3PR3A 1JXMA 1RQXA 3FDXA 3U48A 3EMBA 1EVEA 1FDVA 4C5AA 4DUGA 5J2TB 1HM5A 1GO2A 5CBKA 3E1GA 3OCVA 3SOPA 3TZ6A 2WG2A 1HL3A 1QO7A 1Q7EA 1D6NA 3GARA 3N2YA 5MF6A 4JELA 1C1HA 3AEQA 2DPMA 1RAAA 2DBQA 5DSTA 2WFMA 1EXMA 1GCGA 4NX2A 3SICE 3ZY5A 4Z1OA 4MLZA 4IXTA 3U5TA 4XOIA 1XPRA 2Q5HA 1BXRB 1YHYA 1VXOA 1YQWA 3OX3A 3L8GA 3GFQA 1QTQA 5HJ5A 1U5AA 4KR6A 2I34A 4M53A 1WWKA 5EQTA 2FHSA 2XQKA 1HT3A 4OA5A 2WMNB 3LOPA 3EW9A 3HY3A 1HYEA 4DDKA 2WTAA 1EVIA 5AW0A 5B2ZA 1QZXA 3IGFA 3PU6A 3ZDDA 3K5WA 4C4YA 3PUYA 4YJGB 1N6IA 4NCAA 1E0SA 1U8YA 3V4SA 2RAVA 5D3MB 1HY3A 5ALZA 2ZCJA 4HWGA 3A1NA 1EZ4A 1AY0A 1N7GA 4KNVA 1VZ3A 5CIWA 3VR5A 1HDCA 2ORED 2PRIA 3WZMA 5GZ6A 2I4TA 1I36A 1DT3A 4HAYA 4PTLA 4OGWA 2RB4A 2P9QA 3VGJA 4C05A 2GXAA 3THYB 3HSKA 3AH8A 4RD4A 5K5EA 1TT7A 1VLVA 1QIKA 3SHOA 1SCKA 3MJDA 3GP5A 4E7OA 4LHYA 1DQZA 4D8UA 4AECA 4E3ZA 2AWNA 3ROMA 2YWRA 3IPLA 2P3OA 5A4DA 2CE2X 2O7VA 4L2IB 3DAHA 4DABA 2M2IA 1KSJA 4QGHA 1H65A 4TVOA 5COBA 2AZ4A 2WHEA 4BNDA 4BYGA 1Z0AA 3I72A 1YCFA 3I9V6 3WYNA 1EBUA 2RB5A 3TFQA 4D42A 1TRHA 3MLEA 2F3RA 5IM4F 3CF4G 1BS1A 3EZFA 3W2EA 3JARB 1KO7A 1Q0LA 1E2QA 2Z09A 2WKRA 1I24A 5BWCA 3PX2A 3QVSA 1TTQB 2ZROA 3WGJA 3HZOA 3CA8A 2UVQA 1VL1A 5ILGA 4AW9A 2CJWA 5B7QA 1QP0A 2H2WA 4YEDA 3IDOA 2QRNA 1F12A 4FMCB 5G0WA 1IN8A 1N2CB 3VYVA 5EP2A 1UCFA 3EIQA 2OKCA 2VTBB 5BRNA 4MITA 2JLSA 1CZNA 4XPIA 2XYGA 3ST7A 5DX0A 5KQLA 1HGXA 5LVAA 2BISA 4YJKA 2XPCA 3ETJA 2NX2A 2VAMA 1COWD 2Q9UA 3MWDB 5CNMA 1MA3A 1WHTB 1FFXA 3UNXA 2C7PA 1O9GA 1U3VA 4KE7A 2IXEA 1YVUA 3OU6A 2OL4A 2GJ8A 2QNBA 4OHYA 5LLTA 3FFBA 1TEVA 4OSEA 5CA1A 3HO1A 1UDRA 3DYIA 1HURA 2RHBA 1A9XB 3B9QA 3SN6A 1JMVA 4MVJI 3VSBA 3C97A 4IMIB 3T9FA 1XXLA 3EN0A 1CUDA 2JGIA 4XDGA 2GH1A 2EEZA 3DGEC 3EVDA 4WK0B 4CQJA 1L4BA 2Q5CA 5TMEA 1JEAA 1VL6A 2HCJB 5GMOA 4XRGA 4F2PA 1KIMA 1ZHFA 3L05A 4BASA 2AMVA 1V1JA 5DE3A 3PQ8A 3ZQUA 4R2HA 5JECA 4HDSB 1N33B 1PYDA 5HW0A 2QBYA 3OE5A 3WJ7A 5ITZA 1J24A 1PQ4A 4DDVA 1ZHOA 5CUQA 1RYHA 2QSJA 5CLQA 1UXIA 1KERA 1JIKA 1RZ3A 1P2GA 2P2SA 5DYTA 4IZHA 3S2EA 5K45A 2AEMA 2J31A 2J33A 4C22A 2EZ4A 1A9RA 2MSKA 4LGVA 3LIIA 3MPOA 4R16A 4K40A 4X84A 3LD9A 3UO8B 5C18A 1Z7WA 4EPTA 4I3GA 3GB9A 3IDSA 2QD1A 4QGSA 3DOUA 3RFXA 5JATA 1XA4A 4QTYA 1HT1E 1PW7A 3ET5A 2I1VB 3CX3A 2BKLA 2DVMA 4W5WA 3C5WP 1E2EA 1XDZA 2JD0A 3ZD8A 1Q0ZA 3BGDA 3MTAA 4K6FA 3WO1A 2V0NA 4OJTA 3NNNA 4AJ9A 4PQRA 2DJIA 1DX4A 2PTGA 3A4TA 4H77A 3OG9A 4JSRA 4G2TA 3TNDA 4BBZA 4QGAA 2VH1A 2VHZA 3LF1A 2R3SA 4GD3Q 4KLNA 4PNEA 1SHJA 3II6X 3RYFB 3S29A 3BKWA 3LHDA 1AS0A 2RAFA 2ZE5A 5TMDA 1GITA 5HRUA 4Z4GA 3E7FA 2H1OA 4QRIA 3WYDA 2HPHA 1NJ1A 1OZGA 4P9NA 4D4IA 3AUSA 3ILVA 1ATZA 3L46A 4HBGA 4JJIA 1ZWKA 5JZVA 1XD8A 3IXLA 3BJZA 2C00A 2G8NA 2JI6A 3DV2A 3PQ4A 1GADO 3R5HA 1IH8A 1IJKA 3FPAA 2IXDA 1NV9A 5FIUA 2D06A 1FRVA 2RAPA 4J94A 1NQOA 2PBFA 5ERXA 2IXBA 3QF4B 1XU7A 4HV4A 4L8YA 2GD6A 4GPIB 4JR1A 2PNFA 5FOXA 3TR0A 1JHPA 1FTGA 2CV0A 1N5DA 3PYLA 2I8AA 4OAPA 4S04A 1BE8A 4CJXA 2J30A 2JGJA 4YUAA 4FZJA 4GU5A 4FOTA 2GM4A 2J0SA 3WYCA 3CTPA 4AF7A 3NHPA 3BWDD 3PFBA 1SVUA 2RARA 2VJPA 3TQQA 4CLOA 1CDDA 1CIPA 3MINB 3DXZA 4J0EA 4KB5A 2OE2A 4J6FA 2KB0A 3TNLA 4ER5A 2PLNA 3F71A 1NLYA 3DVLA 4FQ5A 3DMFA 5BN5A 2O8FA 3GP8A 2YN0A 5ARCA 2EF1A 1VECA 3PGLA 3ISVA 3CZ9A 3CURA 3COSA 4CKEA 4NV3A 1DT5A 1MVLA 5ALQA 3IKLA 5TXGA 2FRXA 4KRXA 1RYMA 2BE7A 2JIBA 1MNQA 3KFVA 4X63A 1N0VC 1LI4A 2EKDA 2G9VA 4PYMA 4CF5A 1U2SA 3IL2A 5E3HA 5EPEA 4EA6A 1RAHA 2R6FA 2X4DA 3DKVA 3D3EA 4PSAA 2UKDA 2XTZA 2FW6A 4F1JA 4S0XA 5A6SA 3KT6A 1DIRA 3UA3A 1Q50A 1FFBA 4C7OA 3N59A 1X3LA 3T34A 3P9RA 4NHEA 2O54A 2PKXA 4P7BA 3WK7A 2GR9A 4RMIA 1ZNYA 2Y66A 1FTWA 5JXJA 4JLKA 1OU4A 1RPNA 1SCAA 5C32A 4ZALA 1DJLA 1XMVA 3BMCA 4JL6A 3STYA 3WKAA 3EASA 1YRAA 4D6PA 1EDOA 1WNTA 3MMXA 4KJXA 2NWQA 1CE8B 2ZUWA 4ODIA 5K0LA 1Y82A 3TL6A 4PW0A 2HWXA 2WYUA 3DCYA 1HSOA 1ZL2A 3ZU2A 4I8DA 1ISPA 2DPLA 3DE1X 1SY7A 2YJTD 2YVQA 1HNWB 5IF9A 1OX4A 5BNZA 1ULHA 1AJEA 2WINI 1T6NA 4OQNA 1AT1A 4G0UA 1ZQ9A 3LL4A 1DQRA 2QJRA 4DG5A 2FSIA 2MYPA 4WEQA 3AF3A 4HADA 3ETGA 3KU1A 3ZYCA 4JP3A 5HS4A 2G1PA 2O5EA 1DTWB 2AN5A 4F0JA 4FLEA 1ECGA 4YACA 1P2TA 1THMA 4WWHA 3GT7A 1E1RD 1UBJS 2FYTA 1BQ4A 1RKUA 3CE9A 3UHOA 1M7HA 1G5TA 3GZTB 3WDKA 3BIFA 1P4RA 3ORFA 4N39A 1X70A 4CKWB 3LF2A 4ITUA 1P5FA 4OLJA 4ZDWA 3P0JA 5DO9A 5H3LA 2YW9A 3N7AA 2BZGA 3FNIA 3BJMA 1E1NA 2P65A 2XTNA 4X64B 1FBTA 1QHGA 2PX2A 4TN1A 5F5LA 5HBRA 2DY1A 1I9GA 3H2JA 1SVLA 4DR3B 2FVYA 2XEDA 2SKCA 4QOHA 2WKQA 3Q10A 4E6PA 5LCXA 4FFWA 1ZS9A 1AXGA 2E37A 3B1YA 1RS0A 2C9MA 3THXA 2CKDA 5FOUA 3SHFA 3GYGA 5FI5A 3UFXA 1VTKA 2M1ZA 3ZE2B 4U7DA 3OKFA 3NBKA 4KG7A 1XWFA 5E0OA 2JAXA 2PLAA 1ZA2A 1GKLA 3CF6R 3UMSA 1ODKA 3P4XA 1T5OA 1T5HX 1EU1A 4MK4A 1DAKA 4LRSB 2ZPUA 4RKFA 4HWSA 2R1VB 1KETA 3Q7QA 4NS1A 4HLCA 1B8UA 1SHZA 5CH8A 2CN1A 4XYGA 1N9KA 1J2YA 1PR9A 4X1YB 2EFHB 1D2GA 2FLKA 2JCYA 2PJZA 4UHDA 2CJPA 2DHDA 3K5IA 5I7RA 5JD5A 1OLUB 1I01A 4IIJA 4QFMA 2W6NA 2GEBA 2VZ0A 4JHLA 4NNJA 7YASA 4WHMA 3BB4A 4FU0A 4BU1A 4EG5A 2J32A 4AJPA 1OXXK 3HTXA 2ZBUA 1W94A 2AGVA 1LH0A 4F60A 1HK7A 1LU9A 1QLHA 5CA1B 2ST1A 2A5GA 3KPVA 5BOVA 3ECAA 1O6BA 4FYIA 2X3FA 4CNBA 1JHVA 2BR4A 2CLMB 3I42A 1FFXB 2DAPA 1FFEA 2PIDA 5A3SA 1JAHA 4CKYA 1P6QA 1JYFA 1I2ZA 5TQ0A 2PRSA 3S40A 3VR3D 4MCAA 1NMZA 1RM4A 2OHJA 5M2QA 3W4IA 1H05A 3WGYA 1WCV1 3NBMA 5CDTA 5I4BA 2IIQA 2EAUA 4PYQA 4RZXA 1V5FA 4D0NA 3LXMA 4K0RA 1D6MA 1X1BA 4YUXA 5KYWA 4W9MC 4J7CA 4XVQA 2PUBA 3HXKA 1BTOA 2FP4A 2QAIA 2JAWA 4NU8X 3H11A 4DHEA 2B2XA 2GWHA 2O5VA 3A6HA 3QA9A 3R3UA 4YT8A 1PWZA 2YMPA 1NHGA 4BMVA 2R25B 1C8BA 3DNPA 2GBPA 2O6HA 1JQLB 1QG0A 5CJ2A 4Q3AA 4B6FA 1CEEA 2QDKA 3T5PA 5SYNA 1QFZA 1N57A 3WB9A 1K3TA 1HBJA 4ZVQA 1AUXA 4HQNA 4PO1A 3FKQA 3I6YA 1WCIB 4FS8A 3UMGA 2UYHA 5KYGA 3HXOA 2JHAA 1JG7A 2JFUA 4OYHA 5LZ8A 1VI5A 4WSOA 2ZZMA 2X6QA 2N42A 4NOLA 5IXJA 2OB2A 1L7MA 2RGRA 1SCUB 3IBTA 2XNHA 1NVMB 3TNYA 2XQVA 2OCYC 4Y1FA 5JD3A 1YAHA 3Q87B 1OX6A 1GGHA 2GNPA 3GMIA 3IT0A 4MS4A 2JFBA 2HSDA 1A9QA 3GRUA 4M7PA 5AKJA 5EKDA 5LLDA 2WG0A 2WU0A 4L4YA 5THKA 4I9NA 1KJ8A 2ZAMA 4DF3A 1HEUA 2JJ8A 3LGXA 4GSKA 3SF0A 4JI0B 4IDOA 1O4VA 2XXJA 3W3AD 1FSPA 4KWEA 1FLNA 2PJUA 3EOZA 3L0CA 4QO7A 4RJKA 4W9NC 4UUBA 3F73A 1A5SB 2NZUG 2H06A 1B3RA 1Q0QA 4YJHB 5FNVA 5D3MA 5FOSA 3WL6A 1J7JA 3ZKWB 5IDQA 3KHUA 2XBMA 4QLOA 4YJGA 3ITDA 2YQ4A 5ITSA 3ROQA 4V0MA 3ZE9A 3D1VA 1CB7A 2FDCA 5IT5A 4RHEA 4F6RA 5BYBA 4B4UA 1RKVA 3LT0A 1JKJB 1KAMA 1Y3BE 3OOYA 4LVUA 5IVIA 3RUAA 1YOVA 3WVNA 2FUKA 3ML1A 4HEJA 3ZWXA 1S3FA 1P2FA 4R83A 1KVQA 3U4CA 5CFOA 3L7DA 2H9AA 5KYNA 4KN5A 4Q12A 3FOAA 1JFSA 4CMEC 4PLCA 2P67A 4C0BA 4INOA 2IYFA 3HCFA 2HMTA 4HF7A 4UXJA 2O20A 2HLDA 3MYRA 1NY6A 3SEZA 1AB5A 2X7XA 1W48A 3E58A 4QNMA 4PXAA 1BMDA 3ZY2A 1A9YA 5I7UA 1XZ8A 3Q9UA 3OU7A 1MDBA 1NF8A 2VVTA 3PHHA 4GLOA 4OQZA 3UMBA 5A2GA 4RPIA 4F21A 4JMLA 1G4AE 1YU6A 1VGQA 2Y1KA 4Q37A 4QYWA 1L5LA 1GZ7A 5HKBA 3X1ZA 4W7SA 1YHNA 2JJ2A 1AK9A 1TX4B 4F8YA 5JQGB 5GY7A 4H9GA 2XCSB 4LXTA 4OHXA 3KK0A 4G07A 1LNZA 2CHVA 2HSZA 4JYPA 5ICMA 2NYRA 2FV8A 1EDDA 1GPBA 5E1OA 3ZWQA 2WUEA 1QIFA 3HYTA 4AN1A 1G8MA 2MSWA 1ZRMA 5IJ9B 1TOAA 2J0UA 3ZCXA 4B1FA 4X3PA 3DZGA 1NT2A 3A4MA 3HUTA 4LXQA 3B5IA 1YUBA 3NBUA 3O3OB 5A9TA 1OFVA 1Q3TA 2G7MC 4JUBA 4PIMA 4XX1A 2R8ZA 3MCVA 1I1QB 4JYCA 1RJFA 2VZEA 2REOA 1DRUA 1X2EA 4U7GA 4BUZA 2AVNA 1ZW6A 3H7IA 3KZNA 3SYNA 1TJ3A 1IVNA 1ZSNA 3W2TA 4AZWA 3QVMA 1ZKDA 3D6MA 1GN9A 4D8XA 2VHVA 4N6GA 4CKCB 3I4LA 1WCXA 2A0WA 2XKJE 4TS3A 1M10A 4CQLB 2FI1A 4MB2A 1R8YA 2G40A 2G71A 1IIRA 3ZD9A 4FJ2A 1SEVA 4H0NA 5LQMA 2Z6AA 1BFDA 4JJKA 2R7LA 1AQUA 2EJUA 2W6OA 5AQEA 2ZRNA 5F3WB 3DTNA 2IYPA 4PSDA 1AF4A 4LRXA 1YJXA 4B0OA 1AE1A 1IBLB 1D0SA 1Q74A 1XTPA 2ID8A 2DQ4A 4C2TA 5JZSA 1P6XA 2HO5A 2QN7A 2J8ZA 4X45A 2JZOA 2JI9A 3ESAA 3P0RA 5CB4A 3OTOB 1Y6FA 2WJ4A 4HH3C 4I36A 4D74A 4OHVA 4TXLA 1QVVA 4FXPA 1N75A 3NW9A 1A8SA 1MQSA 1QHHB 1WULS 3GGCA