1KBZA

Crystal structure of apo-dtdp-6-deoxy-l-lyxo-4-hexulose reductase (rmld) from salmonella enterica serovar typhimurium
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
298
structure length
298
Chain Sequence
b'MNILLFGKTGQVGWELQRSLAPVGNLIALDVHSKEFCGDFSNPKGVAETVRKLRPDVIVNAAAHTAVDKAESEPELAQLLNATSVEAIAKAANETGAWVVHYSTDYVFPGTGDIPWQETDATSPLNVYGKTKLAGEKALQDNCPKHLIFRTSWVYAGKGNNFAKTMLRLAKERQTLSVINDQYGAPTGAELLADCTAHAIRVALNKPEVAGLYHLVAGGTTTWHDYAALVFDEARKAGITLALTELNAVPTSAYPTPASRPGNSRLNTEKFQRNFDLILPQWELGVKRMLTEMFTTTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dTDP-glucose oxidoreductase
publication title Variation on a theme of SDR. dTDP-6-deoxy-L- lyxo-4-hexulose reductase (RmlD) shows a new Mg2+-dependent dimerization mode.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Oxidoreductase
total genus 98
structure length 298
sequence length 298
ec nomenclature ec 1.1.1.133: dTDP-4-dehydrorhamnose reductase.
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04321 RmlD_sub_bind RmlD substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1kbzA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1kbzA02
3E18A 4TRJA 1WNTA 1IUKA 3QLJA 4J9UE 1QSGA 1Z45A 1DBVO 2I65A 3BIOA 1C14A 2QX7A 4BO7A 4FSHA 1Q0QA 3JYPA 3WIEA 3KSDO 1H5QA 2JJYA 4IIUA 4MVJI 3PJEA 1KBZA 2HMSA 2Q46A 1XU9A 2HRBA 5A06A 3L0DA 3OIGA 3RKRA 4J1TA 4H7PA 1O0SA 4BL5A 5EIOA 3H4VA 4WLUA 1GQQA 5U4QA 4CM4B 3D4PA 1GQ2A 1PGJA 3DWFA 2NVUB 3CUKA 4Y6RA 3W6ZA 3ETEA 5FYDA 1VPDA 3GGOA 3NKLA 1SNYA 1YQGA 4OMUA 4DBVO 2YDYA 5CEEA 3A28A 4L4SA 3VOSA 3R3SA 3G0OA 1NR1A 4BNTA 5A1TA 4YWJA 4YCAA 4ONEA 3GVHA 1GTMA 4J1NA 4A10A 4L8VA 5TX7A 3WGTA 1XGKA 5BNTA 3L9WA 1J49A 4XX0A 3PWKA 5IDQA 2FZEA 5A05A 4MDHA 1Y8QB 4IDCA 2JD1A 3K2EA 2BF7A 4BQPA 2JCYA 2Y1GA 4Q3BA 1JN0A 5GMOA 4MJLA 3RC1A 2OL4A 4MKRA 3QVOA 1LLUA 1T1RA 3K31A 5I9NA 4K1LA 3BHJA 4YT8A 4RPLA 1VL8A 4KTTE 3ZGYA 2NU6A 4JP3A 4U0KA 4GMGA 4J43A 3ZZNA 4EW6A 2CD9A 4KMSA 1OBFO 3JV7A 3RBXA 3TQHA 1HEUA 2PD3A 3ABIA 1GZ4A 2HK9A 1E3SA 4WOKA 4E30A 3BTSA 4PIVA 4UVDA 1JKIA 2AEMA 1EE9A 1ZSYA 1ZW1A 1ZXLA 3QY9A 3NDJA 1DFGA 1PJQA 2GN6A 3BTOA 4L76A 3HWRA 4M54A 3BHIA 4YQYA 5IN5A 2O3SA 3GN2A 4OH1A 3U4DA 5KJ6A 2Y67A 2GZ2A 4XDZA 1HDRA 3MJTA 1OC4A 2FWMX 5KWEA 1WZIA 3RUAA 4Q3NA 1BSVA 3F1KA 3P5SA 4EITA 4DRYA 3ST7A 4NI5A 2W4QA 5AVOA 2EXXA 1VC2A 3D5QA 3FTPA 4R41A 1B8VA 3EZLA 3ZV4A 1ZJYA 4RQTA 3F4LA 5TRTA 2BRUA 3ORFA 1SOVA 3UN1A 1GV1A 2FR1A 4K9DA 3TF5A 1E3IA 1VJ1A 2W2KB 3AW9A 5C3MA 4IXWA 1ORRA 4G81A 4KZPA 4GVLA 5ICMA 6LDHA 5MDHA 1GY8A 4B3IA 4CMEA 2HAEA 2VYVD 3ZWXA 3LC7O 3DAGA 1VL0A 3AJRA 3DBHA 4CL8A 1PJBA 4FS3A 4QT0A 1HE2A 1EEHA 4ZQGA 1S7CA 2BFMA 2D3TA 4AJHA 4NBVA 2FSSA 4Q3DA 2GZ3A 1CRWG 2Y1FA 4AJEA 1T4DA 5A9SB 1BW9A 1I33A 3TL3A 3UHAA 4YXFA 5B4UA 1XLTA 2NU9A 1C1XA 3HADA 1P44A 4QX6A 4ALNA 4I9HA 3IL2A 4BNZA 1NWCA 3ASVA 4UUNA 2C5AA 4BGUA 3PK0A 1H6BA 1VKOA 5F21A 3LLVA 3N58A 8LDHA 3F6YA 1WXDA 2EW8A 2GYYA 4MVJP 4O0LA 2WSBA 1O89A 4R4JA 5AXCA 5JAIA 4IMPA 1A5ZA 1YBAA 2C2YA 4ALMA 3NTQA 1SAYA 3JQAD 1T24A 4B79A 3V1YA 1PQUA 1KEVA 4B7XA 5T6BA 3I9NA 5A02A 1PZFA 3PDUA 3GG2A 4TMFA 3WQQA 3M1LA 2H6EA 3SBOA 4FJ2A 1DRUA 1KY4A 3JYLA 4RO0A 1HETA 1U28A 4IQGA 3QJ5A 2V6MA 5EERA 3WYCA 4EUHA 5KNLA 4IJUA 2Q1TA 4NFYA 2B37A 4U6QA 4I5EA 3TOXA 3GEDA 1FDTA 3R0IA 3WGOA 3WSVA 1ISFA 3ZCXA 1LRLA 2O3JA 2C5EA 3JQ9C 4ALJA 4E5YA 5AXAA 3GZNB 2V65A 2YW9A 1GEEA 1HZZA 1MX3A 3W4KA 1AHIA 4NDNE 3MTJA 5U1PA 4TKMA 4JBGA 4JCOA 2P9GA 1TB4A 3SJUA 4MP6A 4R1UA 3KXDA 4WKGA 3DZBA 4RVUA 1Q2XA 2FR8A 4GQAA 3Q0EA 5EL0A 4BKRA 2WJPA 3WGGA 1OFGA 1QLHA 4LN1A 3BAZA 2WDZA 2VOEA 2V6GA 3VVBA 3OH8A 1HTBA 3E48A 1P33A 2FSVA 2GNAA 1A27A 3AI2A 4KQWA 2GPTA 4HUJA 3UAGA 4I08A 2B4TO 5L7YA 3H5NA 3VDQA 2PGJA 5JYDA 1BVUA 2B5VA 4WJZA 4AICA 3A9WA 3BTVA 4MP3A 5BQFA 1EQ2A 3ROQA 1YB4A 5JCJD 3PVZA 3G3EA 1ZO8A 3FPCA 2PZMA 2Q45A 1MGOA 4E2YA 4E12A 2F1KA 3LQFA 2VWGA 1KYQA 3JQAB 2C7GA 1G0OA 4NZ9A 3OMLA 1E5LA 1ADBA 2P2SA 1LLQA 1U2GA 2VHZA 4DMLA 1LQTA 4BO3A 1ISJA 4YJGB 4P8RA 2QYTA 3AU8A 3DZFA 2Q1UA 1HDYA 1LC0A 1X14A 3I23A 1R4MA 4ILKA 2Q2QA 3Q9UA 4R1NA 4XYBA 4A0SA 2EW2A 4PLZA 5EQFA 1BVRA 1UR5A 4H3VA 4CQLA 4YEDA 1P0FA 1GPDG 2UUOA 4N54A 4M86A 1F8GA 1Y8RB 1P77A 1OI7A 1YVEI 4DC0A 2VWQA 4DQVA 1NFRA 3Q2KA 4DIBA 1ID1A 4W82A 4B4UA 2ZB3A 4IXTA 1DFHA 2VRBA 4RCVA 3ON5A 3W4JA 3LVFO 1NHWA 1YJQA 2UYYA 1R12A 5U9CA 3WFJA 2X0JA 2PK3A 4CV2A 4I9UA 1A7KA 3GHYA 3HUDA 3OJFA 4MVJM 2VZ0A 4Q9NA 4E4YA 2B5WA 4M8SA 5DNAA 4RLSA 5ES3A 3I5MA 5JY1A 1R0KA 4Z9XA 1JLLA 2AA3A 4Z3DA 1W4ZA 2VQ3A 2P91A 4GBJA 3GDGA 5DBIA 4ND5A 4CM7A 2YQ4A 1U4OA 3ANMA 4G65A 1NQOA 2ZB8A 1E6UA 2LDBA 3C3XA 3IAHA 1A4IA 1E1LA 3ZI0A 3E03A 2VUSA 5T8KA 4D43A 1D3AA 1YDWA 3DDNA 4E0BA 5FI3A 4RPGA 4BNGA 1KERA 1T1SA 3ZWVA 3SX2A 4BNYA 3SC4A 5H81A 1C1DB 1ML3A 3MJVA 4CLRA 1JW9B 5B37A 2BMAA 4HX5A 4TWRA 3NEPX 4P4LA 1BHSA 1SB8A 3LT4A 4B4WA 3WJAA 3ZW9A 3ZWMA 4WPGA 4EYEA 1H6CA 1DIBA 4HFRA 3H3JA 3GY0A 1YH3A 5T67A 2H63A 2QHXA 3V1TC 2Q1SA 1X13A 2Y99A 3BXXA 4B7UA 3E8XA 4R69A 4H16A 5EQDA 1P1FA 1N1GA 3IUPA 3OM9A 4MIEA 3U4IA 3H7AA 1NAHA 3HDYA 3I9JA 2J5KA 1YL5A 2D1YA 2YV2A 3PQEA 1Q0LA 3QVXA 1VM6A 2NTJA 3JQ8B 1PS8A 1JWBB 4FFMA 1P74A 2A35A 1JDJA 5JO0A 1ULSA 5L45A 5AOVA 1HZJA 4BNHA 2NVBA 4URFA 1J5PA 4WEQA 1H9BA 3GG9A 1XHLA 1R4NB 3U49A 3RIHA 4CMEC 3VTFA 3RU9A 3DAFA 2CMDA 1SCUA 3KOUA 4CLRB 3VKUA 2DC1A 1HKUA 1E3WA 3HNPA 1SB9A 4PG6A 9LDTA 5JW6A 5A4DA 3KB6A 4WCFA 1DAPA 1T26A 4CV1A 2E48A 1OOEA 1YBMA 4RORA 3O8QA 3FI9A 2FHSA 1X1TA 1YBVA 4QTZA 3NT2A 3ROMA 1XKQA 5EMHA 4J1SA 1ENZA 1OMOA 2GRAA 4BV8A 1FMCA 3G1TA 4E6PA 2P9CA 1NX6A 1PZEA 2FMUA 1M2WA 4OAQA 4EEZA 4BB6A 5TC4A 4UEJA 4JIGA 2YDXA 1LU9A 1NM5A 4JNKA 4GSLA 1PZGA 4LISA 1DJQA 1PS9A 4D42A 2JAPA 2VCYA 3RAJA 3LZ6A 3JD0A 2X5KO 3B1KA 4EGFA 4LSWA 4OM8A 4FCCA 3JQ6A 1AHHA 2ZYAA 4R1SA 5A3VA 1HE5A 3JQBA 3T7EA 3H9JA 4HXYA 4IZHA 4YT5A 5TJHA 4BUCA 4CM8B 1B3RA 2AQHA 5JCXA 1LDYA 1CQJA 3Q3CA 3DBRB 3ZHBA 4I5GA 1IB6A 1XYGA 2GN8A 2I3GA 3GDOA 4CQMA 1I3NA 4BO5A 5DOVA 1JAYA 2C59A 3H5RA 1K0UA 3CTMA 4YYZA 1XQ6A 1MG0A 3E1KA 3RD5A 4FFOA 3SC6A 1EDOA 5CEFA 3A14A 2PH5A 3MJ4A 1JTVA 1S6YA 5FF9A 2ZTUA 2O2SA 3GPIA 1KEWA 4W99A 1HL3A 1N7HA 3C1OA 4AJ4A 4HFMA 8ADHA 1F12A 1NQAO 1ADCA 5ITWA 3EZYA 1RM3A 1KEUA 3JQGB 1ZUD1 4E31A 1EZ4A 2AE2A 4Q3EA 2JFFA 4AJLA 4CM5A 3PJDA 3R3JA 4WK6A 1DIAA 3DMTA 4NG5A 2R00A 3B20A 3BMCB 4YAEA 3IC5A 2OBNA 2P4QA 1IPFA 2UAGA 4UEKA 5L7TA 1HDXA 4DPLA 1QMGA 3K92A 3NX4A 1NQTA 1DHTA 3BMNA 3GVIA 1P3DA 4KP7A 4PLFA 4DYVA 1TI7A 2OO5A 2FOIA 4DMMA 1Y1PA 3WMXA 2CFCA 4BO2A 1NASA 3TFQA 4N5NA 3WWZA 2HMUA 2O2YA 4CLDA 3B1FA 1SPXA 2O3RA 4GL4A 2HKIA 1DFIA 3ETGA 4HP8A 1R16A 1UDAA 2Y1OA 5I7VA 1LRKA 3TPCA 4WLVA 4OL9A 4R9RA 3TJRA 2Z5LA 1WWKA 4YT4A 1BWSA 3OSUA 2UV8A 3ONEA 3AI1A 3UCFA 2WMDA 4Y6PA 5IFLA 3IOYA 3KYDB 1P1JA 4BO9A 1R0LA 4CR6A 4TQGA 4I9NA 3H9UA 1MG5A 3EDMA 4HNHA 4ND1A 2OBYA 2DPGA 3RBZA 3RWBA 5HRUA 3S1LA 5KOIA 4L75A 2ET6A 3W4IA 4PG8A 3VDRA 3GHHA 1NTOA 2BKAA 1EDZA 4DREA 4MVJF 4HV4A 3GA0A 4XD2A 4W9NC 2DQ4A 4IBOA 3QVWA 3ITDA 4DPKA 3I6QA 3FPLA 3DAPA 4FFPA 4WNCA 5L40A 2GF2A 3S2EA 1I10A 4BNNA 5HA5A 2NQ8A 2Y0EA 3GVPA 2NADA 4QECA 2P9EA 2VUTA 2Y93A 4J16A 1NBOA 3DTTA 3ZHXA 2RH4A 2YV1A 4NNJA 1QYCA 2QRJA 5IG2A 4J4HA 3GAFA 4KDEA 1PWXA 2WD8A 5K0ZA 1W73A 2IYOA 4OXYA 5DN9A 3GGGA 4GI2A 4MVJA 1TXGA 2DTDA 3RBVA 3X2EA 1DRWA 3OEYA 1VJ0A 3PHIA 1GQYA 3FNFA 2OFPA 2JAHA 3I9KA 3OJLA 3CEAA 1PR9A 1EFKA 2AG8A 3I4CA 3ZU5A 4CJXA 1TT7A 4F6CA 1LTHR 5IXSA 3AFMA 4CR7A 1UXHA 2XPCA 3GEGA 1E1MA 3K9QO 3MEQA 3M6IA 4Z6KA 4II2A 4LCJA 2X6TA 3PZRA 1J0XO 3QV1A 4OO3A 3PLNA 4PVDA 1GZ6A 4Y9DA 4MKXA 4CMGA 2NNLD 1ENPA 3WX0A 1QYWA 3N7UA 9LDBA 4F3YA 2CNBA 2EJWA 5ENVA 1BXKA 3RUDA 5B1YA 2JFHA 4YB8A 4L0QA 1RM5A 3C7DB 3CMCO 4GWGA 4AJ1A 3L6DA 3MJCA 3HHPA 2PKQP 4GMFA 1ISIA 5KKAA 2HUNA 1DOHA 2I66A 4J7UA 1LC3A 1B2LA 3GNTA 1LSUA 4L73A 3RSHA 1NYTA 5KJ1A 2VUUA 3IJRA 1H6DA 2DUUA 3DTYA 3GOHA 3TZCA 1U3VA 2ZIZA 1HDZA 3WNVA 4CM4A 2ZYGA 2FP4A 4BKOA 4YAKA 2IXAA 3KVOA 1I32A 3WNQA 2NVUA 5BSGA 1BTOA 1PL6A 2YFQA 4WE3A 1BDBA 2YZ7A 1PGPA 5AXBA 1M6WA 4WCFC 3PIIA 3AUSA 3BMQB 4TVOA 1P1RA 4J91A 4FJ1A 4PLYA 1ZVMA 1YRLA 3WGQA 2B69A 2CF6A 5TIIA 2GN9A 2IZ0A 1UH5A 3MCVA 5HBRA 3D3EA 2A4KA 1WLYA 4AL4A 1U3UA 1CQIA 3UCEA 4QXMA 4B4VA 5I9LA 1Y8QA 3TL2A 2EGGA 2Q2VA 1ARZA 2C0CA 1Y81A 2NTNA 4XGNA 2QZZA 2Q3EA 4XCVA 1PQWA 1IYZA 4IZIA 2E49A 2DVMA 3AUUA 1LDGA 1YGYA 1KVQA 1LDEA 1V9LA 5G0SA 3G79A 3STHA 2B83A 3JQBC 2CDCA 1F0YA 5JDCA 3DHEA 4C7JA 4E2XA 2Q2WA 2AG5A 2J3JA 1GU7A 4DVJA 3IP3A 3GRPA 2Z1NA 4D3SA 3R1IA 5DBFA 5KTKA 3TN7A 2PD6A 3VKVA 2X86A 3AY3A 4W6ZA 5F1KA 3KZVA 3HFGA 3HFSA 4GVXA 4B8WA 1E7MA 2PGLA 4G2NA 3ZWBA 2V6FA 5DP2A 4PLWA 4DPMA 3U4CA 1C0PA 2ZB7A 5IDYA 2NM0A 3ONFA 1YE3A 2VYND 1QG6A 1ZIDA 4LRSB 2RAFA 5DT9A 4IQ8A 2CY0A 4E5MA 5KVCA 4DQXA 4J0EA 3ZU2A 1DIRA 1ONOA 2W2KA 3ZHZA 3WLFA 4IDBA 1K3TA 3ADOA 5KVVA 4RGBA 4R5MA 1P1KA 4YTEA 3DZJA 3ZWWA 3V2UA 3VZPA 4BO6A 2BD0A 2IRWA 2D4AA 3HN7A 3ZWYA 3GK3A 1U5CA 4KTVE 1LUAA 4E2ZA 1X15A 5FWNA 3LDHA 4BKQA 4O63O 3PXXA 3AY7A 4LVCA 4XIJA 5TSDA 2ILTA 2I76A 1QP8A 5A9SA 1PIWA 4MIYA 4JBIA 3ZDFA 4UUOA 1I2ZA 4IGEA 4W4TA 3SEFA 1KETA 3KTDA 1QLJA 1DC4A 5C7OO 4YRDA 4A2CA 1E92A 3OIFA 3KV3O 2EKQA 2HJRA 3GT0A 4YDRA 2PKRA 2GLXA 3E9QA 3GVCA 2YUTA 3M1AA 4O59O 5BNIA 4B3JA 1LLCA 3M2PA 1PTJA 3KSZO 1E1KA 2FR0A 5JMWA 2WE8A 1GD1O 3A4VA 2J6IA 4KUHA 5A04A 4UVIA 5MGBA 2WWRA 5TGDA 1HLPA 1KC1A 1PJ4A 3D3WB 4TKLA 5HTOA 3DB2A 3W6UA 1PU2A 5JSFA 2Y0CA 5A9RA 4J49A 3DXFA 1JKJA 4K6FA 3QSGA 2VHVA 2I3AA 3ZU3A 3H3FA 4GPD1 5L53A 5JO9A 1PS0A 1I5RA 3ENKA 4M55A 1XQ1A 1IL0A 3ICPA 3KBOA 5L95A 4EZBA 2YHIB 1A7AA 1XWFA 4CMJA 4L9RA 1HDCA 3GZNA 4I1IA 1O94A 4QO8A 3W1VA 3DHNA 2B0JA 4JX8A 2OXIA 3WSWA 3CKYA 2Q50A 1LI4A 1CJCA 1R37A 3DBLB 3LT0A 1EFLA 3PYLA 5AYVA 3SXPA 4IDEA 2VYVA 4ZQBA 5A5EA 5JXWA 1PWZA 4RJTA 1E5QA 3DZIA 4HFNA 4A5OA 2DLDA 3JQDA 2LDXA 1Y6JA 5TLSA 2G5CA 4R68A 1HF3A 5B12A 2YV3A 2AQ8A 5F5LA 1T2EA 2RIRA 3WQRA 5A5FA 3WTCA 1JVSA 4Z9YA 3NAQA 3WFIA 1DJNA 1BMDA 1PSDA 1CEQA 1A9YA 1K6IA 2OP1A 1ZSVA 1TVEA 1ZSNA 4DL9A 1Z75A 3I3OA 3DFZA 1WVGA 1UJMA 5BSHA 1E7SA 1KEPA 4IUYA 2HRZA 4GGOA 4ND3A 4BV9A 3PPIA 3X2FA 2XAAA 2IXBA 3ULKA 1PJLA 1NPDA 1DHRA 4XQCA 5JAZA 1GYPA 3GN1A 3PLRA 1I2BA 2DM6A 2C07A 3LT1A 4ZD6A 4J90A 5DULA 3JQAA 1ZNQO 4OXNA 3ROPA 2DBVO 3OHSX 3FBTA 2CDAA 3FWNA 2BGKA 2QW8A 3EMKA 1RYEA 5ENDA 2Z95A 2X7HA 4YJGA 4GX0A 1I3LA 2EERA 5B4TA 4P4GA 1Y7TA 5CHEA 4EJMA 4E2WA 1VSVA 1WDKA 3WYEA 3GPDG 1E7RA 3VH2A 2VNSA 3RUCA 2E82A 1EVYA 4RF3A 5DCYA 2JHGA 3ITKA 1P1HA 3FNGA 1Y8RA 4HNGA 2A92A 4BNJA 3WB9A 3O9ZA 4I8XA 4OQYA 3RASA 2HDHA 3C24A 2CZCA 2NLOA 2X5OA 3JYQA 3Q11A 2HMTA 4PRLA 3FD8A 1LRJA 3OF2A 3SVTA 1T2DA 2OP0A 2I5PO 1LNQA 3L4BC 4UREA 3KYCB 3INTA 3LK7A 3L6OO 3T4EA 4BNUA 4BNLA 2Q4BA 4AVYA 2C54A 3C1TA 1NPYA 2RCYA 4J2HA 5CDSA 5IXYA 4DTIA 2WEKA 3AM3A 5T64A 5IDWA 1ISMA 1RM0A 5JNLA 1E3JA 3ICCA 4XKJA 3QWHA 2J5RA 3WICA 4WLNA 4KWHA 4DBZA 3ZW8A 4KUGA 1LEHA 3ZV6A 3TDKA 2WTBA 1DC5A 3H9EO 1DXYA 2CVOA 4D45A 1GEGA 4J4TA 1QXSA 1ULUA 3FNEA 3I9LA 3ZH2A 4R5HA 3VPHA 3JSAA 4QEDA 2JKVA 4IPTA 4IS3A 3TZ6A 3ZWAA 4O6VA 1C1DA 5JAMA 3OIDA 2JCXA 4K6CA 1HSZA 5HS4A 1YONA 3GFBA 5KCZA 3FHLA 1XIVA 1UAGA 1R66A 1ISGA 4YVFA 4OYRA 4FQ8A 3PHJA 5KKCA 3H2ZA 3RKUA 4B4OA 2E4AA 4P22A 3MOGA 5COAA 4RVFA 5KJFA 4GKVA 3QWFA 4X54A 3I52A 3L4SO 1LSSA 3JQ7B 4CLXA 3HB4X 4M87A 3JQ8A 4FJ0A 4FGSA 4BMNA 4Z9FA 2O50A 1AXEA 2CDBA 2B4RO 2QIOA 3MJSA 2YYYA 3ZNOA 4E3ZA 1E3EA 1VL6A 2GN4A 3JD2A 1R4NA 5F5NA 5CPBA 2OOSA 2AHRA 1V0JA 4Z0PA 3EHEA 4J9VA 4JK3A 4IJKA 1LLDA 3PWZA 4ZU3A 2PWZA 4FPXA 4XQ9A 2X58A 4ZHSA 3WBFA 1HSOA 3QQPA 1GUZA 2V7PA 1TLTA 1ZEJA 5IF3A 3BA1A 2J3HA 2I67A 4B8ZA 4XQGA 4Z0TA 5L4SA 5CDTA 1VJTA 3QE3A 2BGLA 2UUPA 5I7EA 2I99A 4RPHA 1ZBQA 3DQPA 1Q1NA 4R51A 1I30A 4OIMA 4CL3A 1WDLA 3WDSA 5JYEA 3BHMA 2BH9A 2YHUA 1CYDA 3EYWA 4Y67A 3WMWA 3CH6A 4JJGA 1XDWA 2G1UA 3MWEB 4GAEA 2BELA 4IJWA 4Y8VA 3ZN2A 4JROA 1NVGA 4ZQHA 1DLIA 4DIFA 2NTVA 3JD1A 4ZQEA 4CM8A 4NBTA 3U9LA 2Y1CA 1I8TA 1SOWA 4FOOA 3DBRA 1N92A 2X8LA 4UULA 4NHEA 3SLKA 2Z1MA 1V3VA 4IGFA 5JC8A 3GFGA 1BXZA 1JWAB 4MKZA 3LF2A 2DBZA 4RZIA 2DFVA 1YXMA 1JAXA 1LQUA 3GVXA 4NU5A 4EI2A 2HSDA 3AOEA 1KVTA 1N9GB 3F4BA 3LU1A 3D0OA 1F17A 1LDNA 2FPGA 4FOSA 5L9AA 1PR3A 4B3HA 1GYQA 1XCBA 4QSMA 3LYLA 4IY1A 3FR8A 1SO8A 3FRJA 1K6JA 4INAA 4TZTA 4KQXA 1PJSA 3OETA 1U8FO 5LDHA 3JQGA 3EC7A 1RYDA 1QV7A 4PLTA 3FTNA 3QP9A 1U8XX 3ZV5A 4C7KA 4YJFB 3QHAA 1P0CA 1QRRA 1UDCA 4WLEA 3BMCA 4IIVA 5TF4A 4DLLA 1QYXA 1UP4A 2AW5A 1DDOA 5LDGA 1RKXA 2P4HX 4N7RA 4S3MA 3OBBA 1LXCA 5DF1A 1HE4A 1HDOA 2ZCUA 4Q39A 4CR8A 3RC9A 1ZKMA 4M89A 3QWIA 3UF0A 2WD7B 3SJ7A 5L4NA 2FY8A 2TMGA 3BZUA 2BGMA 2GSDA 3MWDB 2X0RA 3ZWNA 4PCVA 2JCVA 3VZQA 1U5AA 2PR2A 1EQUA 2VZ9A 4W7IA 1U4SA 4DXHA 3RFXA 2PZLA 5CG2A 6ADHA 4XYGA 1YOVA 4NK4A 3V5NA 4BNXA 3TSCA 4MOWA 3RVDA 7MDHA 2AEJA 2X9NA 5F1OA 1SMKA 3KYDA 1UXJA 1DIGA 3ENNA 3NJ8A 3AM5A 3PWSA 4PG4A 3TFOA 3EVTA 3GQVA 4ZRMA 1X1EA 4KDFA 2EGHA 4MVJE 1KVRA 1MXFA 5IZCA 3G49A 1M6HA 3ONDA 2X5JO 5ITVA 2IODA 4BGIA 4ZGWA 3D4OA 4D46A 3R6DA 3BYZA 4N5LA 1XA0A 5L7WA 4R16A 1J4AA 1CDOA 1H94A 1HYGA 4YJHB 3RFTA 1GDHA 3COSA 4XYLA 3F46A 3NJ4A 3VAZA 1SC6A 2DBRA 2ZQYA 3DZKA 1MP0A 3TZQA 2OORA 3AFNA 4BGVA 3AWDA 1SEPA 4BO4A 4DA9A 4DIOA 2WE7A 3NV9A 4XB2A 3M2TA 2VNAA 2G0TA 3E5RA 1YOVB 2CUKA 5TNXA 2AE1A 2GASA 4MIOA 2G76A 3CPSA 3CIFA 3PGXA 5CP8A 5CDYA 2A94A 5DBGA 1ZCJA 5L4LA 4NMHA 5KJCA 3PP8A 4FC7A 4AFNA 4ND2A 3U09A 5ILGA 5GZ3A 1FDSA 4IM7A 5G2OA 1YKFA 2O4UX 1Q7CA 1H2BA 3HDJA 3KSUA 4BO1A 2NQTA 3FR7A 4E32A 1HDGO 1H6AA 4Z3KA 5H82A 5G4KB 2UDPA 1GL3A 4CODB 1Z82A 4UUPA 4FW8A 5HWSA 3ZHYA 1TT5B 2BI8A 3WGYA 3ZWPA 4LW8A 4BO8A 4FGWA 2PFGA 1N1EA 3JD4A 4TVBA 4ZVVA 2BI7A 2X23A 3BTUA 1XSEA 3P7MA 1YDEA 2Q49A 3F47A 2D8AA 4OKNA 4YR9A 3UOGA 2D59A 3VPFA 4EJ6A 3HQ4O 2DPHA 4AJNA 4PZDA 1U7HA 2J3IA 4RZHA 3JQCA 4NJMB 5DOZA 1KC3A 2YY7A 4MVJD 1MC5A 3GDFA 4CLHA 4Q3CA 4NH4A 3RUFA 4II3A 3H5AA 2BFAA 1F8FA 1PJTA 3L07A 3GNSA 4PG7A 3QW2A 4MVJH 2FZWA 1K6XA 4R1TA 4YAIA 5CDUA 4OSOA 1GV0A 4RDHA 4AJIA 1IULA 4BNKA 1LSJA 3ETDA 4BQRA 3MTGA 4NBUA 4NJOA 4DC1A 5DDIP 2O3TA 1JKFA 3EY4A 4GX5A 4HFJA 2Q4EA 1SBYA 1ADFA 5T8KC 3OFSA 3FN4A 4TSKA 3GGPA 4XQEA 3WWYA 4FFLA 1KS9A 3HDHA 1GADO 3JYOA 3JTMA 1BRMA 1AGNA 2GUGA 4J3FA 1B8PA 1YJ8A 5K6AA 1VI2A 1A4UA 3FBGA 1UAYA 4D44A 1E7WA 3CE6A 4JBHA 3HZZA 1P45A 4XA8A 5F3RA 7ADHA 4XDYA 2WM3A 4YBZA 1ADGA 3BMQA 3C85A 1B7GO 4E21A 1PJ3A 4HWKA 4ZICA 5JBIA 2DFDA 5I8WA 1G1AA 3UUWA 2B35A 1I2CA 2XXBA 4AJJA 5GZ1A 2JL1A 1K2WA 2ZKLA 5JFOA 5KVSA 5BNFA 4UAGA 2BLLA 4XRGA 1DLJA 5BT9A 3E6AA 1I0ZA 3KRTA 4FR5A 3H9QA 3JQ9A 4CLOB 2DT5A 3OJEA 4EUEA 4CLEA 1GFSA 3OP4A 4RV9A 2PA3A 4HKTA 4NK5A 2W2LA 3GH3A 1FDUA 2OZPA 4A7PA 1DC6A 4FN4A 3NYWA 3LT2A 1OZAA 1PGNA 4RQUA 3DL2A 5LCXA 1ZK0A 4U8GA 4BNVA 3QWAA 1BXGB 3U4HA 4CMBA 3ANNA 4XYEA 4CM9A 4RLHA 5IZ4A 2VRCD 2WYWA 3FSRA 3PIDA 3VTZA 3T7CA 3HJAA 5EN4A 1FXSA 1NP3A 2PH3A 4R3WA 5HS6A 1ZMOA 1P31A 2QYSA 1O6ZA 2HK7A 3UVEA 1NFQA 4YACA 4CM6A 3W8FA 2X9VA 1FF9A 5I7SA 3AOEC 3KETA 1CETA 4ND4A 1FDVA 1ZK1A 1M67A 3KYBA 3IJPA 1ZJZA 2EKPA 3N74A 1PJ2A 1UXIA 4M1QA 4BVAA 1K5HA 2HMWA 4GGPA 3PHHA 4FB5A 2C2XA 2VWHA 4RDIA 4JLWA 3OEWA 3TNLA 4RVGA 2JD0A 3V2GA 1A72A 1TEHA 1WMAA 2QRLA 4WASA 3RCBA 3G1UA 4CPDA 1Q0HA 2P5UA 1KVSA 3K5PA 3VZRA 4E33A 1E0DA 4PLVA 2XF8A 4BGEA 4UVEA 1Q7GA 1HYHA 4E13A 1SZJG 2ZTMA 3HSKA 4LGVA 1KVUA 3Q9NA 3D7LA 4YAGA 5AQ1A 1W8DA 4LMRA 3DONA 1IZ0A 5L3ZA 4R54A 5F1PA 5THKA 2X0NA 2O3QA 2NU8A 4D3FA 2E6UX 3KUXA 1U9JA 3PRJA 3I9MA 4QUKA 3BMOB 4R3NA 3UFXA 4BNIA 1M75A 2X1HA 4A27A 2GGSA 4RVHA 1ZEMA 1VRWA 2EHDA 2F00A 4S1VA 4E5PA 3CXRA 4XGKA 1V3UA 2VHXA 5IAAA 4LMPA 3NT5A 1B15A 3WLEA 3VVCA 3RU7A 4BNMA 3V8BA 4D3DA 1YQXA 3DMTC 3EK2A 5LC1A 2R00C 4QQRA 3D3WA 5IZCC 1D1TA 3PJGA 5L51A 4RL6A 3EGOA 2PLAA 2H5LA 3NT4A 4P38A 3D64A 3WS7A 1D4FA 1ZXBA 1Z73A 1IPEA 1OAAA 3PYMA 2CVQA 3LSYA 2IEDA 3OQ1A 1IZ9A 1N8KA 2C20A 1MFZA 1HWYA 1E6EA 2VYNA 2YHIA 3TOZA 4FD3A 1EK5A 2OHXA 4A26A 3CZMA 1DAOA 3AY6A 1W0CA 5FFFA 2PD4A 1A71A 3KM0A 3SLGA 2HQ1A 3IMFA 2PV7A 4RF2A 1DO8A 2W8ZA 2B36A 3DBLA 1HE3A 2VT3A 1Z7EA 1EVZA 2YFHA 4BKPA 5EINA 1R6DA 3GZ4A 3I6IA 3AUTA 3UKOA 4B7CA 5IN4A 2FN7A 2R6JA 2IDZA 2X4GA 2BFPA 4JP2A 4I5FA 4O1MA 1T4BA 3LC2O 3KLPX 1ONNA 3INGA 2I9PA 1IHYA 2G17A 4XWYA 3ZWOA 4UVGA 3ROKA 4EEXA 1DC3A 4N18A 1MLDA 2BHLA 1XEAA 1YL6A 2YQ5A 4JGBA 1E77A 1WAMA 1UZLA 3DOOA 1T25A 1DEHA 5JY6A 3K96A 4PZCA 4ZRNA 3GNQA 1HRDA 3Q1LA 4OGWA 2POQX 3VPGA 1E6WA 5CPFA 2PZKA 2GR9A 2GZ1A 4KUEA 3INRA 2VT2A 3VH4A 2YJZA 1T2FA 3AOGA 3UXYA 1XG5A 3PFWO 2B4QA 2A9FA 4CUZA 5ICSA 3PQDA 1EUZA 1PGQA 4E5NA 1B0AA 4LRTB 4ID9A 3IDSA 4OKIA 3IIEA 4QFDA 2RHCA 1DSSG 4BS9A 2ZB4A 3H6KA 4NPCA 4XRRA 2GCGA 1HLDA 3U5TA 3O38A 4JJIA 3KEQA 1XU7A 1EVJA 3OQBA 4ITUA 4GKBA 1NFFA 1FDWA 4D79A 3CMMA 1AN9A 4UEOA 1VE9A 3JCZA 2C29D 3HN2A 4RPJA 5G4LA 3H2SA 1B8UA 2P68A 3UH1A 3KYCA 5JC1A 5K6AC 4J7XA 1E1NA 3LF1A 2EV9A 4OOEA 1DRVA 1N5DA 4K26A 2JHFA 4IS2A 3ZNPA 1CIVA 3DBHB 3WXBA 3O03A 5FEUA 5J23A 3WGHA 2VWPA 2HJSA 4PG5A 3RUEA 3PEFA 4XIYA 1RPNA 3OQ6A 2UVDA 3E9NA 3AM4A 4WLFA 3AUAA 3WTBA 1QORA 4HY3A 1M76A 4DLBA 3HG7A 1BW9B 1FK8A 4PLCA 1WP4A 2CSUA 3LC1O 3NTRA 1C1XB 3JYNA 1DPGA 3OICA 4WCDA 1U3TA 4C4OA 2ZCVA 3K2BA 1SEVA 1DIHA 3K30A 3PI7A 1LDBA 2AEFA 4PLGA 1O9BA 2D2IA 2GDZA 4DGSA 1KY5A 3PHGA 5KJEA 3DEYX 2C7VA 2EP7A 3T4XA 2Q99A 3ZWCA 2WYUA 1YB1A 4MO2A 4CMAA 3UGKA 3IS3A 3ASUA 2VTEA 1V35A 2GO1A 5TQVA 5BSFA 1VKNA 4PVCA 4XR9A 4QFCA 4L4RA 1Z6ZA 4MP8A 3RJ9A 3VPXA 2RH8A 5ER9A 4CMIA 2VHYA 5EESA 1UXGA 2EP5A 1HT0A 2NWQA 2X0IA 3JQ7A 2FPIA 3H65A 1U1IA 1R15A 3PTZA 4BB5A 1QKIA 4FDAA 2Y0DA 4ROSA 1PGOA 5G0TA 1E7YA 2VHWA 3QVSA 3PYXA 1Y5MA 2D5AA 4PLHA 2HLPA 5JCJA 1T2AA 1YB5A 3I4FA 1LA2A 4Q3AA 5TT0A 4F45A 4J7CA 5JLAA 2IZ1A 3DFUA 2O3UA 5C7IO 4ZQFA 3IP1A 5JE8A 3QVTA 2RBEA 5COQA 5JS6A 3GF4A 2NVWA 5JDCC 4D41A 2W90A 5I8ZA 1KOLA 1RWBA 4XZ3A 1YL7A 1ZFNA 3B70A 4FIZA 4IDDA 2NV6A 2HU2A 4XB1A 1ENYA 1NAIA 4WOJA 1T2CA 4HADA 4TZKA 1H9AA 5EJ2A 2G82A 4E5KA 1M66A 3QA9A 1ISHA 2EG9A 2QRKA 3NDIA 3WGIA 1L7DA 3VH3A 4CMKA 2I6TA 4CMIB 3WIDA 4W9NA 3EW7A 2IEBA 2XXJA 3RQSA 2ZQZA 1AXGA 1PX0A 3AK4A 1UZMA 2ZJ0A 1KIFA 2DTXA 2X9GA 1O95A 2ZJ1A 3B6ZA 3NTOA 1AUPA 2P5YA 1EMDA 1U7TA 2XOXA 4ZA2A 5H83A 3RI3A 2IYPA 2V6BA 4ALIA 1B16A 1GZ3A 3V1UA 5A3JA 4AJ2A 2AQKA 1N2SA 3S55A 1EUCA 2IZZA 3P19A 5C37A 1R4MB 2OGUA 2Y1EA 3IQDB 2NUAA 1H0KA 4BIIA 4NFHA 3K73O 4WECA 2EIHA 4CQLB 5TS3A 3JD3A 3EUWA 4CM1A 3L9XA 2GD1O 3NRCA 3A1NA 3F9IA 1N9GA 3CSDA 3H9GA 3S2IA 4IJVA 4R01A 2HMVA 3GUYA 4GLOA 2J8ZA 4NBWA 1O8CA 2NACA 5DP1A 3D5TA 3GRKA 4IDGA 2JD2A 3PGJA 4PLPA 4WEOA 4YRBA 5A03A 4CMCA 1TA4A 2H1SA 1UZNA 1ZK4A 4L74A 4PRKA 4ESOA 5CDGA 2EJVA 3RJ5A 1U3WA 4YJDA 3IKVA 1FJHA 1K89A 3DZHA 1EBUA 1L1FA 2O23A 3IUSA 3S2FA 1E3LA 4RPKA 4YJFA 1J6UA 3CZRA 1PL7A 1PQPA 1WDMA 2O7SA 3DR3A 5G0WA 1PL8A 4AJPA 4AJKA 1NVMB 4KOAA 3VZSA 1LJ8A 1MB4A 5CG1A 2JFGA 3C7CB 3PDJA 4CUKA 5JAQA 5G0VA 3UW3A 1LBEA 1Y9AA 5T5QA 2WD7A 4W7HA 2ZTLA 2Y05A 3PFFA 4PFJA 1NHGA 1EBFA 1IHXA 1P1IA 4NR0A 3TZHA 4YPOA 3DOCA 1WMBA 4NBRA 1D7OA 4FC6A 3JQFA 4OHUA 5C5IA 4TRRA 3WYBA 3DC2A 2O7QA 3GMSA 1W6UA 1Y5RA 4D7AA 1NQ5A 2Y66A 1GAEO 4JQCA 4OQZA 1EUDA 2CF5A 2ZYDA 2VZ8A 5JDIA 2AMFA 3OA0A 3DO5A 3WG9A 3P2OA 4IDFA 1I3MA 5CEJA 3E82A 3HDQA 3NUGA 3Q2IA 5I9MA 1EVIA 1Z7BA 4WUVA 3VPSA 2OUIA 1NWHA 1HYEA 2PTGA 4WLOA 3IKTA 1WPQA 1YO6A 1MA0A 3FNHA 1B3BA 4I5DA 1C0LA 4TRMA 2DAPA 5HM8A 4FBGA 2AXQA 4IMRA 4K28A 3C7AA 4IINA 3VHRA 1D1SA 3U0BA 1VLLA 1GR0A 1H2HA 1O5IA 3C1AA 3F1LA 3OJOA 2DKNA 4AJOA 4CQMD 4DYDA 4YA6A 1Q7BA 4TROA 2Y1DA 5KIAA 3RUHA 3KHUA 3L6EA 4FFRA 1ZK2A 4YJHA 5DZSA 1AE1A 4JN6B 2VN8A 1ZH8A 4D0RA 5IJZA 5ADHA 3NDRA 3C8MA 5K9ZA 4IQ0A 4XR4A 1PJCA 2DUWA 5JMPA 3RFVA 3FF4A 1CF2O 2EKLA 2QQ5A 4RF5A 4BMVA 4ALKA 4NIMA 3L77A 3KLMX 3OJ0A 3GR6A 2DBQA 2O48X 3O26A 3VH1A 3WBBA 1ZMTA 3CINA 4J1QA 3A06A 2HO5A 3W8EA 3WOHA 5GY7A 1E3WB 2HCTA 3F3SA 1YWGO 1G6KA 1X0VA 4WCFB 5COBA 4H15A 3H8VA 2NSDA 3O8QB 1E7QA 2J3KA 1MFPA 3U3XA 4MVJG 2AQIA 3ZNQA 1QYVA 1JVBA 3DBVO 4BHTA 1ONPA 1I36A 2ZATA 1U2DA 4U6SA 5BSEA 3UICA 3V2HA 3WJ7A 4TRNA 4A73A 4DWVA 1L7EA 4M49A 5G4KA 2O4CA 4YT2A 1X7DA 1BG6A 3RROA 2D0IA 1I24A 1GPJA 1TT5A 4N5MA 5TJ9A 1PZHA 4LK3A 2ZTVA 4U0JA 1PEDA 1ZK3A 3PQFA 4GX2A 4EJ0A 1D8AA 4HBGA 3UCXA 1BGVA 4FFNA 3DHYA 1Y9EA 4XJTA 4NJMA 3RUIA 3MJEA 1V3TA 1MV8A 3HE3A 3FCOA 4PN3A 1QYDA 4CM3A 4EDFA 3NGXA 4CQMB 1G0NA 2FPPA 2DU8A 4A03A 1HXHA 5KVQA 1NPTO 3E5MA 3TWOA 3EAGA 3WGZA 2VOJA 4JJFA 5THQA 5ER6A 1X7GA 3QRWA 4R9SA 1UUFA 4XGIA 1I3KA 3G17A 4YRAA 4J4BA 2EEZA 1IE3A 2Q1WA 4F46A 3EVNA 3I1JA 1LSOA 3KO8A 3GLQA 1R0SA 4Z0HO 5DCWA 3ZU4A 2RHRA 4U5QA 4RF4A 2QZ9A 4LCEA 3RC7A 1P9LA 1WZEA 4DUPA 3F5SA 2PNFA 2X22A 1YS4A 1GUYA 4RVDA 3P2YA 4GSKA 1CWUA 1WW8A 4P4NA 4YAJA 3OECA 4ALLA 4BOYA 5ILOA 4EUFA 4BNWA 1LDMA 4ZJUA 2OMEA 5AXDA 4DQUA 1GUFA 4WGGA 4RVSA 4OXKA 4PZEA 4NU6A 3BMNB 5I7FA 3QWBA 1X7HA 4WNIA 4Y6SA 3ZV3A 5B4VA 4AG3A 4EBFA 3GMDA 4DLAA 4XYMA 3S2GA 2ZK7A 4CLOA 5DCUA 4GWKA 1NNUA 3GUCA 3NGLA 3ADPA 2J5QA 4BO0A 4BMSA 4J6FA 3K8ZA 1IY8A 1N7GA 2EF1A 4ZN6A 1UP6A 2C82A 1V6AA 3ANLA 4UVHA 1BXGA 2SCUA 1ZZEA 1GCUA 1VSUA 4J2OA 5T57A 3VC7A 3GC6A 4PGFA 3WR5A 2VTDA 1B26A 1GYRA 3DZGA 2HK8A 4CV3A 1JQBA 2PGDA 2TMDA 2QG4A 4GH5A 2EWMA 3OA2A 3TRIA 1QV6A 4MPDA 1GCOA 2IE0A 1MUUA 1NR7A 5TT1A 4BKUA 4CMHA 1QR6A 5CAEA 1UXKA 1Z74A 2BFOA 1CERA 3I9OA 2Y68A 1DB3A 4NFSA 5C7LO 1JU9A 2CVZA 2W2LD 3GEMA 1XR3A 3GAZA 3MOIA 3PHLA 1C0KA 1MXHA 3TZKA 1F14A 2GERA 2D5CA 2DTEA 2PKQO 4MINA 2E37A 4LSMA 1LX6A 1IOLA 1NVTA 1EK6A 4OSPA 4KWIA 3U62A 3F5QA 4CM9D 1V8BA 5A9TA 3QIVA 4BNFA 4L4XA 5JPIA 1YQDA 3AU9A 2FRDA 1F06A 1JA9A 3O4RA 2PZJA 3K6JA 3E9MA 2WYVA 3RC2A 4LVUA 4O5OA 4QO7A 4D0SA 5BR7A 3ZNNA 1C0IA 4OOFA 2W98A 1X0XA 3DMYA 4J0FA 4U7WA 3I83A 2R2GA 3KEOA 3PZBA 3HB5X 4UUMA 1BDMA 1RJWA 3D1LA 4Y98A 3JQEA 1ENOA 5GZ6A 3D4NA 5CFZA 2NU7A 3JQFC 5G0UA 2H9IA 3BMOA 1H93A 4XJSA 5FI5A 1RM4A 5JDIC 3DOJA 1NXQA 4JXKA 4CUJA 3L4BA 4OJNA 1A9ZA 1C3VA 3MZ0A 4GX1A 4CV0A 4G5HA 3Q6IA 5EPOA 4IDAA 1UDBA 1B14A 1EE2A 1OC2A 4YQZA 2PY6A 3AI3A 1MC4A 3S8MA 2VRCA 3FWZA 3W8DA 3LLSA 3B1JA 4F6LA 4GLLA 3WQSB 1XELA 1I01A 3PJFA 4NQZA 4XEHA 1UP7A 5IDXA
chains in the Genus database with same CATH superfamily
3AJ8A 3E18A 4TRJA 2BMJA 4BJ3A 5ALHA 1FRZA 3EPHA 1BROA 4J9UE 2WTXA 1Z45A 3M7IA 1DBVO 2R5FA 4MPPA 4KR9A 3K9GA 1IN7A 1ZH6A 1Q0QA 3CLTC 2BFBA 1KI4A 4UTOA 3O95A 5B3AA 1JPUA 2BGGA 4KX3A 5GV8A 1RC0A 1KBZA 1P7ZA 3T34A 1U2SA 3GJYA 4YP5A 2CFOA 2Q46A 3LQ4A 1X7XA 1Z63A 4XUDA 4XM0A 3OIGA 2Q2OA 1FRVA 3R6LA 4RPIA 1Z2AA 1QRDA 1TYZA 1DRKA 5K1ZA 3AVWA 4G1FA 3F5MA 4H31A 4WV3A 1G9TA 1RRVA 2JIZD 4X1IA 1AS2A 5HCUA 3D81A 3B1VA 1Z36A 1UF9A 2ZE6A 3W2IA 2D7JA 3ZXSA 2NVUB 1N33B 2IEYA 1W94A 5FYDA 1RXUA 1VPDA 2QN2A 1EFHA 2F64A 1X70A 3NKLA 1SZPA 3FDXA 4ZVPA 5CEEA 2YDYA 3FFBA 3A28A 4PYKA 3ZZ1A 1BQEA 3ZG6A 3EVDA 1NR1A 4J07A 5TPWB 1IM8A 2HLDA 4BNTA 3DA8A 1KMHB 1DWQA 1GTMA 4UDYX 4L8VA 1R3UA 4O08A 3PEEA 3VPDA 2ZIFA 1N3BA 1YIAA 5IDQA 1JMYA 2FZEA 2ZDGA 5A05A 3T7SA 1T8RA 3QXCA 1O6CA 1SFRA 3K0CA 4WTOA 4BQEA 1W85A 3DV0B 4Q3BA 1CF4A 3D6FA 4XWTA 3SXJA 3G0DA 1HG1A 3W5BA 1N0UA 1FXWF 2WJ4A 1T1RA 1Z4QA 5CB4A 2I4RA 4DLPA 4TMZA 3Q8KA 1YR9A 4OQXA 3MQ2A 4IMIB 1VLJA 3S1AA 4M76B 2GYUA 2NU6A 5J2TA 4GMGA 4LV8B 4TV8A 4KMSA 3EZXA 5C9ZA 1OBFO 3DFKA 3TZBA 1FLVA 4AN0A 3BWMA 1KDTA 1ZGZA 5D85A 3T3PB 1G20A 3B7GA 3SJBA 1GLVA 3ABIA 5J47A 1K4KA 3T4UA 4E30A 5BSTA 1OVMA 2PVPA 3T9DA 1A5AB 4W5TA 3NDJA 1DFGA 3C8DA 3G8BA 3BTOA 3BSYA 2YQZA 3BHIA 4AO7A 4K88A 2QUAA 3AR7A 1YRHA 2D6FA 1VCOA 1IUPA 1VGVA 3E22B 4W5HA 4Q48A 1K92A 1OC4A 4F1WA 2FWMX 5KWEA 1SHLA 4ZK2A 1WZIA 3RUAA 3N0RA 2Z58A 1OV4A 3F1KA 4AWBA 4OX9Y 2GXQA 1TCBA 2KPOA 3GP5A 1QAMA 4JASB 3TCNA 1B8VA 5E2AA 2H7VA 3BCHA 1JHQA 4F9TA 3CVWA 1XXHE 5GP1A 2GEBA 4ZKDA 4RQTA 2PRYA 2BRUA 3ORFA 3ZDAA 4D9BA 2D4HA 1N2GA 3UN1A 2FWRA 1LTQA 5DYWA 3TSYA 1GV1A 3MINB 3ZE2B 1XHEA 3TF5A 2PL5A 3KB2A 4RK0A 5C3MA 1T91A 2CVPA 1ORRA 3HDGA 5SZHB 3PXGA 6LDHA 4IDUB 4B3IA 2HAEA 3ZWXA 1RIIA 4EM6A 1VL0A 3AJRA 3SSAA 2ZIXA 4RZQA 3GEPA 4K9RA 4QLBA 4NONA 1KP3A 1WNFA 4YJ3F 4RS4A 4PGGA 1JJBA 4BIMA 3U7IA 1S7CA 2C7OA 3N6VA 5JI3E 1V7CA 2JA2A 2WWWA 4MW5A 5LP6F 3A6ZA 3IEMA 2RSLA 4OGLA 2NUTB 1LPOA 1T4DA 2DFPA 4H3KB 1BW9A 1DS6A 4DY4A 3DVLA 1I33A 4O33A 1L1RA 2GJ9A 2I34A 2Q3JA 1L7OA 2ZZKA 1BX1A 4YXFA 3G0HA 1YVUA 4HEA6 1P9RA 1FA9A 4BBPA 1P44A 4MVYA 4CKCB 4QYTA 1QVAA 4BQSA 4G0WA 3ET4A 3VX3A 1H6BA 4QEKA 3L6CA 1VKOA 5BQ3A 8LDHA 1ND6A 3N58A 1VZ3A 3F6YA 3GO4A 4FILA 4B7AA 1WXDA 2EW8A 2F4NA 2GYYA 3F78A 3EQ9A 1O89A 1ZISA 1ZRHA 3DLAA 3FTCA 3OPYB 4JXJA 4MJ3A 1H4VB 1N5KA 2C2YA 4PGMA 3WHIA 2PU5A 3TZLA 1WRBA 3WKCA 5CTJA 4TLCA 2XTNA 1XQ9A 3TI7A 4FQ7A 4EG0A 1JR3E 4QA9A 5LA6A 4GUAA 1VMAA 2CC2A 3OZEA 4FMCB 5IX8A 5T6BA 4DM4A 4LY3A 2PEZA 4UTPA 4TMFA 1QGZA 1PLJA 1SK9A 3P0HA 4LJ8A 4FQ5A 3SBOA 5BN3A 3NU1A 2BEVB 1EUYA 2V0GA 3JYLA 2HFKA 4RO0A 2I4MA 4DABA 1OD6A 2EW1A 2I8AA 3PCTA 4KL8S 4W9RA 3VV2A 4YCLA 2CB0A 4PAOA 4JBLA 3CN9A 3EJ6A 2WSYB 2WIJA 4GSYA 4I5EA 3R0IA 1FDTA 1WHTA 2DCUA 1N2XA 4U6QA 1ISFA 2WHPB 3EGCA 4FEEA 4G67A 5K0FA 2FRVA 5FQOA 2O3JA 5GM1A 4I3HA 5FULA 3LFUA 3VU0A 2QNBA 3V00A 2I2BA 2FDCA 3OCZA 4TVKA 1V8DA 3UJ6A 1LX7A 1HZZA 4I7EA 1AHIA 2H2HA 3KS9A 3MTJA 4EZIA 2VSNA 5HZKA 3WLKX 4JCOA 2HF8A 4Z86A 1TM4E 1TB4A 5BY2A 3SJUA 3NHMA 3ANXA 4R1UA 4BFLA 4EYQA 3PFNA 4TV9A 2B9VA 2DKFA 3DZBA 2FR8A 2R6R1 4GQAA 3HB7A 4WKGA 4XUGB 4EGQA 3OPYI 3AR3A 5DM70 2C2WA 3P0JA 5K8IA 4G0XA 1MZVA 1NBHA 1QLHA 2EG5A 3BAZA 3EQ2A 3MOSA 4YCNA 1ZLYA 2NYRA 2JIPA 4NE2A 4FKZA 3OH8A 2NXJA 2JFOA 3I04M 3JAMA 4DE5A 1SQ6A 1VGQA 2FSVA 2F17A 1GVHA 3ZYZA 2XQIA 2Y4OA 2NO1A 3KKMA 4I08A 1YQ9A 3A6EA 1GGEA 1X2EA 3K20A 4L9AA 4NCNA 2HCBA 1L5KA 2PGJA 1OASA 5JFTA 3RFUA 4OU5A 4HGNA 2X2EA 3MC1A 2JHAA 4ZOQI 2Q6TA 3L8HA 4KITB 1R0RE 4AICA 1Z47A 5IM4A 4MP3A 3BTVA 2JLUA 1EQ2A 1YB4A 3GOQA 4P32A 5JCJD 1EG2A 1YI1A 1XZEA 2CL6X 3G3EA 4I55F 3FPCA 4MSUA 4HDMB 4IICA 5L6MB 1AF7A 3WIVA 4E12A 5IHXA 3DKVA 2HXYA 1YV9A 2XVAA 3BXPA 1N8SA 1XO1A 3H8WA 3P9NA 3JQAB 2C7GA 1G0OA 4KMOA 1L1QA 3M33A 4D5EA 1NKSA 2ZROA 2VHZA 3LP8A 1R4AA 4GI5A 4GMHA 2C9ZA 4BO3A 1QRUA 1KQ3A 5DBOA 2RGRA 3PENA 4XIIA 3UJHA 1HK7A 4M38A 2LCFA 2BVNA 3R3XA 4PAMA 4EA8A 2RHHA 3E3AA 3E7FA 3NAGA 3KNZA 4LE1A 5J40A 4A0SA 4J0DA 5KOJB 1UR5A 4UAJA 2WFMA 3ENQA 5F76A 4DM7A 1JFTA 4WXMA 1C9NA 2Q8NA 2QSZA 2PM8A 4PGHA 4P9NA 3F6RA 4W8HA 1K4YA 2UUOA 4M86A 4N54A 1F8GA 3BILA 4J03A 3QU4A 5EXPA 3RV4A 3H99A 2R7MA 4DQVA 4HDSB 4LMBA 4W82A 4TTRA 1EIZA 4TQUS 2XJ4A 1DFHA 1ZA1A 4ZPJA 2UVPA 5A4IS 3W6PA 3AF6A 4OHYA 3LVFO 1E9SA 5EJAA 3H19A 3IAXA 2HY7A 2QTCA 4NECA 1YQWA 3O4FA 2X0JA 4JLVA 2PK3A 3R4CA 2A59A 4CV2A 5TARA 3KZOA 3JW8A 1A7KA 6CHYA 2QVGA 2UYGA 4AMYA 1VA4A 2VZ0A 4MR8B 4HWSA 1D2CA 1N75A 2WV9A 1TE2A 3TLGB 3UB4A 4OI0A 4Y0AA 5HCNA 1OR8A 1R0KA 2JIOA 4CKEA 2EWWA 2WOJA 2VA8A 3DVRX 3QA3E 4P3NA 4TN5A 2YHAA 3TCKA 2WHYA 3R7FA 1QO9A 2PUJA 4B3GA 1RLMA 5TQ0A 2YBEA 3IAM6 4ASUA 1LK0A 4ND5A 1W4CA 2VSXA 2DY1A 4JCCA 1CD5A 3AZQA 3K0CC 5EXXA 5BR4A 4D25A 4G65A 3KPJA 2X40A 1C3OB 1NQOA 1P7WA 1YJXA 2VDQB 1WCYA 3VR5H 2LDBA 1MOZA 4BWYA 5B57C 4FCTA 3NNSA 4P5EA 3ZI0A 3RVJA 1D2EA 1US8B 2DGDA 5FI3A 1NY5A 4BNGA 4D0GA 5GJVC 2AC7A 3V1KA 3ZWVA 1SC4A 1CP3A 4BNYA 1SU6A 2CXHA 2HJGA 1X87A 3IP9A 3SC4A 4WBNA 1O4VA 4R8VA 5DXJA 1CR4A 4DOMA 2J33A 2ZXEA 1JW9B 5F9FA 1Q0RA 4NP6A 1MJGA 1OT3A 1TCCA 2QJTA 1NLUA 4U2KA 4TWRA 4XARA 4QGSA 5AW1A 3K0SA 4R1LA 3RAFC 1KHTA 3WQHA 1CJMA 2QMEA 1ZINA 3DEKA 3LT4A 4ZHQB 2XT6A 4Z1MD 3ZW9A 1J06A 3IVAA 3K0HA 4LYHA 3OC6A 1AO0A 2R0QC 1A9RA 1DIBA 3GY0A 1BFUA 3MMPA 1NJFA 3O8OB 2H63A 3Q7SA 4MWTA 2QHXA 1XF9A 2VP4A 2XB6A 3E8XA 4ME6A 4U63A 1PR6A 4YRLA 1HC7A 1YB6A 1AXRA 5EQDA 5B1IA 3OM9A 3UWOA 8OHMA 5IK2D 3U4IA 1T5BA 3HS3A 2POCA 3EFEA 4XDHA 1NAHA 2AFRA 2P67A 3RYFA 3I9JA 5A7GA 5ICEA 1REQA 4PV7A 1YL5A 1MTOA 4NEHB 4WW0A 1Q0LA 1YK1A 2PWPA 4Y6GB 2AZXA 2MTBA 4IGAA 3JQ8B 4CKWA 1JWBB 2HHJA 2HM7A 1WCXA 4ERXA 3WE7A 1JDJA 1ULSA 2PZBA 2ZUCA 3UJ3X 5B5SA 3W5DA 1CUFA 2H07A 4F4FA 2YS7A 2VTBB 2Q6IA 4NYJR 2P62A 1WG8A 3HGTA 1J2JA 1GT91 1J5PA 2GI4A 1A88A 1MRSA 1H9BA 4QC2A 5F1YA 1FNDA 2JFYA 4RPCA 3U49A 1U02A 3DT8A 3VTFA 3RU9A 4ZOLB 2I29A 2MU1A 3AV0B 1SCUA 2XTMA 4CLRB 1F6WA 5IC6A 1KBOA 3HA2A 1YK0A 2RGEA 1HKUA 2ZIUB 5DHRA 5JW6A 3GP8A 1FUEA 3W6NA 5JAPA 2ZUWA 1T26A 4OGGA 3AR2A 4EA6A 4LZNA 5F77A 1VE7A 1KJZA 1OOEA 1YBMA 4HQKA 1TJPB 2W2VA 4CVNA 3PNPA 4PWYA 1QE0A 4EH1A 2VDKB 3WYFA 3OT5A 1YBVA 4QTZA 4JODA 3ROMA 4M0PA 1XKQA 4NV1A 1IH8A 4J1SA 3E58A 3DMRA 3VPCA 2E4WA 1H2AS 2CKMA 3PTLA 3PUHA 4I1RA 3GRUA 5E9AA 1NX6A 4OAQA 1TTTA 2GD0A 3UUFA 3H0CA 4BB6A 5A4FS 5LKAA 5DK4A 4BX9A 3TBFA 4IHAA 4RZ2A 2YDXA 1OF1A 1LU9A 2MSCB 4O4LB 2YY5A 4P58A 3U2QA 2VQEB 3LA6A 1DJQA 1PS9A 1RI2A 2HPVA 3ZDYB 2ZM6B 3KR2A 4O4HA 1CR6A 9ABPA 4AX8A 1JLKA 1GFIA 1H0HA 2NO6A 1D6SA 3BKXA 3JQ6A 4D9KA 2I7DA 1K8RA 2NQ2C 2ZPTX 4PY2A 5A3VA 1KFCB 3WY9A 2Q0QA 4XFDA 4BMOB 1V5IA 4F96A 3LPDA 4NABA 5TJHA 2JIQA 1GPWB 2COUA 2X0KA 4CM8B 2B30A 1HX7A 3A6HA 3NH9A 4ND7A 1CQJA 5JCXA 2RHJA 3Q3CA 4NBSA 2EZUA 3GLRA 4I5GA 2GN8A 3GDOA 3HXLA 1EIWA 2BEUB 4CQMA 5IT9A 2PSFA 4IILA 3C3WA 2UVQA 5DOVA 5BVHB 1CEEA 1CTQA 1JAYA 3H5RA 3C6QA 2BDEA 3FKQA 1B1AA 1XK6A 2OO7A 1BEEA 4EPTA 4YYZA 1G17A 3T7KA 3IE0A 4MNTA 1VIVA 4ZU6X 3SC6A 1KF0A 2PH5A 5SY9A 2VNKA 1GHTA 1G3MA 2FFAA 1R4ZA 2PXXA 1YF3A 1HKHA 2Q3HA 2V7QA 4O2BF 1CZNA 2FMHA 3BERA 1SHUX 5KQLA 3QELB 4OB7A 2AKYA 4F72A 1RVV1 1G4UR 1E0KA 1AHNA 1AZWA 4NFLA 1Y9ZA 4MUGA 5IJ0B 3JALB 4Q3EA 4EEKA 1YJAA 2XGMA 4KV7A 2QUZA 1A8QA 3VA7A 3THRA 1SQ5A 3R3JA 4FINA 4AZ3B 4MX8A 1MO5A 2G1AA 4NG5A 1DAEA 1JBEA 1EFPA 2FSVC 5CURA 1K5PA 4OFZA 3SR4A 3WQBA 1EG7A 4YDQA 4BTEA 5JVDF 3CRZA 4QXAA 5KYYB 3W5CA 4RL4A 1MHPA 1M34E 5T7BA 5L7TA 5FR1A 2AR0A 3VX4A 1WHSB 3AP1A 1CUCA 4KR6A 4PLFA 3NV7A 1OLSB 1URPA 2WYHA 4LYGA 2OO5A 4OBEA 3CR3C 4QQ8A 2P3LA 3CU5A 3DUWA 4DMMA 3AKDA 5KTMA 4QLAA 1EGHA 4PC6A 4OHXA 1W5AA 4DJEC 3HDTA 4S24A 3L8GA 4BU1A 2QD2A 5FD8A 1QAQA 1UDAA 4B83A 1AH2A 3SK0A 1LRKA 4AY6A 3FGNA 1JHOA 1YZTA 2JAUA 2V3VA 4OL9A 4R9RA 4RK6A 5C80A 1BWSA 3D6MA 3O92A 1GCIA 1PZMA 2QL6A 2WMDA 3N5CA 4CKBA 1P1JA 2OV1A 1UJNA 2YYSA 4J0QA 1E3TA 1LWOA 2OMKA 5F3DA 3RGWS 5IT5A 1EGAA 4HDNA 2E7ZA 3ABZA 2Q5JA 3H1PA 4Q7LA 2H0RA 4I9NA 3VU8A 1WXQA 2REOA 1MG5A 1WM1A 1Z06A 3EDMA 3LWNA 3MGKA 4HNHA 4QGAA 1OWLA 2IYXA 4M2LA 3RBZA 4FCVA 5LQKA 4XGQA 4UCXA 3EQ8A 5HRUA 4NKRA 2VP9A 3EF3A 1UK9A 3VC2A 4FGUA 3OX1A 4W5QA 3K5WA 3CGWA 4Z4IA 4E6EA 2D74A 1FFSA 5LNK1 3KZXA 3DKKA 2RK3A 1XK7A 3VSAA 3ITDA 3I6QA 3B7WA 3AEKA 1KE2A 4YMLA 4JUBA 2VHEA 2QDXA 1Q1QA 1ZGCA 3W34A 5AVTA 1Z0SA 1JEJA 3F74A 2NQ8A 2RKBA 4HTAA 4QECA 3T1NA 5D86A 4JKYA 1ZIXA 1NQVA 1O8BA 3MGAA 4EMUA 2XRMA 2YV1A 2V4UA 3O4VA 3L0YA 1XT6A 2ZEJA 3A7DA 3LX4A 1QB8A 4KDEA 4MGYR 4XB6B 5E7QA 2C57A 2VJYA 1X1SA 2VSQA 4IOMA 4PNZA 3DD5A 3NHUA 5DN9A 2FP3A 2Z83A 2RIPA 4MVJA 4DIBA 2FX5A 5EOVA 1OAKA 2Z4RA 2CUZA 2ZBUA 4A16A 3C3KA 3OEYA 3AWIA 2ZSHA 1R9GA 1U8EA 1UKEA 1GPBA 3L8ZA 5C34B 3G9TA 1GWNA 5E1MA 4L3WA 1VZ2A 3QLTA 2DSNA 5BN1A 3B82A 3CGGA 3OJLA 1CKEA 4YJ2B 1PR0A 2WSSA 1T6ZA 1HUQA 1SG9A 2BUAA 1LTHR 3L18A 4XW2A 5E6RB 3AFMA 1V96A 4JSRA 3GEGA 3KL4A 3UW1A 3MEQA 3G7UA 4NVRA 2HU5A 3M6IA 1ZOLA 4Z6KA 2WJHA 1BFKA 4II2A 4LCJA 1ANKA 4WBXC 2PZFA 3FNQA 2E4UA 5DI3A 3PLNA 2E21A 4PVDA 4WK2B 4H4DA 3H11A 4CMGA 2NNLD 4MICA 3RT1A 4L0CA 1OTXA 3N75A 5K4AA 3K09A 3N2YA 2SKDA 1MW8X 2NPOA 5FAXA 2AFIE 3PL1A 1B23P 5AHWA 5B1YA 1BXKA 2C2GA 1JU4A 1BJKA 3P0FA 2X41A 4KPGA 4Q15A 3PQ2A 5DNWA 1A04A 3UGQA 1BKDR 2IGTA 1RM5A 2NXCA 3EGDA 4UU1A 1LF0A 2HF2A 2ONYA 2O8VA 3L7YA 3RK4A 1R6TA 4B74A 1SXJC 1T15A 5D6OA 1R27A 3TQFA 3Q5GA 3HHPA 2PKQP 1IAQA 4ZODA 1ISIA 3KELA 5KKAA 2HUNA 3RVQA 3UB3A 4EPWA 5JSZB 2I66A 2JH3A 1LC3A 3ORSA 4O5AA 1B2LA 1WXIA 1YFZA 3HWWA 3ZXXA 1U2QA 4IXMA 1XWIA 3RANA 3T0IA 4QT4A 1IAVA 3AMVA 5TQ2A 4D97A 2DUUA 2RMKA 3OZIA 4UZEA 1PVVA 2ZIZA 1HDZA 2PUWA 3WNVA 4CM4A 4D6YA 5E4YA 1ECBA 2FP4A 3HWX1 2YWGA 1W9HA 1C7ZA 2JPDA 2IXAA 3H42B 3KVOA 2ONJA 1ULAA 3WLQA 2AXNA 2QQFA 1X9HA 2A84A 4GI3A 4C3UA 3OKPA 5CFOA 4C29A 1WCV1 2N1MA 4WNAB 5AKZA 3UXHA 3QPDA 5HYVA 5AXBA 1MVLA 5BURA 1H8HA 1H2WA 2WPDD 1TW3A 3BWDD 3A1EA 1LKZA 3PRHA 1GCGA 3AZOA 4FXOA 1U6IA 1S3IA 2I2AA 3DO8A 5D3KA 2RI1A 1YRLA 3OO1A 3X2SA 5I7RA 1MJNA 4A8PA 3IKLA 1E32A 3MCVA 3ADBA 2W4IA 1PBTA 2A4KA 3BVPA 4B4VA 1CQIA 4DLKA 1L1EA 3PFKA 2I1VB 2REXB 4C6HA 1OQAA 1VE6A 1PEKE 3S2YA 4OIFA 4DMKA 3Q3HA 2HHAA 5DNUA 1ARZA 5HUHA 2NTNA 4KI0A 2QZZA 4G97A 1TZBA 1GZSA 2GPBA 2JBAB 1XTSA 3AF2A 1AUXA 3AUUA 1CE8B 1YGYA 4RCZA 4MW0A 1LDEA 1QP4A 3GFOA 1EAMA 1IHUA 1S2MA 4RV4A 3G79A 3WZ2A 2B83A 4J1JA 4TWAA 3ZWKA 5JSQA 3DCNA 4Q1DA 1RKUA 5E4FA 2AKEA 4L5AA 2DPXA 2ZU0C 1NZFA 3H1GA 2P9TA 3NATA 4RTPA 3PU6A 4PRYA 2Q2WA 2GCOB 3C6KA 4DVJA 4YCJA 4F5EA 3GRPA 1E79A 2Z1NA 4D3SA 1JG7A 3LWBA 4KQKA 4B47A 1NVFA 2E2WA 2EDCA 4M7PA 1MBZA 3ZHUA 2PSDA 3AY3A 4DNQA 2VK2A 4QM7A 5AHKA 5D2CA 4BGDA 4LF7B 3K6KA 4B8WA 2GWRA 3CF2A 1ZMBA 3P9KA 4MCAA 5DYGA 1D6JA 4ILEA 4DPMA 1GQRA 2Z8XA 3T6KA 1U1FA 1LK7A 1TQHA 3TLBA 2QMHA 3TSAA 4QUBA 5IDYA 3ONFA 5IAOA 2WHQA 5KC9A 1F4VA 5D7BA 2VYND 5GONA 2XITA 4M8LA 1DE0A 4L28A 4KVGA 2OWEA 5G1NA 4GRIA 2Q9CA 3BJEA 1PX2A 3CX8A 3L6BA 3TIGA 2E5LB 4E5MA 2ZU6A 4QHYA 5AJZA 4GGMX 5JJIA 2QY6A 2PX5A 1E9AA 3P32A 4LHVA 3KKNA 1V6SA 5DGHA 3ZHZA 1QQ6A 1W5EA 1K3TA 2ZSEA 4NAUA 4F12A 5KVVA 1U7DA 2IDMA 1LW7A 4R5MA 4YTEA 3V2UA 2DHQA 1KKLA 2IRWA 1DT3A 1M8JA 3LO5A 1GXSB 3ZWYA 3DUFB 2N46A 4K9LA 4UNRA 5HR5A 1JKMA 1V1MA 2FTKE 4AP6A 1W88B 3H3XA 4PX2A 5FWNA 1HY3A 4WY8A 5B6JA 3PXXA 2GEVA 1UPAA 3LUAA 1GAXA 2PUEA 2IOFA 2KBEA 2IT1A 5AR1A 2G88A 3TMYA 3A6LA 2G83A 1L7RA 1H4SA 5EIBD 5CNIA 2CK3A 4N0MA 4YI5A 4S05A 4GOOD 4G1VA 4ZEVA 1H9CA 3CEHA 3RRZA 3ZDFA 4BYMA 1K8QA 5DLYA 1E9RA 2EU8A 1QYIA 5DGCA 3DKIA 4W4TA 2BH2A 3SEFA 5TGTA 2R84A 3E7XA 1DC4A 2AWOA 3F5FA 5C7OO 3D6JA 2XUIA 3MTEA 2CGEA 4M21A 2PKRA 5DN6A 2C31A 2OCDA 2X0DA 5C18A 1T5SA 3ZQJA 4HEA1 2PRZA 4GBED 1KPIA 3M1AA 1EDDA 3B48A 3M2PA 1PTJA 5TMEA 2P2CA 1GD1O 2W71A 2XI4A 3A4VA 2RI6A 3NDPA 5FTWA 3R9WA 4KUHA 4C14A 5GJBA 1IBKB 1N2CE 3PJRA 1RQNA 2WF8A 3C97A 5MGBA 3VR3D 3BUSA 3HGQA 5B58C 1KC1A 4G0PA 2G70A 4JWTA 5HTOA 2DHCA 3MVEA 1RWKA 1UKZA 2OV4A 2VDRB 3OQVA 4X91A 3CCFA 2W8BA 3NBQA 4G8DA 3DXFA 4J49A 3QUCA 4K6FA 3IXLA 2VHVA 4RACA 5BOVA 4RXUA 4NEGA 3AVOA 5IARA 1PS0A 1EGMB 4EI7A 5ED4A 3DF7A 2ANCA 3DL4A 3KBOA 2FJPA 5FP0A 1MNAA 2B1RA 4HF7A 3I73A 4IDNA 4I6JA 4KXMA 5ICGA 3HSSA 3UAYA 3GLIB 4Z2YA 4CT0A 5HQJA 1KYIA 1TAUA 4WN3A 5LFAA 4I1IA 4MLDA 3SPXA 3TNJA 4DMUB 5CX1A 1SC3A 1O96B 3LPAA 4U3JB 4KLCA 2OXIA 3FVVA 3CKYA 3WK9A 4DLXA 4BMZA 3DBLB 1L7XA 5KTNA 2XE7A 4ZQBA 3OTWA 5JH7F 3CLUC 3DEIA 1MB3A 2NYVA 2PS9A 4V0MA 1DNPA 1TIBA 2AJBA 1SCNE 2IBMA 4P7BA 2LDXA 1Y6JA 2RHTA 2CMFA 3FMVA 2YV3A 2XYRA 2J4DA 3MMZA 4PSKA 4K03A 4DA7A 3DHWC 3I12A 1XOIA 2I6XA 3U37A 1K5DA 3WTCA 3ZDCA 4Z9YA 3NAQA 5EZ6B 4BLUA 4FU0A 3GGDA 2CLFB 3N3AC 2P5SA 1BMDA 3DQZA 3K9CA 1ZSVA 1TVEA 2HD4A 4OYLA 3DLHA 3R8FA 2IVZA 1Y63A 3M6MD 1C4WA 4H7IA 1BCSA 2XMCA 2ZUVA 4EHLA 3C3DA 1Y4SA 2HRZA 4IUYA 3B6JA 1K0FA 3LV8A 1CIPA 2BAGA 4ND3A 3TD2A 3I53A 4YPFA 4BV9A 1JLMA 2XUGA 1W5BA 1FP7A 1NPDA 1PJLA 2G9VA 3HBNA 4MW1A 3GLGA 4IHJA 3CJTA 4UMFA 1K3UB 4HPWA 1P2GA 5EIWA 4J90A 4WH0A 2BR4A 2FG7C 2XYQA 1ZNQO 3EXIA 4PX3A 4B6EA 3OQIA 3A4LA 3K09C 3L7NA 1Y6FA 1JB1A 3FW1A 4F1KA 5B4TA 1WZNA 2OB2A 3ZBPA 1Y7TA 2B7LA 3R7DA 1VIMA 2C4VA 1UM8A 4C4TA 1VSVA 1WDKA 5BP7A 1XZGA 3GPDG 4QUJA 4JIMA 4PPQA 1E7RA 4JFRA 1IY0A 2O07A 4JC0A 1KAQA 1K1EA 2FEKA 4HNAA 2E82A 2VATA 4C08A 3C70A 1WDWB 4MA5A 1FYXA 1P1HA 3AHJA 4QPNA 2QXUA 5DEOA 3ZTYA 3UPUA 2MSLA 4JB0A 1Z5UA 1G60A 2A92A 5K3BA 2ZJ3A 1YIDA 5IUNC 4I8XA 3G0GA 1YRQA 3CS3A 4OQYA 4QE3A 4C0HA 4QKQA 3Q11A 2HMTA 2PEYA 2XYGA 3QNUA 1U0TA 3VH3A 3VV3A 2GJ8A 2H1CA 1CRZA 1QFXA 3L4BC 1A4XA 1N3YA 4BNUA 4TTQA 5TMDA 4BNLA 2Q4BA 3KHKA 2O0LA 4HJXA 1ZBDA 4OF4A 2GF0A 1NPYA 3IR6A 4J2HA 5CDSA 1ECJA 5AM0A 2C5BA 3QMVA 4X24A 3IUYA 1J1UA 1JJFA 1YAJA 2W11A 4QHSA 3RU3A 1AZTA 1X94A 2XCOA 2ZOSA 3T0FA 4BU0A 4G8CA 4DTIA 3EG5A 1E9DA 2XUDA 3GT4A 3LDFA 4BWFB 1ISMA 5F33A 4HNQA 3C3PA 1FZTA 2OECA 4XKJA 1Z29A 4YCCA 1GN9A 1VSTA 5AM4A 3K70C 4EPVA 2XIJA 1GZ7A 1NVAA 1SVOA 3N7TA 4WLNA 3VKHA 2C00A 4B0OA 2WTBA 1V5FA 4WESA 1KORA 3H9EO 1Z6QA 2CVOA 3FI0A 1IOVA 2J07A 1ULUA 3NNDA 4G4SP 3I9LA 1L7PA 1HA3A 3IAM1 4ZVOA 1SXQA 2JKVA 4OLAA 3SQXA 4I19A 1U3FA 4IPTA 3MS7A 2GILA 2IP4A 3ROEA 3TZ6A 5IJ9B 3DCIA 1E20A 1EM6A 4YP0A 4YMHA 3RVLA 1TMOA 2VAMA 2WFZA 3ZWDA 2G8NA 2G9UA 3FPBA 5D3MA 1O95D 2PLFA 4FT4A 5HS4A 1YONA 3GFBA 3HJGA 3IEPA 2VQFB 4W1PA 3GNLA 4HWPA 1NV8A 1JDUA 5M29A 2X8JA 2J30A 3JAWB 5CM8B 1F0KA 1SRQA 3C15C 2BC9A 1R66A 1X19A 1RLOA 3W7VA 3PT9A 1UT6A 4L5CA 4ZT2A 1KJNA 1TM3E 3GI1A 4ZAWA 1G21E 1PSZA 3FHOA 4B4OA 2CCKA 2E4AA 4LFBB 4MYCA 5COAA 1N4AA 1IZ7A 5KJFA 3QWFA 1FP4B 3GARA 2XYVA 3I52A 4PIPA 1L5GB 3ZR4B 3IHWA 3WA7A 2X2PA 3JQ7B 1NUSA 3HB4X 1F7UA 3EWIA 2AN9A 1NXXA 3EBLA 5KNDD 4IV8A 4Z9FA 2ERCA 3BC1A 2O50A 2VJAA 3VYRB 2XOEA 3BFPA 5HQTA 1HTWA 2WP8J 4B7ZA 5KNDH 1P9NA 4WKOA 5HE8A 2YV5A 1E3EA 1K8ZB 1ACMA 4UMVA 2G71A 3QMWA 4WXPA 3ZS9A 2WTEA 3ZD6A 2AHRA 1V0JA 5H7XA 3CT6A 3DE0X 1N7JA 3FZEA 1LLDA 2OAP1 3PWZA 4D4HA 3N0TA 1BMFD 2PWZA 2R1TA 5K0JA 3WBFA 4MA0A 3G2NA 1Y6GA 1HSOA 3I9V6 5FUBA 1GUZA 4ZC1A 1IBMB 1A7JA 1ZEJA 1GSHA 3IMKA 3PD7A 1DVRA 4L08A 5GIPE 1COWD 1UKCA 1U0RA 3FYHA 4XQGA 4Z0TA 3UB2A 5CDTA 4P82A 1T5LA 2Q0SA 2YXNA 4BFZA 2I99A 4RPHA 3UYLA 3KX2A 1BE6A 1CUYA 4IQFA 1I30A 1RXIA 4KK3A 4FZJA 3UT5B 2Y1KA 1XYVA 2BH9A 3GUVA 5ITSA 5KHOC 2YHUA 1QGUB 3EYWA 5AHRA 3E0XA 2AFHA 3ZK7A 4RE5A 2FHPA 1ZAKA 4CHTA 5LU8A 1YA6A 1X7ZA 1AKYA 2Q6VA 5H80A 4GAEA 1SD2A 2CYCA 3NTXA 2ECFA 2G5TA 1NURA 5FH9A 2R2AA 2YCLA 1FRNA 3GJRA 4R0NA 3IT1A 4Y8VA 3WMGA 1NVGA 2BLNA 8ATCA 5C4MA 1PVDA 1EQAA 2V03A 2CFSA 1ZI8A 5LD2C 3CBQA 5I4KA 2NTVA 2WIAA 4XTCS 1M72A 2CN1A 1IRXA 4XWKA 2BP7B 4LGMA 4NBTA 1YJCA 3WGMA 2Y1CA 2G0AA 1IG0A 1EUCB 4FOOA 2G1KA 4UULA 4XE5A 1KNQA 3KE9A 3SLKA 2C61A 3DBOB 4U8HA 1IHOA 4NATA 4WZBE 4IGFA 4F4JA 4I50A 1JWAB 2TSYB 3OD1A 1VP9A 1UPBA 1T6BY 1YR3A 1FTNA 3COWA 1OGJA 3CM0A 4O4JB 5EZYB 4GI1A 3AL0C 3RABA 3AQ4A 4OQDA 4MULA 1WW3A 3GVXA 2HWXA 2HSDA 4TKZA 2RHGB 4EI2A 1V2HE 2JI8A 1X38A 2FPGA 2WPNA 4P2GA 4QRIA 3RVOA 5L9AA 3ETCA 3D7RA 5EY5B 4DV6B 1T29A 2WJGA 2Q28A 2I78A 2AZ4A 1S3SA 1YGPA 4R2WA 4DM3A 4EQ6A 2B0CA 1K7SN 2VQSA 1K6JA 3DGFC 1DXHA 5I47A 2AIRA 1LPMA 2YNMA 2C88A 2XNDD 1Z4PX 1KK3A 1JSLA 2HQBA 3AL2A 3BN3A 2I2DA 3EC7A 3RTBA 1LGYA 1RYDA 1I1OA 4TYYA 2OXTA 1TJ5A 1H2YA 1PI3A 2P2NA 1DKUA 5A4KA 4EVRA 1PN3A 1P0CA 1QRRA 1UDCA 2WP0A 3HKEB 2V7WA 1CUUA 1H1LB 1KJ8A 3EXHA 3PR3A 5TF4A 3U3DA 5B2FA 1NC3A 5LDGA 1RKXA 3ZQUA 4N7RA 4PX5A 3J7AC 1U1GA 3OBBA 1LXCA 2VKQA 2IC5A 4X6UA 1Z6YA 5DF1A 3UC5A 4F6RA 2OKGA 3R6GA 2HJWA 4Q39A 1O6FA 3W79A 4FYKA 4NQRA 3THXB 5GM2A 1SXJB 2D1QA 2IDKA 1OA1A 3RC9A 1UBJS 4QU8A 4LTNA 4TXMA 3UF0A 3G5AA 4F4HA 1NRIA 2OK7A 3OOYA 1G3UA 3I32A 2FY8A 1USGA 4DCPA 2EGUA 2QV0A 3A4YA 3BZUA 3V8QA 2DZDA 1JG1A 4KAXA 4KYTA 2PYZA 2C9DA 4PCVA 2P6UA 4N39A 1PT6A 4EATA 4PC3A 3MN1A 5JD6A 1EQUA 4FX2A 2VZ9A 1TC2A 2CDRA 2A5LA 4FLFA 5J5CA 4X20A 4DXHA 2X9LA 1WUHS 3RFXA 4LE2A 1N9KA 3FVQA 2QM3A 3GFQA 1EUDB 3REQB 5HKAA 2X9QA 3AO0B 6ADHA 4XYGA 1YOVA 1QFMA 2HZBA 3ZE9A 3OZCA 7MDHA 2PVCA 1RBMA 5DHAA 1HQCA 3IUJA 1IHDA 3RT9A 3TTXA 1KKMA 4IRXA 2ISSD 3KYDA 1UXJA 5IANA 4H0FA 2QNIA 1C7RA 3DEFA 1DIGA 5LLSA 3QEMB 3AM5A 1TZ2A 2GRJA 3U44A 4K6MA 5LQMA 4JR2A 4KDFA 4C4ZA 2QTRA 3N07A 1KVRA 4HDQB 4LBYA 1QNFA 5IZCA 1E3MA 1M6HA 2J0UB 3ONDA 4Q66C 1D2GA 3K9WA 3U3RA 1M1YE 3ZH9B 2VT7A 2GPJA 3AESB 4BGIA 4D46A 1CX9B 2FRXA 3R6DA 1OYWA 2QJRA 1TCAA 1V48A 4DRXB 5L7WA 5IASA 3FUVA 1J4AA 1DQZA 2QOEA 1CDOA 1HYGA 3JSXA 3KB1A 3QXHA 4ZI7B 3RFTA 3COSA 1QZ3A 3WWDA 1NVEA 4GR9A 3CUSA 1HMPA 1PWEA 3CEMA 3WLLA 3F46A 3B2NA 5BPHA 2B5OA 1D2RA 2OHGA 2C2MA 4Z7JA 2GSWA 4FMDB 4E15A 4JU8A 3NVKI 3AFNA 1DTWA 1UOEA 2WT4A 5HHTA 3P2IA 1ZR4A 4BQNA 1D5CA 2O19A 1CR1A 3BREA 1XRMA 1ZI9A 4XB2A 5KNBH 3T7AA 2QU7A 5B7PA 2CUKA 3I2GA 2AE1A 1E0SA 1OBOA 2PNJA 1L5VA 2G76A 5G1PA 4DW8A 1F38A 4ZKEA 2KYRA 1Z37A 3CHYA 2N3ZA 3ONNA 3FFTA 2XB8A 4WKPA 5DBGA 4PFQA 2Z8ZA 3LP5A 3NIFB 2XA9A 5EP4A 4IWYA 3TRKA 2HDOA 2QAGC 4NLLA 3OEED 4NMHA 3LHIA 3CRNA 2DQYA 3JRWA 3O1IC 4AFNA 3U4QB 1YR1A 2ZAMA 1KRXA 4LXUA 2DECA 4IM7A 5G2OA 3AM1A 2O4UX 5MN6A 1QVZA 4D6XA 1DI0A 4JXXA 3BFJA 4BMYA 1R7RA 5CCEA 3FR7A 3GWZA 3H1TA 3QE4A 4RZSA 3V4OA 5HK9A 2VYFA 1T1GA 1MAWA 4UUPA 4C0KA 1ECGA 1QKJA 4JVNA 5HWSA 1I7LA 3ZHYA 5KYGA 3HVRA 3WGYA 1RC8A 1NSFA 4OP3A 1AZSC 2PBFA 3ZWPA 1UMKA 2E18A 1SVMA 4LW8A 5HF5A 4BO8A 5AW2A 2I0FA 3J80A 1N1EA 1QZUA 4DIEA 3PA6A 4D92A 4ZVVA 2P9HA 1D2HA 3O84A 3BTUA 2GCNA 5H59A 5IPFA 1BIFA 1PP4A 1XFDA 2D8AA 3D3JA 4OKNA 2H9YA 3JXEA 4H7JA 5IKEA 1MO4A 1XN4A 3BDVA 4LY9A 4IIDA 1KEEB 2DPHA 1CUJA 2JA1A 4AJNA 4YAUA 3GBSA 1U7HA 5K09A 2A9QA 5DOZA 3GEBA 4QYMA 2IY7A 5DNEA 3L0OA 2GXAA 2YY7A 1N6OA 1MC5A 1Z6GA 4HJRA 4FHZA 4XI9A 2FQXA 3NCHA 4L2IA 2FPPB 4PG7A 3FWYA 2DQKA 1G4AE 3SMVA 3SS7X 3N0WA 1G63A 1OBCA 5CDUA 1GV0A 4M0FA 1J20A 3U7GA 1TTHA 5JTUA 1LSJA 2XWJI 4QPCA 4BQRA 4N1AA 4NBUA 5BQXA 5KHAA 4DC1A 4R40A 3X1XA 3A2LA 4TWIA 1JKFA 2QORA 1JNYA 3L46A 1SBYA 1ADFA 3AKEA 4Q1FA 4DSTA 2NOAA 1UM9B 2HRQA 2J09A 4XQEA 3C3YA 3UENA 2R60A 3D0QA 1VL2A 3O6VA 2G9QA 3JYOA 3RSGA 3U60B 3JTMA 3L0IB 4DKXA 2AF3C 3J7TA 4H1TA 3V32A 1V39A 4WN9A 3GJ6A 3CH7A 3DJFA 4V03A 4EJSC 1VI2A 3FBGA 5F7ZA 2IYLD 1OXTA 1E7WA 3HL0A 3CE6A 1QTIA 1Z4JA 2Y1WA 4JBHA 3PUXA 2XAUA 3T1TA 1C9EA 4ER0A 3HB1A 4MPTA 3TK1A 1I7QB 2Z0MA 4YBZA 4EABA 1B7GO 4E21A 4YRZA 4HWKA 2DFDA 4BP8A 3PUIA 4CCAA 2I54A 2DUMA 1J8VA 3CURA 1I2CA 1RLJA 3BG5A 5GZ1A 2AOWA 2XZPA