1KCAA

Crystal structure of the lambda repressor c-terminal domain octamer
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
101
structure length
101
Chain Sequence
ASDSAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNESCSVVGKVIASQWPEETFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the lambda repressor C-terminal domain octamer.
pubmed doi rcsb
source organism Enterobacteria phage lambda
molecule tags Gene regulation
molecule keywords REPRESSOR PROTEIN CI
total genus 13
structure length 101
sequence length 101
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 1kcaA00
3JSPA 2FKDA 1B12A 2FJRA 4ME8A 4K8WA 1T7DA 3K2ZA 2HO0A 3JSOA 1KCAA 1JHFA 1F39A 4NV4A 2HNFA 3BDNA 3IIQA 1JHEA 1JHHA 1UMUA 3S04A 4N31A 1AY9A 1KN9A 1I4VA 1JHCA
chains in the Genus database with same CATH superfamily
3JSPA 2FKDA 1B12A 2FJRA 4ME8A 4K8WA 1T7DA 3K2ZA 2HO0A 3JSOA 1KCAA 1JHFA 1F39A 4NV4A 2HNFA 3BDNA 3IIQA 1JHEA 1JHHA 1UMUA 3S04A 4N31A 1AY9A 1KN9A 1I4VA 1JHCA
chains in the Genus database with same CATH topology
3JSPA 2FKDA 1B12A 2FJRA 4ME8A 4K8WA 1T7DA 3K2ZA 2HO0A 3JSOA 1KCAA 1JHFA 1F39A 4NV4A 2HNFA 3BDNA 3IIQA 1JHEA 1JHHA 1UMUA 3S04A 4N31A 1AY9A 1KN9A 1I4VA 1JHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JSP A;  2FKD A;  1B12 A;  2FJR A;  4ME8 A;  4K8W A;  1T7D A;  3K2Z A;  2HO0 A;  3JSO A;  1KCA A;  1JHF A;  1F39 A;  4NV4 A;  2HNF A;  3BDN A;  3IIQ A;  1JHE A;  1JHH A;  1UMU A;  3S04 A;  4N31 A;  1AY9 A;  1KN9 A;  1I4V A;  1JHC A; 
#chains in the Genus database with same CATH topology
 3JSP A;  2FKD A;  1B12 A;  2FJR A;  4ME8 A;  4K8W A;  1T7D A;  3K2Z A;  2HO0 A;  3JSO A;  1KCA A;  1JHF A;  1F39 A;  4NV4 A;  2HNF A;  3BDN A;  3IIQ A;  1JHE A;  1JHH A;  1UMU A;  3S04 A;  4N31 A;  1AY9 A;  1KN9 A;  1I4V A;  1JHC A; 
#chains in the Genus database with same CATH homology
 3JSP A;  2FKD A;  1B12 A;  2FJR A;  4ME8 A;  4K8W A;  1T7D A;  3K2Z A;  2HO0 A;  3JSO A;  1KCA A;  1JHF A;  1F39 A;  4NV4 A;  2HNF A;  3BDN A;  3IIQ A;  1JHE A;  1JHH A;  1UMU A;  3S04 A;  4N31 A;  1AY9 A;  1KN9 A;  1I4V A;  1JHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...