1KCAA

Crystal structure of the lambda repressor c-terminal domain octamer
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
101
structure length
101
Chain Sequence
ASDSAFWLEVEGNSMTAPTGSKPSFPDGMLILVDPEQAVEPGDFCIARLGGDEFTFKKLIRDSGQVFLQPLNPQYPMIPCNESCSVVGKVIASQWPEETFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the lambda repressor C-terminal domain octamer.
pubmed doi rcsb
source organism Enterobacteria phage lambda
molecule tags Gene regulation
molecule keywords REPRESSOR PROTEIN CI
total genus 13
structure length 101
sequence length 101
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 1kcaA00
3K2ZA 1KN9A 3JSOA 2FKDA 3BDNA 3JSPA 4N31A 1JHFA 1B12A 4ME8A 1UMUA 3IIQA 1JHEA 2HO0A 1JHCA 1KCAA 4K8WA 4NV4A 2FJRA 3S04A 1AY9A 2HNFA 1T7DA 1I4VA 1F39A 1JHHA
chains in the Genus database with same CATH superfamily
3K2ZA 1KN9A 3JSOA 2FKDA 3BDNA 3JSPA 4N31A 1JHFA 1B12A 4ME8A 1UMUA 3IIQA 1JHEA 2HO0A 1JHCA 1KCAA 4K8WA 4NV4A 2FJRA 3S04A 1AY9A 2HNFA 1T7DA 1I4VA 1F39A 1JHHA
chains in the Genus database with same CATH topology
3K2ZA 1KN9A 3JSOA 2FKDA 3BDNA 3JSPA 4N31A 1JHFA 1B12A 4ME8A 1UMUA 3IIQA 1JHEA 2HO0A 1JHCA 1KCAA 4K8WA 4NV4A 2FJRA 3S04A 1AY9A 2HNFA 1T7DA 1I4VA 1F39A 1JHHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K2Z A;  1KN9 A;  3JSO A;  2FKD A;  3BDN A;  3JSP A;  4N31 A;  1JHF A;  1B12 A;  4ME8 A;  1UMU A;  3IIQ A;  1JHE A;  2HO0 A;  1JHC A;  1KCA A;  4K8W A;  4NV4 A;  2FJR A;  3S04 A;  1AY9 A;  2HNF A;  1T7D A;  1I4V A;  1F39 A;  1JHH A; 
#chains in the Genus database with same CATH topology
 3K2Z A;  1KN9 A;  3JSO A;  2FKD A;  3BDN A;  3JSP A;  4N31 A;  1JHF A;  1B12 A;  4ME8 A;  1UMU A;  3IIQ A;  1JHE A;  2HO0 A;  1JHC A;  1KCA A;  4K8W A;  4NV4 A;  2FJR A;  3S04 A;  1AY9 A;  2HNF A;  1T7D A;  1I4V A;  1F39 A;  1JHH A; 
#chains in the Genus database with same CATH homology
 3K2Z A;  1KN9 A;  3JSO A;  2FKD A;  3BDN A;  3JSP A;  4N31 A;  1JHF A;  1B12 A;  4ME8 A;  1UMU A;  3IIQ A;  1JHE A;  2HO0 A;  1JHC A;  1KCA A;  4K8W A;  4NV4 A;  2FJR A;  3S04 A;  1AY9 A;  2HNF A;  1T7D A;  1I4V A;  1F39 A;  1JHH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...