1KCEA

E. coli thymidylate synthase mutant e58q in complex with cb3717 and 2'-deoxyuridine 5'-monophosphate (dump)
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
263
structure length
263
Chain Sequence
KQYLELMQKVLDEGTQKNDRTGTGTLSIFGHQMRFNLQDGFPLVTTKRCHLRSIIHELLWFLQGDTNIAYLHENNVTIWDEWADENGDLGPVYGKQWRAWPTPDGRHIDQITTVLNQLKNDPDSRRIIVSAWNVGELDKMALAPCHAFFQFYVADGKLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQCDLEVGDFVWTGGDTHLYSNHMDQTHLQLSREPRPLPKLIIKRKPESIFDYRFEDFEIEGYDPHPGIKAPVAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An essential role for water in an enzyme reaction mechanism: the crystal structure of the thymidylate synthase mutant E58Q.
pubmed doi rcsb
molecule keywords THYMIDYLATE SYNTHASE
molecule tags Transferase
source organism Escherichia coli
total genus 89
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 1996-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 1kceA00
3GG5A 1TDBA 1KCEA 1TSVA 5H39A 1JMFA 1NCEA 5BY6A 1HVYA 3UWLA 4EB4A 3B9HA 3H9KA 1F4BA 1SEJA 1TSXA 1DNAA 4FOGA 1JUJA 5H38A 4KNZA 3DL5A 3EF9A 1HZWA 3HB8A 2G8XA 3IX6A 4GD7A 1NJAA 1BQ2A 1QZFA 3BZ0A 3N5EA 3GH2X 4O1XA 2G8DA 3QG2A 3BYXA 1J3IC 1TLSA 1AJMA 1BIDA 3BHRA 2VF0A 4IQBA 1AOBA 3HBBA 1AIQA 1F4EA 2VETA 4EILA 3IROA 1RTSA 1F4DA 2TSRA 3QJ7A 4Q0DA 1DDUA 1J3KC 3ED7A 2G89A 3HJ3A 2G8AA 3JSUA 2H2QA 4IQQA 4PSGA 3IRNA 1HW4A 2BBQA 3EGYX 1TLCA 1B49A 1TVWA 4GEVA 3IHIA 1LCBA 4KYAA 1EV8A 4O7UA 1NJBA 4FGTA 1VZDA 1VZAA 3DGAC 1JTUA 1LCEA 1BP0A 4EINA 3UM5A 4H0RA 3EBUA 3EHIX 1NJEA 1BSPA 1FWMA 3CL9A 3OB7A 4G2OX 3DG8C 4GYHA 4DPHA 4XSCA 1BO7A 3TMSA 3UM6A 3V8HA 1AXWA 1TVVA 3C0AA 1BKPA 1TISA 2A9WA 3BFIA 4LRRA 4E5OA 2RDAA 5J7WA 2RD8A 1VZCA 3IK1A 1F4CA 1THYA 3IRMA 3KJRA 3C06A 4DPDA 3EJLA 1BKOA 4KY4A 1B5DA 4UP1A 3DL6A 3BNZA 4KY8A 4FQSA 2TDMA 4FOAA 4H1IA 1TSWA 1JMIA 2FTOX 2TDDA 4XSEA 1TSZA 4TMSA 1TRGA 1B5EA 1BO8A 1TDAA 2ONBA 1BQ1A 3KJSA 1EV5A 1TDCA 1YPVA 4XSDA 4ECKA 3UM8A 1SYNA 4Q0EA 1VZEA 3UWLB 3INVA 3BHLA 4KPWA 3EAWX 3EDWX 4ISKA 3QGTA 1BJGA 1TSLA 2FTNA 3N5GA 1CI7A 3BGXA 4ISWA 3K2HA 1TSDA 4F2VA 1TSNA 4E28A 1I00A 1TYSA 3N5EB 4H0UA 1TVUA 1F4GA 4JEFA 4IRRA 4FOXA 1BDUA 1J3JC 5WRNA 4DQ1A 1ZPRA 1NJCA 1JTQA 2FTQA 1EVFA 3CLBA 3I3RA 1B02A 1FFLA 1F4FA 3IJZA 1KZIA 1JMHA 4O1XD 1EVGA 2AAZA 1KZJA 2RD8B 5H3AA 1AN5A 1VZBA 1TSMA 3IK0A 2OIPA 1JG0A 2G86A 1BPJA 1NJDA 3NRRA 5HS3A 4G6WX 1TSYA 1LCAA 2TSCA 1BP6A 1QQQA 1JMGA 4O1UA 1F28A 1TDUA 1JUTA 3B5BA 1TJSA 3GH0A 4EZ8A 1BSFA 4DP3A 2KCEA 5FCTA 1HW3A 1JU6A 3KGBA
chains in the Genus database with same CATH superfamily
3GG5A 1TDBA 1KCEA 1TSVA 5H39A 1JMFA 1NCEA 5BY6A 1HVYA 3UWLA 4EB4A 3B9HA 3H9KA 1F4BA 1SEJA 1TSXA 1DNAA 4FOGA 1JUJA 5H38A 4KNZA 3DL5A 3EF9A 1HZWA 3HB8A 2G8XA 3IX6A 4GD7A 1NJAA 1BQ2A 1QZFA 3BZ0A 3N5EA 3GH2X 4O1XA 2G8DA 3QG2A 3BYXA 1J3IC 1TLSA 1AJMA 1BIDA 3BHRA 2VF0A 4IQBA 1AOBA 3HBBA 1AIQA 1F4EA 2VETA 4EILA 3IROA 1RTSA 1F4DA 2TSRA 3QJ7A 4Q0DA 1DDUA 1J3KC 3ED7A 2G89A 3HJ3A 2G8AA 3JSUA 2H2QA 4IQQA 4PSGA 3IRNA 1HW4A 2BBQA 3EGYX 1TLCA 1B49A 1TVWA 4GEVA 3IHIA 1LCBA 4KYAA 1EV8A 4O7UA 1NJBA 4FGTA 1VZDA 1VZAA 3DGAC 1JTUA 1LCEA 1BP0A 4EINA 3UM5A 4H0RA 3EBUA 3EHIX 1NJEA 1BSPA 1FWMA 3CL9A 3OB7A 4G2OX 3DG8C 4GYHA 4DPHA 4XSCA 1BO7A 3TMSA 3UM6A 3V8HA 1AXWA 1TVVA 3C0AA 1BKPA 1TISA 2A9WA 3BFIA 4LRRA 4E5OA 2RDAA 5J7WA 2RD8A 1VZCA 3IK1A 1F4CA 1THYA 3IRMA 3KJRA 3C06A 4DPDA 3EJLA 1BKOA 4KY4A 1B5DA 4UP1A 3DL6A 3BNZA 4KY8A 4FQSA 2TDMA 4FOAA 4H1IA 1TSWA 1JMIA 2FTOX 2TDDA 4XSEA 1TSZA 4TMSA 1TRGA 1B5EA 1BO8A 1TDAA 2ONBA 1BQ1A 3KJSA 1EV5A 1TDCA 1YPVA 4XSDA 4ECKA 3UM8A 1SYNA 4Q0EA 1VZEA 3UWLB 3INVA 3BHLA 4KPWA 3EAWX 3EDWX 4ISKA 3QGTA 1BJGA 1TSLA 2FTNA 3N5GA 1CI7A 3BGXA 4ISWA 3K2HA 1TSDA 4F2VA 1TSNA 4E28A 1I00A 1TYSA 3N5EB 4H0UA 1TVUA 1F4GA 4JEFA 4IRRA 4FOXA 1BDUA 1J3JC 5WRNA 4DQ1A 1ZPRA 1NJCA 1JTQA 2FTQA 1EVFA 3CLBA 3I3RA 1B02A 1FFLA 1F4FA 3IJZA 1KZIA 1JMHA 4O1XD 1EVGA 2AAZA 1KZJA 2RD8B 5H3AA 1AN5A 1VZBA 1TSMA 3IK0A 2OIPA 1JG0A 2G86A 1BPJA 1NJDA 3NRRA 5HS3A 4G6WX 1TSYA 1LCAA 2TSCA 1BP6A 1QQQA 1JMGA 4O1UA 1F28A 1TDUA 1JUTA 3B5BA 1TJSA 3GH0A 4EZ8A 1BSFA 4DP3A 2KCEA 5FCTA 1HW3A 1JU6A 3KGBA
chains in the Genus database with same CATH topology
3GG5A 1TDBA 1KCEA 1TSVA 5H39A 1JMFA 1NCEA 5BY6A 1HVYA 3UWLA 4EB4A 3B9HA 3H9KA 1F4BA 1SEJA 1TSXA 1DNAA 4FOGA 1JUJA 5H38A 4KNZA 3DL5A 3EF9A 1HZWA 3HB8A 2G8XA 3IX6A 4GD7A 1NJAA 1BQ2A 1QZFA 3BZ0A 3N5EA 3GH2X 4O1XA 2G8DA 3QG2A 3BYXA 1J3IC 1TLSA 1AJMA 1BIDA 3BHRA 2VF0A 4IQBA 1AOBA 3HBBA 1AIQA 1F4EA 2VETA 4EILA 3IROA 1RTSA 1F4DA 2TSRA 3QJ7A 4Q0DA 1DDUA 1J3KC 3ED7A 2G89A 3HJ3A 2G8AA 3JSUA 2H2QA 4IQQA 4PSGA 3IRNA 1HW4A 2BBQA 3EGYX 1TLCA 1B49A 1TVWA 4GEVA 3IHIA 1LCBA 4KYAA 1EV8A 4O7UA 1NJBA 4FGTA 1VZDA 1VZAA 3DGAC 1JTUA 1LCEA 1BP0A 4EINA 3UM5A 4H0RA 3EBUA 3EHIX 1NJEA 1BSPA 1FWMA 3CL9A 3OB7A 4G2OX 3DG8C 4GYHA 4DPHA 4XSCA 1BO7A 3TMSA 3UM6A 3V8HA 1AXWA 1TVVA 3C0AA 1BKPA 1TISA 2A9WA 3BFIA 4LRRA 4E5OA 2RDAA 5J7WA 2RD8A 1VZCA 3IK1A 1F4CA 1THYA 3IRMA 3KJRA 3C06A 4DPDA 3EJLA 1BKOA 4KY4A 1B5DA 4UP1A 3DL6A 3BNZA 4KY8A 4FQSA 2TDMA 4FOAA 4H1IA 1TSWA 1JMIA 2FTOX 2TDDA 4XSEA 1TSZA 4TMSA 1TRGA 1B5EA 1BO8A 1TDAA 2ONBA 1BQ1A 3KJSA 1EV5A 1TDCA 1YPVA 4XSDA 4ECKA 3UM8A 1SYNA 4Q0EA 1VZEA 3UWLB 3INVA 3BHLA 4KPWA 3EAWX 3EDWX 4ISKA 3QGTA 1BJGA 1TSLA 2FTNA 3N5GA 1CI7A 3BGXA 4ISWA 3K2HA 1TSDA 4F2VA 1TSNA 4E28A 1I00A 1TYSA 3N5EB 4H0UA 1TVUA 1F4GA 4JEFA 4IRRA 4FOXA 1BDUA 1J3JC 5WRNA 4DQ1A 1ZPRA 1NJCA 1JTQA 2FTQA 1EVFA 3CLBA 3I3RA 1B02A 1FFLA 1F4FA 3IJZA 1KZIA 1JMHA 4O1XD 1EVGA 2AAZA 1KZJA 2RD8B 5H3AA 1AN5A 1VZBA 1TSMA 3IK0A 2OIPA 1JG0A 2G86A 1BPJA 1NJDA 3NRRA 5HS3A 4G6WX 1TSYA 1LCAA 2TSCA 1BP6A 1QQQA 1JMGA 4O1UA 1F28A 1TDUA 1JUTA 3B5BA 1TJSA 3GH0A 4EZ8A 1BSFA 4DP3A 2KCEA 5FCTA 1HW3A 1JU6A 3KGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GG5 A;  1TDB A;  1KCE A;  1TSV A;  5H39 A;  1JMF A;  1NCE A;  5BY6 A;  1HVY A;  3UWL A;  4EB4 A;  3B9H A;  3H9K A;  1F4B A;  1SEJ A;  1TSX A;  1DNA A;  4FOG A;  1JUJ A;  5H38 A;  4KNZ A;  3DL5 A;  3EF9 A;  1HZW A;  3HB8 A;  2G8X A;  3IX6 A;  4GD7 A;  1NJA A;  1BQ2 A;  1QZF A;  3BZ0 A;  3N5E A;  3GH2 X;  4O1X A;  2G8D A;  3QG2 A;  3BYX A;  1J3I C;  1TLS A;  1AJM A;  1BID A;  3BHR A;  2VF0 A;  4IQB A;  1AOB A;  3HBB A;  1AIQ A;  1F4E A;  2VET A;  4EIL A;  3IRO A;  1RTS A;  1F4D A;  2TSR A;  3QJ7 A;  4Q0D A;  1DDU A;  1J3K C;  3ED7 A;  2G89 A;  3HJ3 A;  2G8A A;  3JSU A;  2H2Q A;  4IQQ A;  4PSG A;  3IRN A;  1HW4 A;  2BBQ A;  3EGY X;  1TLC A;  1B49 A;  1TVW A;  4GEV A;  3IHI A;  1LCB A;  4KYA A;  1EV8 A;  4O7U A;  1NJB A;  4FGT A;  1VZD A;  1VZA A;  3DGA C;  1JTU A;  1LCE A;  1BP0 A;  4EIN A;  3UM5 A;  4H0R A;  3EBU A;  3EHI X;  1NJE A;  1BSP A;  1FWM A;  3CL9 A;  3OB7 A;  4G2O X;  3DG8 C;  4GYH A;  4DPH A;  4XSC A;  1BO7 A;  3TMS A;  3UM6 A;  3V8H A;  1AXW A;  1TVV A;  3C0A A;  1BKP A;  1TIS A;  2A9W A;  3BFI A;  4LRR A;  4E5O A;  2RDA A;  5J7W A;  2RD8 A;  1VZC A;  3IK1 A;  1F4C A;  1THY A;  3IRM A;  3KJR A;  3C06 A;  4DPD A;  3EJL A;  1BKO A;  4KY4 A;  1B5D A;  4UP1 A;  3DL6 A;  3BNZ A;  4KY8 A;  4FQS A;  2TDM A;  4FOA A;  4H1I A;  1TSW A;  1JMI A;  2FTO X;  2TDD A;  4XSE A;  1TSZ A;  4TMS A;  1TRG A;  1B5E A;  1BO8 A;  1TDA A;  2ONB A;  1BQ1 A;  3KJS A;  1EV5 A;  1TDC A;  1YPV A;  4XSD A;  4ECK A;  3UM8 A;  1SYN A;  4Q0E A;  1VZE A;  3UWL B;  3INV A;  3BHL A;  4KPW A;  3EAW X;  3EDW X;  4ISK A;  3QGT A;  1BJG A;  1TSL A;  2FTN A;  3N5G A;  1CI7 A;  3BGX A;  4ISW A;  3K2H A;  1TSD A;  4F2V A;  1TSN A;  4E28 A;  1I00 A;  1TYS A;  3N5E B;  4H0U A;  1TVU A;  1F4G A;  4JEF A;  4IRR A;  4FOX A;  1BDU A;  1J3J C;  5WRN A;  4DQ1 A;  1ZPR A;  1NJC A;  1JTQ A;  2FTQ A;  1EVF A;  3CLB A;  3I3R A;  1B02 A;  1FFL A;  1F4F A;  3IJZ A;  1KZI A;  1JMH A;  4O1X D;  1EVG A;  2AAZ A;  1KZJ A;  2RD8 B;  5H3A A;  1AN5 A;  1VZB A;  1TSM A;  3IK0 A;  2OIP A;  1JG0 A;  2G86 A;  1BPJ A;  1NJD A;  3NRR A;  5HS3 A;  4G6W X;  1TSY A;  1LCA A;  2TSC A;  1BP6 A;  1QQQ A;  1JMG A;  4O1U A;  1F28 A;  1TDU A;  1JUT A;  3B5B A;  1TJS A;  3GH0 A;  4EZ8 A;  1BSF A;  4DP3 A;  2KCE A;  5FCT A;  1HW3 A;  1JU6 A;  3KGB A; 
#chains in the Genus database with same CATH topology
 3GG5 A;  1TDB A;  1KCE A;  1TSV A;  5H39 A;  1JMF A;  1NCE A;  5BY6 A;  1HVY A;  3UWL A;  4EB4 A;  3B9H A;  3H9K A;  1F4B A;  1SEJ A;  1TSX A;  1DNA A;  4FOG A;  1JUJ A;  5H38 A;  4KNZ A;  3DL5 A;  3EF9 A;  1HZW A;  3HB8 A;  2G8X A;  3IX6 A;  4GD7 A;  1NJA A;  1BQ2 A;  1QZF A;  3BZ0 A;  3N5E A;  3GH2 X;  4O1X A;  2G8D A;  3QG2 A;  3BYX A;  1J3I C;  1TLS A;  1AJM A;  1BID A;  3BHR A;  2VF0 A;  4IQB A;  1AOB A;  3HBB A;  1AIQ A;  1F4E A;  2VET A;  4EIL A;  3IRO A;  1RTS A;  1F4D A;  2TSR A;  3QJ7 A;  4Q0D A;  1DDU A;  1J3K C;  3ED7 A;  2G89 A;  3HJ3 A;  2G8A A;  3JSU A;  2H2Q A;  4IQQ A;  4PSG A;  3IRN A;  1HW4 A;  2BBQ A;  3EGY X;  1TLC A;  1B49 A;  1TVW A;  4GEV A;  3IHI A;  1LCB A;  4KYA A;  1EV8 A;  4O7U A;  1NJB A;  4FGT A;  1VZD A;  1VZA A;  3DGA C;  1JTU A;  1LCE A;  1BP0 A;  4EIN A;  3UM5 A;  4H0R A;  3EBU A;  3EHI X;  1NJE A;  1BSP A;  1FWM A;  3CL9 A;  3OB7 A;  4G2O X;  3DG8 C;  4GYH A;  4DPH A;  4XSC A;  1BO7 A;  3TMS A;  3UM6 A;  3V8H A;  1AXW A;  1TVV A;  3C0A A;  1BKP A;  1TIS A;  2A9W A;  3BFI A;  4LRR A;  4E5O A;  2RDA A;  5J7W A;  2RD8 A;  1VZC A;  3IK1 A;  1F4C A;  1THY A;  3IRM A;  3KJR A;  3C06 A;  4DPD A;  3EJL A;  1BKO A;  4KY4 A;  1B5D A;  4UP1 A;  3DL6 A;  3BNZ A;  4KY8 A;  4FQS A;  2TDM A;  4FOA A;  4H1I A;  1TSW A;  1JMI A;  2FTO X;  2TDD A;  4XSE A;  1TSZ A;  4TMS A;  1TRG A;  1B5E A;  1BO8 A;  1TDA A;  2ONB A;  1BQ1 A;  3KJS A;  1EV5 A;  1TDC A;  1YPV A;  4XSD A;  4ECK A;  3UM8 A;  1SYN A;  4Q0E A;  1VZE A;  3UWL B;  3INV A;  3BHL A;  4KPW A;  3EAW X;  3EDW X;  4ISK A;  3QGT A;  1BJG A;  1TSL A;  2FTN A;  3N5G A;  1CI7 A;  3BGX A;  4ISW A;  3K2H A;  1TSD A;  4F2V A;  1TSN A;  4E28 A;  1I00 A;  1TYS A;  3N5E B;  4H0U A;  1TVU A;  1F4G A;  4JEF A;  4IRR A;  4FOX A;  1BDU A;  1J3J C;  5WRN A;  4DQ1 A;  1ZPR A;  1NJC A;  1JTQ A;  2FTQ A;  1EVF A;  3CLB A;  3I3R A;  1B02 A;  1FFL A;  1F4F A;  3IJZ A;  1KZI A;  1JMH A;  4O1X D;  1EVG A;  2AAZ A;  1KZJ A;  2RD8 B;  5H3A A;  1AN5 A;  1VZB A;  1TSM A;  3IK0 A;  2OIP A;  1JG0 A;  2G86 A;  1BPJ A;  1NJD A;  3NRR A;  5HS3 A;  4G6W X;  1TSY A;  1LCA A;  2TSC A;  1BP6 A;  1QQQ A;  1JMG A;  4O1U A;  1F28 A;  1TDU A;  1JUT A;  3B5B A;  1TJS A;  3GH0 A;  4EZ8 A;  1BSF A;  4DP3 A;  2KCE A;  5FCT A;  1HW3 A;  1JU6 A;  3KGB A; 
#chains in the Genus database with same CATH homology
 3GG5 A;  1TDB A;  1KCE A;  1TSV A;  5H39 A;  1JMF A;  1NCE A;  5BY6 A;  1HVY A;  3UWL A;  4EB4 A;  3B9H A;  3H9K A;  1F4B A;  1SEJ A;  1TSX A;  1DNA A;  4FOG A;  1JUJ A;  5H38 A;  4KNZ A;  3DL5 A;  3EF9 A;  1HZW A;  3HB8 A;  2G8X A;  3IX6 A;  4GD7 A;  1NJA A;  1BQ2 A;  1QZF A;  3BZ0 A;  3N5E A;  3GH2 X;  4O1X A;  2G8D A;  3QG2 A;  3BYX A;  1J3I C;  1TLS A;  1AJM A;  1BID A;  3BHR A;  2VF0 A;  4IQB A;  1AOB A;  3HBB A;  1AIQ A;  1F4E A;  2VET A;  4EIL A;  3IRO A;  1RTS A;  1F4D A;  2TSR A;  3QJ7 A;  4Q0D A;  1DDU A;  1J3K C;  3ED7 A;  2G89 A;  3HJ3 A;  2G8A A;  3JSU A;  2H2Q A;  4IQQ A;  4PSG A;  3IRN A;  1HW4 A;  2BBQ A;  3EGY X;  1TLC A;  1B49 A;  1TVW A;  4GEV A;  3IHI A;  1LCB A;  4KYA A;  1EV8 A;  4O7U A;  1NJB A;  4FGT A;  1VZD A;  1VZA A;  3DGA C;  1JTU A;  1LCE A;  1BP0 A;  4EIN A;  3UM5 A;  4H0R A;  3EBU A;  3EHI X;  1NJE A;  1BSP A;  1FWM A;  3CL9 A;  3OB7 A;  4G2O X;  3DG8 C;  4GYH A;  4DPH A;  4XSC A;  1BO7 A;  3TMS A;  3UM6 A;  3V8H A;  1AXW A;  1TVV A;  3C0A A;  1BKP A;  1TIS A;  2A9W A;  3BFI A;  4LRR A;  4E5O A;  2RDA A;  5J7W A;  2RD8 A;  1VZC A;  3IK1 A;  1F4C A;  1THY A;  3IRM A;  3KJR A;  3C06 A;  4DPD A;  3EJL A;  1BKO A;  4KY4 A;  1B5D A;  4UP1 A;  3DL6 A;  3BNZ A;  4KY8 A;  4FQS A;  2TDM A;  4FOA A;  4H1I A;  1TSW A;  1JMI A;  2FTO X;  2TDD A;  4XSE A;  1TSZ A;  4TMS A;  1TRG A;  1B5E A;  1BO8 A;  1TDA A;  2ONB A;  1BQ1 A;  3KJS A;  1EV5 A;  1TDC A;  1YPV A;  4XSD A;  4ECK A;  3UM8 A;  1SYN A;  4Q0E A;  1VZE A;  3UWL B;  3INV A;  3BHL A;  4KPW A;  3EAW X;  3EDW X;  4ISK A;  3QGT A;  1BJG A;  1TSL A;  2FTN A;  3N5G A;  1CI7 A;  3BGX A;  4ISW A;  3K2H A;  1TSD A;  4F2V A;  1TSN A;  4E28 A;  1I00 A;  1TYS A;  3N5E B;  4H0U A;  1TVU A;  1F4G A;  4JEF A;  4IRR A;  4FOX A;  1BDU A;  1J3J C;  5WRN A;  4DQ1 A;  1ZPR A;  1NJC A;  1JTQ A;  2FTQ A;  1EVF A;  3CLB A;  3I3R A;  1B02 A;  1FFL A;  1F4F A;  3IJZ A;  1KZI A;  1JMH A;  4O1X D;  1EVG A;  2AAZ A;  1KZJ A;  2RD8 B;  5H3A A;  1AN5 A;  1VZB A;  1TSM A;  3IK0 A;  2OIP A;  1JG0 A;  2G86 A;  1BPJ A;  1NJD A;  3NRR A;  5HS3 A;  4G6W X;  1TSY A;  1LCA A;  2TSC A;  1BP6 A;  1QQQ A;  1JMG A;  4O1U A;  1F28 A;  1TDU A;  1JUT A;  3B5B A;  1TJS A;  3GH0 A;  4EZ8 A;  1BSF A;  4DP3 A;  2KCE A;  5FCT A;  1HW3 A;  1JU6 A;  3KGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...