1KCZA

Crystal structure of beta-methylaspartase from clostridium tetanomorphum. mg-complex.
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
413
structure length
412
Chain Sequence
b'MKIVDVLCTPGLTGFYFDDQRAIKKGAGHDGFTYTGSTVTEGFTQVRQKGESISVLLVLEDGQVAHGDCAAVQYSGAGGRDPLFLAKDFIPVIEKEIAPKLIGREITNFKPMAEEFDKMTVNGNRLHTAIRYGITQAILDAVAKTRKVTMAEVIRDEYNPGAEINAVPVFAQSGDDRYDNVDKMIIKEADVLPHALINNVEEKLGLKGEKLLEYVKWLRDRIIKLRVREDYAPIFHIDVYGTIGAAFDVDIKAMADYIQTLAEAAKPFHLRIEGPMDVEDRQKQMEAMRDLRAELDGRGVDAELVADEWCNTVEDVKFFTDNKAGHMVQIKTPDLGGVNNIADAIMYCKANGMGAYCGGTNETNRSAEVTTNIGMACGARQVLAKPGMGVDEGMMIVKNEMNRVLALVGRRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-methylaspartase
publication title The structure of 3-methylaspartase from Clostridium tetanomorphum functions via the common enolase chemical step.
pubmed doi rcsb
source organism Clostridium tetanomorphum
molecule tags Lyase
total genus 158
structure length 412
sequence length 413
chains with identical sequence B
ec nomenclature ec 4.3.1.2: Methylaspartate ammonia-lyase.
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05034 MAAL_N Methylaspartate ammonia-lyase N-terminus
A PF07476 MAAL_C Methylaspartate ammonia-lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1kczA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1kczA01
1MNSA 3SSZA 3D46A 3ZVHB 3SQSA 3CAWA 1XPYA 1R0MA 2GSHA 3P93A 3Q4DA 2OZ8A 4GYPC 2PTZA 4HCHA 3TJIA 4HNCA 1ONEA 3DG6A 3VC6A 3FYYA 3TJ4A 3CYJA 4IL0A 2QGYA 3DG7A 2ONEA 2XH2A 3DDMA 4HPNA 3SN1A 2P88A 3VCNA 1NELA 1OEPA 4MKSA 2OG9A 1BQGA 4A6GA 3Q45A 4ROPA 3STPA 2PP0A 4DN1A 3FCPA 3CXOA 2OKTA 3UCDA 2PTWA 4HCLA 4EWJA 3UJRA 2PU0A 2PSNA 5EU9A 4G8TA 3N4FA 3TQPA 4DYEA 3T9PA 3TCSA 2MNRA 5FJUA 1KKRA 3MKCA 2FYMA 3H12A 3R11A 2GGJA 4K8GA 3DFYA 2PCEA 2PP3A 4HCDA 3TW9A 2QVHA 4GISA 1EC9A 5J04A 1KKOA 3V4BA 2DW7A 3FJ4A 2QJNA 2MUCA 3NFUA 1PDZA 1DTNA 4F4RA 4HN8A 2PS2A 4X2PA 3QLDA 7ENLA 3RR1A 2OX4A 1W6TA 2GGHA 4J3ZA 1WUFA 5FJPA 4YWSA 3UJEA 4FI4A 2PP1A 4KEMA 3GO2A 2GGGA 1PDYA 2OPJA 3T8QA 3CK5A 1EBHA 3RCYA 2QDEA 3NZGA 1IYXA 4J1OA 4ZCWA 3H8AA 4MMWA 3TWBA 3OW1A 3DIPA 1JPMA 3S47A 4A3RA 1MDRA 4HYRA 3V3WA 1KD0A 3EEZA 5FJTA 4IP4A 4KWSA 3CB3A 3U9IA 3KUMA 3OZMA 3FXGA 2XH4A 3MSYA 2PGWA 3UJ2A 2HXUA 1MRAA 1P48A 1EBGA 4JN8A 5FJRA 2OQYA 1RVKA 3IK4A 3TWAA 4E5TA 3DERA 1EC8A 3SN4A 3UJFA 4GGBA 3R25A 1R6WA 3QKEA 4DWDA 2GDQA 1ELSA 1KCZA 1TKKA 2XH0A 3CT2A 1BKHA 2PPGA 3MY9A 4H2HA 3MUCA 2GL5A 2PGEA 3GD6A 4IT1A 3FV9A 4HNLA 4E4UA 3QTPA 3I4KA 3JZUA 4E4FA 2QDDA 3UCCA 2OZTA 4GFIA 3PWGA 3I6TA 3GC2A 3NXLA 3T4WA 2HZGA 2ZC8A 4ZA0A 4FP1A 4ENLA 3DESA 3MZNA 3R0KA 3QN3A 2OZ3A 2FKPA 3I6EA 2OLAA 3V5CA 3BSMA 4GIRA 2PTXA 2AKZA 3SJNA 3D47A 4DX3A 3SBFA 1P43A 2XSXA 3DEQA 4KPLA 2OFJA 2POZA 2PA6A 3JW7A 2O56A 1TE6A 3RO6A 3IJIA 2AL2A 4M0XA 3TOYA 3S5SA 3N6JA 3HPFA 4IHCA 1L8PA 1TZZA 4IP5A 3DGBA 3ZLFA 4MGGA 1SJCA 4K2SA 4M6UA 3BOXA 2RDXA 2HXTA 2QQ6A 3RITA 3T6CA 2P8BA 4IZGA 1FHVA 3RRAA 1JDFA 1SJAA 2GGIA 4A35A 4GMEA 3VFCA 3R0UA 2P0IA 4Z1YA 3VCCA 3B97A 2PTYA 3GY1A 3UGVA 4GYPA 2PODA 3THUA 3MWCA 3VDGA 3R1ZA 3IJLA 3H70A 4DHGA 2DW6A 2QJJA 3H7VA 3N6HA 3OZYA 3ZVHA 3R10A 6ENLA 4KT2A 1JPDX 3VA8A 3DFHA 3DG3A 3ENLA 2AL1A 3UXKA 3JVAA 3TTEA 1EC7A 4H19A 3VC5A 4E8GA 3QPEA 3UJSA 2PU1A 3ZLGA 1JCTA 2XH7A 3PK7A 5ENLA 2P8CA 2OQHA 4E6MA 3P0WA 1WUEA 2XGZA 2I5QA 4H1ZA 4H83A 1MDLA 2CHRA 3FVDA 5BOEA 2QJMA 2ZADA 3UXLA 4DXKA 2OVLA 3K1GA 3N4EA 1ECQA 2AL2B 4G7FA 4IL2A 2PMQA 1SJDA 3V5FA 2OO6A 1SJBA 5FJOA 5IDZA 3ZLHA 3ZVIA 4JHMA 3MQTA 2GGEA 1NU5A 2AKMA 3PFRA 4GGHA 3OPSA 2P3ZA 3OP2A 3U4FA 3RGTA 3BJSA 3PWIA 3EKGA 1F9CA 4JN7A 4Z17A 3OTRA 3SN0A 3IJQA 2NQLA 1XS2A 2HNEA 3ES8A 1MUCA 1YEYA 3P3BA 3ES7A 3NO1A 1E9IA 4K1WA 1FHUA 5BOFA
chains in the Genus database with same CATH superfamily
3HZ3A 5D8WA 3VE7A 4C6JA 1V51A 3UZXA 3KOWA 4O17A 3K8LA 4B5XA 2D2JA 3P93A 3EKLA 4GJJA 2ZTJA 2OZ8A 4DXVA 4PUEA 1DXLA 3BSGA 2CFYA 5FEZA 1HKMA 4JIIX 1MFVA 3WMLA 4UTJA 3WY1A 3MUXA 3O6DA 2AGTA 3QZEA 2GQ3A 1TQXA 1VB9A 3IAPA 1I75A 3AYRA 4K3ZA 5BXPA 4IXXA 3KX6A 1FFQA 3CPRA 4WGXA 2P88A 1AODA 3OQEA 2A2IA 3ARZA 3PS7A 3VCNA 1ISWA 2G4JA 4NG3A 1KN0A 1ZXIC 1Q6LA 3L4TA 2V5BA 1V0NA 3WK2A 1PYMA 3THQA 2D2GA 4EWJA 3VILA 1K4GA 2PU0A 2DZSA 1YDOA 4ZSTA 3WDJA 3C8NA 1FRBA 4UZUA 2ZZ0A 4G9PA 4DBSA 4WDTA 1PJ9A 2DSUA 4Q6JA 2HQMA 1G7UA 3VDCA 2INEA 2WWDA 2QVHA 1HVXA 1M7PA 4N0RA 1CB7B 4DYKA 2FH6A 1IR1A 4MNLA 3VNLA 5D2XA 4PRRA 1CGUA 5B7YA 4KESA 1KTBA 1RJPA 4PUWA 1JEZA 3S5NA 1JG9A 1BYAA 1PDYA 2PGRA 4JYDA 4GUFA 4BEUA 1S1RA 2P53A 1HJXA 3M47A 3KLLA 4ICNA 3W7MA 3KLJA 3LZ3A 1JPMA 2H9AB 4DF0A 1KM6A 2YDRA 3DHPA 2A3HA 4HYRA 2VZTA 4XKYA 1G4PA 3O9NA 1B1YA 3AIQA 2VWTA 4Y9MA 1T5AA 2OB3A 1LZOA 3OZMA 1WBHA 1NDVA 4LVAA 1X8CA 4GC4A 2VGGA 1KCXA 2C79A 2DFAA 1P48A 3RR4A 1GSNA 2Z4GA 1KB3A 2OQYA 2Z0IA 4F8XA 1UMYA 1ONWA 3NPWA 1A5SA 4IGSA 4CQBA 2PDUA 4XBSA 3MP5A 4UIOA 1DL3A 2OYKA 3WD1A 3SM0A 1VQZA 4GGBA 1YTDA 4OTKA 4GYFA 3UWEA 4NQ1A 3WFLA 3IVTA 3CT2A 1WDSA 4W5UA 1NPXA 1OFAA 3HGRA 2C1GA 2G97A 3N17A 3WLMA 3PZVA 3WEOA 1A5MC 4A22A 1XIEA 5FAGA 4HA4A 4L80A 1JR1A 3WD0A 4JTCA 4AXKA 1YNPA 1XFBA 1TO3A 3UCCA 2GVJA 1DXIA 4FLSA 4TTUA 3NXLA 5CPOA 2E6FA 2FGZA 2Y6ZA 1OABA 2PWHA 3LCFA 4ORMA 1F8IA 1XLMA 3FA3A 4HD5A 2Y2WA 3NS1B 1C8VA 4Z1CA 3AZTA 1VENA 5MKGA 1UD8A 1N61C 1RK6A 4YS1A 1RUSA 2DZAA 3WUEA 1Q7MA 3M7WA 3D47A 3LBCA 2PDFA 4UBPC 3VIGA 1DP0A 2UZ9A 4IQDA 1ZJHA 2NX1A 4DELA 4LU0A 1ME9A 3E2SA 5CGMA 1UH2A 3ERPA 3IUDA 1ZAIA 2W62A 2X8HA 2R1MA 1OFRA 3EOSA 1EJTC 1OC5A 4IM4A 1ZBVA 3UBPC 3HGOA 4DB7A 3U7BA 2A3LA 1SR0A 1KRBC 3WNOA 3BLKA 3S9YA 3RITA 3VGBA 1JQXA 1TWDA 4FLOA 5D09A 3V18A 4GABA 4IICA 5B80A 1M03A 2J7FA 4A35A 2ZUNA 1XLCA 3VFCA 1UUMA 1V59A 5FSEC 3MUIA 2QUTA 5FMHA 4H2CA 3QGVA 5CPSA 3NNTA 4XAZA 4MG4A 1L6SA 3IJLA 1OFOA 3U57A 3W9ZA 1Q6FA 1SGJA 1C92A 1YDNA 2I57A 1E70M 1QWGA 3ALGA 3UXKA 3ZXWA 1VPXA 5C70A 2WV8A 3ARUA 2VZUA 3IIVA 4K7YA 3AMGA 2OEKA 4E8CA 5FF7A 4GQQA 2PZNA 1OGGA 5T91A 3M6YA 1ODUA 3B8VA 4O14A 4XISA 5LXXA 1GEHA 3Q37A 1U2YA 2G3JA 7CGTA 6A3HA 4LWWA 1US3A 1G5AA 4NYYA 2ZA1A 2QF8A 1DOSA 3M0LA 1J18A 1CCWB 2VEMA 3F7JA 2FHFA 3OGVA 3M5VA 4KWVA 2BY3A 4QCEA 4M5PA 3V5FA 3PBUA 3ZLHA 3CL8A 3H4KA 1RBOB 1LYXA 1JCMP 4RW5A 2EHHA 4J3XA 1J93A 1TCDA 4LEQA 1X39A 4B5SA 1VFHA 1YKWA 2XFRA 1W5QA 2PFHA 3K5XA 1S5WA 2BOFX 4HZMA 1TE1A 4JL1A 2OLSA 4X60A 2HNEA 1QI2A 3EF6A 4UFIA 1RLDA 2YL5A 1UASA 1KA9F 4C6DA 4YU1A 3EB2A 4AWUA 2OEJA 2NQZA 2HE5A 2FZ8A 3WLTA 3LQGA 2WC4A 3S46A 1GG0A 3KOZA 4WVXA 3NVZB 3MHGA 2VEIA 1XUZA 4JTIA 4K39A 1YNQA 3TR9A 1G7VA 1KQZA 3WJXA 1V3KA 4ZOBA 1R8LA 2O7SA 2VR2A 5DF0A 3TJIA 3CWNA 1LRTA 1DVJA 3CH9A 1BVWA 1HP5A 3ARPA 4JHOA 3RX3A 1DKWA 5C7VA 1O5KA 4IMGA 3QXBA 3QV9A 3ZYZA 1Y7VA 2PUZA 3MI3A 4F0MA 3T07A 3MYOA 4FXRA 3PAJA 1MEWA 4H9YA 1VBUA 3EEGA 3SR6B 3DGRA 1CX9A 3WMBA 4C5ZA 3FA4A 3V0UA 3ARVA 1RY8A 2YIHA 3EPOA 4NX0A 5DN1A 4H6RA 1SMDA 1XICA 3GFZA 3KDNA 3TH6A 3LK6A 1XRVA 5A6BA 2BY2A 3NL6A 4KS0A 1FWSA 3CGDA 5CZ0A 3GVGA 5GVJA 1E56A 1YW1A 4IP7A 3WCZA 1HL8A 1XXXA 5ABEA 4EPKA 1IZJA 4OU1A 1CLVA 4ZMGA 3K30A 4L9YA 4OOZA 5AHLA 5HMSA 2ESCA 4XZBA 2FGLA 3W27A 3MSRA 4JKKA 3W2KA 4B3KA 1EC9A 1E0TA 1K8CA 2WSYA 1K6WA 2MUCA 3VX1A 3OJGA 2WJZA 1ZCCA 3V7PA 4WLCA 4WOZA 2OX4A 3T1GA 3OC4A 2CFFA 4HTBA 2ZC1A 3GKAA 1VGAA 4LUSB 2ZVRA 1ECEA 3GX9A 2VFEA 2ZWZA 7ODCA 3KVJA 5E0FA 5AC4A 1S3HA 4KFPA 4Y6GA 2BGNE 1M41A 3WFZA 1LQAA 3EWZA 3FG2P 1BWLA 2Z1VA 5F2IA 3BQ6A 1P7TA 1BG9A 6CGTA 1L6WA 2QVNA 4L7ZA 4ZB2A 3MVIA 1R38A 2NW0A 2YVGA 1BWCA 4PUDA 2VOTA 2R24A 1NP0A 3NVTA 1OX6A 3ABZA 3CHDA 3CHCA 1MUWA 1EBGA 2EO7A 4RDYA 3UR2A 4D8AA 3KZPA 2FB3A 3G3MA 3OIXA 3NEHA 4Z2JA 5FAJA 1A3HA 3C56A 1V0KA 3LXBA 5A8PA 1BKHA 4NNAA 1EHAA 3JRKA 3ITLA 2VVSA 1JZ7A 5CBIA 4GI4A 4H9VA 3B9OA 5F2LA 2PDIA 3HPXA 3UGRA 3KZSA 5E0KA 4I7UA 4IMDA 2FMOA 4L61A 2PDJA 3L4WA 2PDLA 4BI5A 1E3ZA 1M04A 1LRQA 5LIUX 1M01A 4GIAA 2PLCA 3MSGA 4F2UA 1EKOA 2CLOA 3ARXA 4F66A 4P5UA 5A6AA 3UPBA 4PBFA 4RNIA 3MCOA 4IGMA 3BH4A 3RNMA 3AWOA 4XO7A 1KWKA 3ANVA 3HG5A 4S3JA 4C5YA 5C5YA 3GU2A 2POZA 4ERGA 1BKSA 3AYSA 1K7EA 1V77A 2I9EA 4LS1A 1SFSA 4KH2A 3TC7A 3BICA 5G4EA 4Q4RA 2D2HA 2WO5A 2HDJA 1EGVA 3I3BA 1SJCA 4H4RA 2V3BA 2HXTA 1HVQA 1JVNA 1W9PA 3KS5A 4AD4A 3IRSA 2D24A 4H8VA 3SJ3A 3TNBA 3VINA 3S1GA 4DJFC 3QSTA 4QM1A 1JDFA 3BVJA 2WLZA 1QT1A 4XSMA 3QOMA 2CHOA 5EL1A 2E8YA 2OMAA 1JCLA 5CC3A 3F03K 1NDYA 4AB4A 4EQSA 5AN7A 3LCIA 4O1CA 4DO6A 4M7TA 4A8NA 3BWWA 2QJJA 4GUGA 1H7NA 3AHVA 1B4KA 4R53A 1VF8A 2A0NA 2A21A 2V63A 2A3AA 3RJYA 1RM6B 2BGSA 3W37A 4JYFA 3P6LA 3ENLA 1E6NA 3UYCA 2F8QA 4PCNA 3ZO9A 4O1EA 4TIMA 1XDJA 3TUUA 4FNTA 2AAMA 3GZAA 4U2YA 2R1LA 1LQ2A 4KETA 5I3IA 1AL7A 2WW5A 3UP8A 2ZZ6A 5U1OA 3PZGA 2J9XA 1VR6A 3VNJA 1E1CA 4Q32A 3B04A 1MNZA 4N9CA 5EFFA 1TZ9A 1JPKA 3HG3A 3MUZ1 3W3OA 3AXKA 2NVAA 1SR9A 4JZ5A 3MI2A 1WE5A 3URBA 1KXTA 4J28A 2E9LA 3OPSA 2EQ7A 1XUUA 4LAZA 3SCRA 1XYCA 2GK1A 5A3HA 1XHGA 2Z29A 2GPTA 3PWIA 3FNDA 1CI1A 2X42A 1TWWA 3KBJA 2E9MA 4GR1A 1XRFA 1TB3A 3E49A 4B92A 5AZ0A 5JCMA 3CUGA 2BOEX 1PIIA 4M81A 2FPYA 1MUCA 2NZLA 1WZMA 1Z9AA 4IISA 3TZNA 3VD9A 1KGWA 3AM9A 3NO1A 3EWBX 5H91A 4HA1A 5H1WA 3SSZA 1UD2A 4BA0A 1NTHA 2RH9A 2X30A 2O9TA 2CYGA 3STEA 2Z6IA 1FHLA 1M6IA 1OX4A 2ZOXA 3OHMB 1XLEA 2OYMA 3KRBA 2OO0A 2PF8A 1AW2A 3ARTA 5E5CA 2YCLA 4M51A 1FWEC 4DO5A 1SM9A 3QHNA 3FX4A 1HJQA 3MV11 4U10A 4B91A 1W2PA 2EG6A 2W4XA 4LV4A 3S2JA 5CBBA 2BFGA 2OYLA 3M5ZA 4P8WA 1UR8A 2G3MA 1W8GA 1UIPA 3C6CA 3PG6A 4UR8A 3OG3A 2TPSA 4HYWA 4FO4A 4CNNA 5TF0A 1H62A 3RNDA 1UR1A 1V3LA 3AIRA 2OKTA 3IJ7A 2D1ZA 3SCSA 3MS8A 2PF0A 1QW8A 1W9DM 1I0BA 2Z00A 4LC6A 1JCNA 2VGIA 2IUZA 2R14A 4PYSA 4RUBA 3MKVA 4HZ6A 3P81A 1OCNA 4C6IA 1KKRA 1V93A 2BCPA 3A7UA 3R11A 2DUXA 1FEAA 1V0MA 3LV5A 2EBNA 3GU9A 3LUTA 1XLJA 3W7CA 3TW9A 1RV8A 1ZQ5A 3B9DA 1J0IA 4RPQA 3R94A 1S2TA 2CPUA 3FJ4A 4UQEA 5CCZA 4MFDA 3NFUA 4PTVA 5F1VA 2O55A 1UWTA 1GRFA 1BG4A 1H1ZA 1UKTA 1NQKA 3LCHA 3T81A 4HU0A 1GOOA 1VCFA 3SFKA 2QUVA 1EYEA 2Y7GA 3CIVA 4WEVX 4LUIA 3UF9A 1N63C 4I6KA 3W1TA 2GGGA 4CNOA 1DTUA 3HF3A 1JYVA 1W8SA 1EP3A 4FPSA 1E4MM 3AHXA 1F3XA 3NDZA 3O7UA 3KOYA 3LPFA 4R88A 1N7KA 3OVPA 3SQLA 4PRWA 2IPFA 5AVNA 3E74A 2VEPA 4NILA 1XH0A 4C6CA 2WYSA 3SW6A 5AFDA 1XQLA 2YVJA 2E5DA 4W93A 4ZENA 1IEQA 3BAIA 3SQPA 3RMJA 1RVGA 2PC8A 3B8WA 3QW4B 4B90A 1VLWA 3W7JA 2W54A 4U31A 3SN4A 4J3WA 1AOGA 2X1TA 1O68A 1PEZA 2FJUB 3NR0A 2ASHA 2QGHA 4YVVA 1IEVA 3FS2A 3P8JA 2QCDA 1QASA 5GPRA 1FCVA 1WB0A 4IG2B 1OM0A 5CZTA 1WDWA 3WYZA 2BODX 3E6EA 1ME7A 3W53A 3GM8A 4JX6A 2Y0FA 3GRSA 4G1KA 1W31A 4AZHA 5A2CA 1XIIA 2XU2A 1TPUA 3G5EA 4JFTA 2P50A 1TCMA 1LG2A 1I2RA 4AD2A 3MUY1 4H8HA 1SSGA 2FFIA 2XIBA 3POHA 1EZ2A 3AFBA 3BZJA 3L21A 1BPLB 4MDOA 2GJPA 3T0BA 2EF9A 4HPHA 1UP2A 3KXQA 3LHVA 4NAFB 1VJSA 1Z6KA 3NM3A 3W1NA 1Q6QA 4OGZA 3GK0A 1Q2RA 3CAVA 1FH7A 1GOKA 4JDBA 1VFMA 3DX5A 1SU5A 2O56A 1K6AA 4KCWA 1FH9A 1WDRA 4FF5A 1ICSA 4OUEA 3H4XA 2J3NA 3EWXA 3W7PA 3HPFA 3PVFA 3HTWA 3LGEA 2RDUA 3WNMA 4WRHA 4X0VA 3PG9A 4DZIA 4P7OA 3VKAA 1TMLA 3PUOA 2WANA 5CPTA 3B05A 1SVDA 2J13A 2QQ6A 4H8UA 4JY9A 4NU7A 4X3ZA 1UIOA 1QTWA 1LTDA 2YB4A 1CPUA 1F2JA 4UNLA 1XCFA 1SZGA 5JVLA 3QR1A 1O6IA 3NURA 4QRNA 4U5KA 4DO7A 1EZWA 4F0KA 4YHEA 1W56A 1TWIA 4GYJA 3BCJA 5TQLA 1A0EA 4CQ9A 3LRLA 4AC7C 1HXJA 1NWTA 4MUZA 3VIHA 4LF1A 3HPAA 4KERA 1K02A 1KFCA 1V0LA 4HSNA 2C1IA 2ISWA 5G1YA 3VFLA 3G77A 3E0IA 3VNMA 3E3HA 3QPZA 3RDKA 3QFAA 1AVAA 4LVFA 9RUBA 3CUZA 2WOVA 1SFLA 3A4XA 3USZA 4WKAA 3TTEA 1Q6RA 1UBPC 5HMEA 5HDRA 2WVTA 5G2HA 3AICA 4XV0A 2G3IA 3WBAA 1RJQA 3OYXA 3P0WA 4IUGA 4JKMA 4WD0A 1FXPA 2CBJA 4RDVA 2QAEA 1XX1A 5HWMA 5H8PA 3A9IA 4O28A 3VD3A 1D7FA 3NQAA 4YVXA 1FWAC 1TTJA 2E8ZA 2PDWA 2ATMA 5JQ9A 3MMUA 4LOCA 4QG9A 3II1A 4D6EA 1VRDA 1JJKA 1YE4A 2WMIB 2E6DA 2J66A 3QYSA 9XIMA 2IQDA 2OCZA 3QY7A 1DJHA 1STZA 4JHMA 2GGEA 2AKMA 2GZXA 3G6MA 4GQ0A 5BXSA 3RGTA 2C1HA 5ABTA 4D9PA 3LQLA 1AG1O 4KWOA 5DQPA 4CD7A 2BTMA 4IPPA 3CHFA 2QCGA 1X97A 3IJQA 4N9BA 2P10A 3ZR5A 4ZXOA 2RFGA 2Q8LA 5IRPA 4HNUA 1ZBKA 5BZAA 2YCJA 1J0JA 2FTWA 3T7VA 3P5ZA 4HK7A 4YTSA 4XZLX 3VGDA 3VIJA 1KXQA 2X1SA 1X98A 3EDKA 4AZ7A 1DWAM 4C1KA 1Q1RA 1P6CA 2XGBA 1GRHA 2YCIX 1ME8A 5HPCA 2YZ5A 1GJWA 3NQDA 1OK4A 3ELFA 4PMJA 2A85A 3SY8A 5D37A 2AOSA 3LNPA 5FS9A 5CC7A 3PB0A 3W84A 3NUKA 1REQA 3DG7A 1EDTA 3BMVA 1CXFA 1OFDA 5F2MA 4DO4A 3EUB3 3PR2A 3EA3A 1PVNA 3NQGA 2YCKX 4BCEA 4UFLA 1S3TC 2WZEA 2PDNA 1M1BA 3MYPA 1FWNA 2CBIA 4DYJA 4F2BA 4WJXA 1JDEA 3BCDA 5I24A 4HCLA 1Q45A 1QNSA 2DVUA 4U33A 1TJ2A 1FWTA 1EQCA 2JKAA 1XI3A 3VZXA 4WZHA 1H3GA 3T9PA 2MNRA 1LUCA 4R34A 1NHRA 4CU6A 1R7AA 1SB3B 2VFFA 1OGSA 4GISA 1HG3A 2UY4A 4ZODA 4EANA 4A3QA 1XLAA 4X63A 4XD4A 3BW2A 1Y5VA 5CG0A 4KCVA 1KBKA 1JCYA 1SW7A 2BGQA 2NXHA 4HN8A 1NHQA 5GRTA 3RMEA 3SB0A 4NY2A 4HOZA 4MVAA 3HN3A 1IZKA 2V3AA 3WK3A 3GDBA 3NYDA 1AK5A 5F4WA 1XYZA 3CK5A 1RAKA 4GVIA 2FVKA 4HMEA 4BK9A 4BKNA 2PWFA 3S47A 1UC5A 5AOUA 4EF8A 4M80A 3AWNA 3UVAA 2J9ZA 3EEZA 1GKPA 2VDHA 2W66A 2INFA 3ZJ8A 1U83A 3USBA 2BVDA 3TYZA 1AL8A 3BG3A 5FJRA 3B3DA 3BLOA 3RN6A 1FIQB 4NSBA 3NEVA 4P61A 4ACZB 1UOZA 4JIRA 4FHAA 1E51A 1HO1A 1MYRA 1EXPA 3DKJA 3A7RA 3HQ1A 3M0KA 3A24A 4A21A 1VJZA 1X1NA 1G6CA 4D1JA 4PL2A 1GT8A 3LN3A 5K3VA 2WZMA 4YNGA 3HMJG 4ASTA 4JX4A 4NXKA 3NZQA 3FK4A 3EOUA 5TIMA 2FQIA 4ADUA 4HNLA 3H53A 3QTPA 3PBWA 1G4SA 3JZUA 3K4DA 3SCTA 3CV6A 1J11A 4GI6A 4L65A 2CCRA 4EKJA 5AHNA 2HZGA 1UA3A 3NVYB 3EXTA 4J2MA 1PYFA 1IGWA 2E0PA 5HPOA 1LBFA 2HJPA 1R47A 3TN6A 1JDAA 3MZNA 3AUJA 3NZ1A 4GVGA 3NQEA 1UR3M 3W0KA 1FWIC 4XWUA 1XDIA 4GINA 1YPIA 4UOQA 4FALA 2OFJA 3UZJA 3B4YA 4ZQMA 3FHQA 4P8XA 3WLPA 5FD0A 2YFNA 5JBEA 3N3TA 4DI8A 3E0VA 2VJXA 1W3IA 3GG8A 1ZENA 2ZXAA 3AIWA 5CXPA 3VIMA 3ZLFA 4NI8A 1ZJAA 2BP1A 3ZWTA 3KOXA 4R9XA 1V6XA 1Z32X 2Z2AA 3LGDA 4E8DA 1VPQA 1C29A 4MPKA 3NXFA 3DFQA 1GGOA 3GTIA 1FDYA 3WENA 5FEWA 1RD6A 2NX3A 6TIMA 2J7DA 2WKLA 3O16A 4Z1YA 3VCCA 3S3GA 1JI1A 3W22A 3GVQA 3U2ZA 1XLDA 4RE4A 5FEPA 4ZGYA 1LLWA 3G1FA 3BGJA 1L2QA 3VDGA 3BO9A 4YVPA 4QLKA 5DT5A 1BHGA 1UG6A 4H41A 3ZVHA 4HK5A 4LVGA 5E93A 1QUMA 2EQ8A 1B3XA 3NYZA 4YPJA 4OBTA 4Z1DA 4TVCA 4RR4A 2AMGA 4DEFA 1EGZA 3VNKA 4H9MA 1ZMCA 1TPEA 4X22A 1WKYA 3TDFA 2XGZA 5C0QA 4GI8A 3LTPA 1W54A 1J10A 4J40A 1F3WA 2QIIA 1EP2A 2QJMA 3HB9A 1YBQB 4K7VA 1F6KA 1M68A 5GJPA 5BW6A 3NL5A 3UT0A 5HUPA 3JZEA 1JZ6A 1CXIA 2XDFA 1OYBA 1TR1A 2DVXA 1GREA 2OO6A 3KVLA 4TO8A 3OVRA 3WF3A 1R85A 1CXLA 4R3UA 4RKAA 2WPGA 1HZYA 2ATSA 5G1TA 2ZKMX 3GR8A 4XZWA 3CZ8A 1LWIA 3FN9A 4TU1A 4XD6A 2CZEA 3ABQA 3V16A 5HANA 2P76A 5KEZA 4D6CA 2QUMA 3NGFA 1FWBC 3EBVA 2GOUA 2FVMA 3ABSA 4H4VA 4N9EA 4B3ZA 4C1NA 2WVSA 1XYMA 1E71M 2PLJA 3W25A 3SR7A 3TKFA 4HNVA 1UCWA 4LBSA 1MEHA 1KLZA 2PC4A 4JTRA 1QPQA 2XZ9A 4JIQA 3SRDA 3QFBA 1N82A 3DZ1A 2WOWA 5AYIA 3W28A 4GKTA 3GH4A 3MCNA 2GQ8A 3E02A 1SW3A 1W3JA 5HQLA 3SUUA 1V02A 2YBVA 3LHZA 4U3AA 3VGFA 1CGVA 5I7GA 3OBKA 2ABAA 1JZ4A 1NELA 1C7TA 4DJDA 3UZWA 3G1XA 4NVTA 5XIMA 4CQCA 1OBAA 4LVDA 4GJ1A 1BGGA 1TV5A 4NASA 1HKWA 1EL3A 2BXVA 2DY3A 4FA3A 3BQ5A 1J0KA 1SSDA 9XIAA 1O1ZA 3RIKA 2GFTA 3T09A 2ZX7A 4A3YA 3E12A 3UJRA 1GZJA 2BBFA 2QJHA 2GJRA 2WVVA 1KTCA 1N2VA 3TQPA 4DYEA 1VJIA 1PKLA 1WDPA 3LRMA 4IX2A 5BCAA 1ZLPA 3GZ3A 2PP3A 4CD8A 2VP8A 5AZ1A 2OT0A 5J04A 2P3EA 3OBAA 3GLCA 2DW7A 2ZE3A 5T9BG 1R3RA 1E6PA 4JDYA 4JL2A 2GGHA 3LLDA 1DXEA 5FJPA 3UA4A 3C0SA 1TR9A 2HSAA 1EBHA 4DNHA 4LUYA 1M7OA 3L23A 2IXUA 1V6VA 3RPMA 4H00A 1N55A 3TWBA 3EANA 3LTSA 3SCWA 2VO5A 3S9IA 1QW9A 1K9FA 4ZTYA 2H8XA 2YDSA 4GZIA 2IQ0A 2YB1A 3KBSA 3TN5A 4AQLA 2ZRWA 3H2EA 2Z26A 2YW4A 4CU7A 3APYA 3MT1A 5L6UA 2I17A 3PUDA 4GVFA 5D03A 4CN6A 4B5NA 3BW4A 3WQDA 1XL9A 2X2GA 4DWSA 1W1TA 4FK9A 4QNEA 1EPVA 4JICA 3TMQA 1XGDA 4YHGA 3N3MA 4I7VA 3GD3A 3B8SA 3VD7A 2WBAA 2VFHA 3RJXA 1E6ZA 2AQOA 1EGMA 2Y7FA 4A05A 2XYLA 3RX2A 3URQA 4APNA 2J9YA 1O7AA 2FIQA 4H2HA 3TYEA 2DDXA 1XKJA 3OLDA 3OIHA 3MZ2A 1MO0A 4PBGA 1JNEA 1W0MA 3WLLA 1UWIA 1TG7A 3ZIZA 4X9SA 2WJFA 3L4ZA 1THFD 4CCEA 1UKQA 1V7AA 2CZ5A 4HSHA 4W5ZA 4IIGA 5KZEA 2VCAA 1P6BA 3UZYA 4MFEA 3GW0A 2XM2A 2QF7A 3NQ8A 1VFUA 1G9HA 3QN3A 1ADSA 2Y8VA 3I6EA 4FX8A 3FDGA 1DWHM 3O0KA 1SMAA 3NQBA 4D1IA 4QP0A 1WO2A 1ZHAA 4XVDA 4DUXA 3HFTA 4ZQOA 1TPC1 2FLIA 3JW7A 1Z8AA 1PTAA 3E0LA 3DCPA 1UD6A 2Q3RA 3AISA 1A4LA 3H21A 3TOYA 2VKZG 3TN3A 5IBXA 1A53A 1L8PA 4LW7A 1EDGA 4NAFA 1RQHA 3DGBA 3M0JA 3M16A 4MGGA 3DFSA 1DV7A 2VD9A 4Z42C 4ZXLA 1E73M 3PBYA 2YR1A 3M1ZA 2F6XA 3OLEA 1W3TA 2OR2A 3AHTA 3DK9A 3IVUA 4W8BA 1XBYA 3T0AA 4U3CA 1VFLA 1QI3A 1QOQA 3A3HA 1SJAA 4PC8A 2WSRA 4EXAA 1QXLA 3KP1A 4PN2A 3AJ7A 1T0OA 5LIXX 2PTYA 1C90A 3F2CA 4M3PA 1QPOA 3CLMA 1B57A 3MVTA 4DJFD 3CMFA 2Y8KA 1WDDA 3DHFA 1E1EA 1VRXA 2NVCA 3KHJA 2R6OA 4FOJA 4DJDC 3W81A 4RZ6A 4R7JA 3LRKA 3QYQA 2NV2A 5E09A 3VA8A 3DFHA 1GESA 1GTEA 4GI9A 5LSMA 3OOQA 1R3VA 3QPEA 3GG1A 3G1RA 4UMAA 4UTKA 2NWRA 3W1UA 4E6MA 2V82A 1TJ1A 3BG5A 4NJJA 3EDFA 2HQAA 3PZTA 1EJVC 3CUXA 1PHWA 4PMVA 2ZADA 3PG8A 6XIAA 3CWOX 4JXCA 4NNCA 4INFA 4FOKA 3BXWA 2HEJA 2XIQA 4XZMX 4HMCA 4ERAA 1HL2A 4IL2A 3OO2A 3GS6A 2I56A 1HJVA 4FAMA 1WOBA 4EQWA 2DUAA 2Y70A 3MMTA 4C6LA 5ECUA 4KRUA 1E5JA 1FY6A 2OWXA 2WZIA 2E28A 4GGHA 4IPIA 4Q3MA 3GHRA 2GDVA 2YZRA 3IIXA 3PZNA 4JQ9A 2WHKA 4AD5A 2F9RA 1H63A 3S0CA 2Y1HA 4Z17A 2Y63A 3APGA 3M43A 1LVLA 3PY2A 4I8DA 4RNHA 5FF0A 3S2MA 3WNLA 4B9ZA 3U5YA 3SSJA 1TYGA 2CNCA 4O13A 2WMIA 1U5VA 3UZ5A 3CU2A 3P3BA 2GR2A 3R79A 3AMDA 4XZNX 1B9ZA 2TMDA 4DBEA 1CB2A 4KEUA 4NZFA 4G2DA 3WUGA 3AJXA 3EDJA 1FX6A 4UQCA 3SQSA 4H4WA 2GSHA 2A8XA 5BWAA 4PEEA 4OFCA 3APTA 1QRQA 4GYPC 4LTSA 4DJEA 1CYGA 4HP5A 1RH9A 2CXEA 4HCHA 4XD3A 1XLGA 4LB4A 2B4GA 4URIA 1ONEA 2GVYA 3EAUA 3UU0A 1GYNA 3WSUA 1AJZA 1OJXA 1RBLA 1SZRA 1GW9A 3S1WA 1FWHC 2OWWA 3WX7A 3ZWSA 2XSBA 1V3MA 1VD6A 1H5VA 2ONEA 2CLMA 5REQA 3GD4A 1SFTA 2GVLA 3KBNA 3BOFA 3NRZB 3R5EA 4AU0A 1TJRA 5FEXA 3KL0A 2V8ZA 3RCNA 3MANA 5IHSA 4GUHA 2QPXA 2W5FA 2CIPA 4ZL1A 3SY1A 3AALA 4JPGA 3PZMA 5DMLA 1CW2A 3BLLA 3UCDA 1FWWA 4UOZA 3YPIA 2V5JA 4FLRA 2CZDA 5EU9A 4G5DA 1ZB5A 1R87A 3WO8A 1GETA 1BWVA 1PWLA 4QXIA 3UXDA 2JF6A 1W5NA 4HU4A 5AHFA 2W27A 2DSVA 1PL9A 3TCEA 4EMIA 5F4XA 3QLLA 2VC7A 4BWLC 3VOJA 3FVMA 6REQB 1ITCA 1PKMA 1KKOA 3VX0A 4ZO6A 4L6HA 3MV01 3GH7A 1CWYA 1QO5A 2ZZ3A 1PDZA 1SZFA 8CGTA 7ENLA 3RR1A 3VM5A 1HGYA 7REQB 3Q6JA 4JQ3A 2CLIA 3M07A 4KEMA 4LT9A 3KBMA 4P7NA 1DJWA 3NZGA 1B3YA 4IWWA 2FZ9A 1BVZA 1CGXA 3OW1A 1WXJA 1B54A 4AIBA 2GDUA 3BV7A 4Q7BA 3KM8A 1MDRA 1Z7AA 2OWCA 3R8GA 1EF3A 1ZJIA 1PZ1A 3L2LA 1I60A 5I5RA 1A3WA 4YTRA 1A5BA 3PBVA 3L5MA 4ONVA 4IGHA 1W1PA 4WY0A 3UJ2A 4OVXA 1MRAA 4GBDA 4EACA 3DENA 3LV6A 1HJWA 1F3EA 3M7SA 3CZJA 5C9UA 4C6QA 1NEYA 3AI0A 2E3ZA 4PTWA 3URNA 3E2RA 4KPRA 4NEVA 4Z2IA 3N04A 3A3XA 4B5VA 4HVXA 1RP8A 3H2NA 3S1XA 4HA0A 2H3BA 2PPGA 2Y88A 1F4HA 2W6RA 1T40A 4JTSA 4JD4A 1FECA 2PGEA 4DF2A 4Q8PA 2W3ZA 5IFPA 2E7FA 1OT2A 2QIWA 1Q13A 3PC0A 4BV6A 1LJYA 2G8ZA 3NZPA 4PCTA 3EX1A 1JF6A 1LF1A 3N9KA 4E2OA 3W86A 5IHRA 1UD5A 3CH0A 5K4ZA 1PCKA 2WPFA 1NDAA 3IWPA 2DV0A 2X40A 3GDRA 3G0SA 1JFHA 4ENLA 1DJYA 2YL6A 4RL3A 1SFJA 3K1DA 4XKMA 1UD3A 3DU0A 1TV7A 2WOQA 1E4IA 1GV4A 4OBSA 3UVIA 1A0CA 1O60A 4O18A 3BAJA 1XLFA 5I3KA 1UWRA 1HO4A 3V1PA 1P43A 3LBMA 3C0JA 3DEQA 1TFVA 4Z0SA 1OHLA 5E70A 1FWRA 4RE3A 3W1PA 1WZKA 4QFUA 3H6OA 4IGNA 3HIJA 2GYIA 3G8RA 3HQOA 3EWYA 1JD7A 1V79A 3C2FA 1VFOA 1R2SA 3A7AA 3G22A 2Q02A 4XG1A 1TZZA 4N6EA 4N4QA 3F5LA 4LB3A 2DIJA 1YADA 4PH6A 4K7ZA 4GH3A 2Q6ZA 3MDUA 3WQCA 4B5TA 2GJXA 2QULA 1JXJA 1N8FA 2ZA3A 3GTXA 1LQ0A 4JNMA 1IZCA 1KV8A 1OYCA 4Z2LA 3C3UA 4G1NA 2Y5JA 2J27A 5DMYA 4OT7A 2E3TA 4WQ6A 4MLRA 1GJPA 4Q4OA 5BWFA 3H7VA 4UUIA 3LG3A 3OZYA 4F40A 3LHUA 3R10A 5F1UA 1AH3A 4PEKA 3G1DA 4JOMA 4UQAA 1QHPA 4HOWA 2Z2BA 1S5NA 4Q7NA 4O0QA 4XVEA 1ZP4A 4V28A 1KXVA 1TVLA 1F8MA 3BANA 1G1YA 5E9AA 2QCCA 5EBAA 5XIAA 4K6AA 4Y9PA 3VABA 3RM4A 4QLLA 1GG1A 3LCWA 3H26A 1B30A 1GORA 2I9UA 4PB4A 1C7SA 1AD4A 4PODA 3PTQA 2XWEA 1MDLA 2CHRA 3PJUA 3VOIA 1TVNA 1MUMA 4C65A 2L5HA 2BVWA 3EPMA 2AL2B 2PTDA 4C90A 2J7GA 1GOQA 1KRMA 1B3WA 3PTMA 4S23A 3KTCA 1I9CB 3HM7A 1T96A 1KQYA 4AZ6A 1K4QA 4S3GA 3VVGA 1GQJA 1O12A 2VX6A 2VT0A 1YBQA 5IDIA 3S5ZA 3W7IA 4Z08A 1M7XA 5KMYA 2V81A 3TA9A 1RBAA 4O52A 3HMCA 1OADA 1XLIA 1V4YA 1XBVA 3VDAA 3ES8A 3W2JA 1BXCA 5AHMA 3FY1A 4DAIA 2JALA 5DXYA 1IV8A 2J77A 1QATA 5JCIA 5FF4A 2ON3A 4TX6A 1JD9A 2W0UA 1J0YA 3W1AA 2WSQA 4NEWA 1KM3A 4ECLA 1VYSX 4KBXA 3LM3A 5LNUA 4IMFA 1GRBA 3L68A 3RLHA 1J2BA 1AQ0A 2RAGA 3WF2A 1O5RA 2BY1A 1X1OA 4HMDA 1IQ8A 3P74A 4M6QA 3UWVA 1MXGA 3UWWA 1S2VA 3FLUA 4ZZ9A 3CYJA 3FW6A 4IIDA 2VEKA 1NOWA 5A69A 3AO0A 3M41A 3GXIA 1SYTA 3T0DA 2KX9A 4AZCB 1F76A 4ROPA 3SRKA 3GDLA 1LT8A 4W84A 3LY0A 5T8GA 3TA6A 2OT1A 4D72A 1K9DA 2X05A 2CC0A 3CT7A 2F7FA 1TTPA 5IM51 2E77A 1MW3A 5HBFA 1WCGA 4Y9OA 1YE6A 5H6HA 1TZ7A 1HKJA 1DJQA 1MZRA 1NFPA 1B90A 2WSPA 1ONRA 1DIKA 1AQHA 1CGTA 2PS2A 1A5AA 5CSRA 5DRCA 5AHEA 3QQWA 4AF0A 3RM8A 1I8JA 4FB7A 4D6HA 4NP7A 1GRAA 4GACA 2WK2A 3PF3A 1EJXC 4L56A 1JDDA 3Q94A 4L1WA 4AWTA 2IPJA 3NQ2A 1LORA 3NPVA 3ZR4A 2HV5A 2JK2A 3EXSA 1KNWA 1TQJA 3T0CA 5F7UA 2HVOA 4YMZA 3SZ8A 4NF7A 5CGQA 2DT2A 2TPRA 5FIPA 1ISVA 2X8CA 4BURA 4W8LA 3IK4A 1W3LA 1TX2A 4EMJA 3H22A 3T2OA 1EC8A 3L4XA 4XQ6A 4NZJA 3NSXA 4CLMA 4N2YA 5A8OA 1KGXA 3L2IA 2MANA 1O94A 3G6LA 3H24A 3VKJA 1PS9A 3BAXA 3F5JA 1VIZA 1FFRA 3B8DA 3AMLA 3F4NA 3S2NA 3QQ0A 4AZBA 3O07A 2DT0A 1JZ5A 3QC3A 2XFWA 4OV9A 2NPXA 4WJEA 5KVIA 1TUFA 4H9TA 2QDDA 4H3DA 5CQ1A 4CEUC 1K3UA 2XVPA 3GC2A 4LIIA 5L9FA 4MWAB 4DVOA 1XIBA 1LBLA 4DF1A 4OWGA 3DESA 3B06A 5ABFB 3TQVA 1FWCC 1WXYA 4LS0A 3HOJA 2XSAA 5FL0A 1F07A 2CWNA 2J62A 4XO6A 2W79A 3VAVA 1UOKA 2FKPA 2E09A 2AAQA 2POTA 1RJRA 3DOPA 4GUJA 2YDAA 2YBUA 3EGJA 5HATA 3WF1A 1R3WA 1TTQA 1HT6A 3ITTA 3IUIA 1K9EA 3RO8A 3N2MA 3UXIA 1AA1B 2DP3A 2V3FA 2VGFA 4MWAC 2PA6A 2NUXA 3R8RA 4BF9A 3R07C 1M9HA 1HW6A 3VOCA 3QHOA 4M0XA 3SRHA 1GPWA 1V3IA 3TSDA 1S2AA 4UTTA 1KBJA 2E68A 4S3AA 3EWWA 4C1LA 1YX1A 1UZ4A 2O0TA 3XIMA 4CKQA 3BOXA 2TAAA 3GBDA 1P6WA 4PB3A 5FF3A 7A3HA 4ML4A 1X96A 3TLQA 3HFYA 5D9PA 3RRAA 4QSHA 1I1XA 4H01A 1WAUA 1XP3A 4JQAA 4PTMA 3ETRB 4AAJA 4WXZA 3GFXA 4HQVA 3CUFA 1FH8A 3DJGX 5LGZA 4C6KA 3GY1A 4PA8A 1JF5A 1Z89A 2HVNA 2EPNA 2PWUA 1IHIA 2I16A 2ISSA 4EM3A 4C60A 2EGZA 3SGZA 1EO7A 2WCAA 4DM1A 4DUWA 2R9ZA 3NQ7A 1T3QC 3T42A 5LHEA 4A8IA 3NQFA 3I3DA 1BXNA 3QPYA 5FKYA 4J9JA 3SQMA 2YFOA 1XANA 1MXDA 4FR1A 1JZ8A 4UTMA 2PU1A 4LXFA 2XZ7A 3B0UX 1VP5A 4EE9A 1A47A 4O19A 1NHSA 3DAQA 4XIAA 1J0ZA 3I65A 4GQRA 3TYAA 1Z42A 3MO7A 4H1ZA 5MF5A 4CNSA 3LM7A 3SGGA 5HJXA 3UXLA 4MDPA 4GY0A 2CETA 3UY7A 1DE5A 3VMOA 3O06A 3DHDA 5CPMA 1X6LA 1XIDA 2GLKA 3TYUA 2FVLA 1MO9A 3BLIA 4UMCA 3LPPA 3NJ3A 1TYPA 2WM1A 4GFSA 5FJOA 1EJSC 1MFUA 5T26A 1E0WA 1VFSA 3VO0A 1EUAA 4B9YA 3GNNA 5D9MA 1R3TA 1W2VA 2R9RA 3LZ5A 4R33A 1JDCA 1DQXA 4I6VA 4JCMA 4UQDA 3L0NA 4GZJA 1Q4NX 3SN0A 4ZQRA 4PBEA 1E5NA 4J2PA 2ABBA 4WKFA 4M7SA 3MMWA 4WUIA 4XBKA 2ACQA 1LCOA 1QO2A 4D71A 1E0UA 3KRUA 4HA3A 1CNVA 5AC5A 3SUSA 4AIUA 1TV8A 2VL4A 1E0VA 4FEZA 4MWAE 3L4UA 2RDTA 4BFAA 3A64A 2XVNA 3B4UA 2TYSA 3DUGA 1BLIA 2WJEA 1UD4A 1YXCA 1FTXA 4JTQA 1F7BA 1E6QM 4HJFA 3M0IA 1SQ7A 3VI2A 3TK7A 5G5IA 3GNOA 2XIJA 4US5D 5HXMA 3AMZA 3UEQA 4B5UA 2IKIA 3TJ4A 2QGYA 2C14A 4FX7A 4NAEB 2XG9A 4ADTA 3CL6A 5EA9A 2VC6A 3UZZA 4LYKA 3WQ8A 1DJIA 1ZDLA 1DJXA 1OCBA 4DNMA 4GWEA 3O1NA 3W7OA 4DZHA 1Q6CA 1Q6EA 4K38A 4KFOA 4QE5A 4MAZA 3K4AA 2O7QA 1EBDA 1PX4A 1Q5MA 2QDHA 6PTDA 1P0BA 1U30A 3CIWA 3A3WA 4ALDA 1J0HA 3LA4A 1A5NC 1RHCA 4JGDA 2FZNA 3TCSA 1AJ2A 1UR9A 2VRJA 4NIRA 3IPWA 3DFYA 3CO8A 4Z1BA 5U4NA 1OD0A 1HIZA 1WZLA 3EYPA 1UWSA 1BF2A 2A7RA 2JEQA 4JEQA 5HNRA 1EUNA 3AIUA 3QMTA 2REQA 2ACRA 4UNIA 1T8QA 3CM4A 2PWGA 1GQLA 1H7WA 1DTNA 4MJ4A 3WF4A 1MOKA 4LUTA 2PD5A 3GDTA 2VX5A 1AH0A 1XIJA 3GC4A 4FS9A 1UP3A 3UJEA 1DE6A 3IK2A 4FI4A 5E1QA 1WPCA 2YJQA 2OSWA 2VEGA 3EB3A 3OODA 4LAKA 3T0TA 6REQA 2PDYA 4TXEA 4Q8NA 1R3YA 3W2MA 2OSYA 4H4SA 2ZZ2A 1EIBA 3M0MA 2R94A 3GHUA 3PJTA 3P60A 1PBGA 5GNZA 3N2TA 4JFUA 3EX3A 3N2CA 1PKYA 2C71A 3LENA 5DBTA 3N15A 1QNOA 5DY2A 8A3HA 1XIFA 3SDOA 1X2GA 2VR4A 1P0NA 1BD0A 3XINA 2X1UA 3BL3A 1CZ1A 1RR2A 5D4YA 1SW0A 2BX7A 3LB8A 2CHNA 4V1XA 5CKSA 3UJFA 2VR5A 4F2TA 3FKKA 4J5NA 5A6SA 1ELSA 1TKKA 3E1F1 4W88A 3NOEA 1ML1A 2ALRA 5XINA 2GQAA 1R9YA 3W1XA 3AIEA 5K4XA 3O6AA 1RPKA 3CGBA 5A6MA 2A6LA 2GL5A 4HNOA 3SGUA 1VC4A 1D7YA 3CV2A 3ZJ6A 1OB0A 3W1RA 4Q4SA 2WQPA 4A29A 3IEBA 2YL8A 4FNUA 4JTKA 2XIOA 3N6QA 4AZIA 3L67A 4ES4A 5CPLA 4KEZA 1TPFA 2Y7EA 4B3LA 2QT3A 2CZVA 3CAQA 3OHIA 5FI8A 3C2YA 4JQ2A 2EAWA 2OZ3A 3EX2A 1AW5A 2CLKA 3VIKA 4ADSA 4CQDA 4QISA 1XIMA 1K7FA 1EDQA 4PMRA 1GOXA 1W9XA 1RLCL 3LTYA 4G6CA 4V1YA 3CPGA 4EPDC 4C6BA 1T99A 3PNUA 2DPEA 3C52A 3W01A 3WNKA 1F5ZA 1P4CA 3TTQA 3W7EA 4PE8A 5GNXA 3Q58A 1GOWA 1F05A 2OZ0A 3MKKA 3LCLA 4ORIA 4WX2A 1CTNA 4GJIA 5FS8A 3VYLA 2CBUA 4O1AA 1BVNP 4CN1A 2CZFA 2CU0A 4JQ4A 3PWAA 3QFWA 1XDMA 1T6MA 2BASA 3BK0A 2UY5A 3S6DA 1ZSXA 5CH9A 1GVSA 3EAOA 1EO5A 3VD5A 3DFPA 2VGBA 3IARA 4GMEA 2ZRYA 5LIYX 4H4XA 3KAOA 3HW2A 4W85A 2G3NA 2ZRUA 4OECA 3WQ6A 3RRXA 1QW7A 3KP0A 4XB3A 4WJ8A 4KWWA 5D32A 3WLRA 5JCNA 3R12A 4EX4A 2ZIDA 5ABGA 4JTAA 1R30A 5JIWA 1BFNA 4L6DA 1ZRQA 4HN4A 1FFUC 1W9BM 2HK1A 3ECQA 4HPJA 4ERIA 1RSCA 2QPSA 1DWJM 3ZOAA 4ZO8A 6ENLA 4PUUA 1BWKA 1JPDX 2BHZA 3GXPA 5AYZA 3H2MA 3PJXA 3L2MA 4B4HA 5D30A 2W63A 4H4TA 4IX0A 3T08A 3VMPA 4S3EA 1KR0A 3I3EA 1W1YA 5CPQA 1V6WA 1QBBA 2HNHA 2BS9A 1AQFA 2OODA 2DQWA 1D2KA 1TV3A 3PZUA 3NO3A 1TREA 1FO4A 2J74A 2TODA 1UUOA 2E6YA 1JQVA 4F48A 4PMYA 3PPGA 5D2VA 3HG2A 3N14A 2R1KA 2VZSA 4QITA 1R9XA 3EWDA 1E9LA 4KF1A 2ODOA 3KRZA 3GUWA 3ZVIA 1EF2A 3NDOA 1UJQA 4JTLA 2QYGA 5A6LA 3JS3A 3N73A 1JI2A 1K8ZA 1PE1A 1UZDA 3RM9A 1GQNA 1E6XM 4HBKA 5JH2A 3LB0A 1BRLA 1O4UA 4DLFA 1YRRA 3SCVA 2A3BA 4ATDA 4C7GA 3IJDA 4PR4A 5AB3A 4AWEA 1ZFJA 2P0OA 4S39A 1ICQA 3FGCB 1BQCA 4CQ8A 4FX6M 1DORA 1GVOA 5TAOA 4M1BA 1TJ0A 4Q6XA 1WDQA 2NXIA 4G56A 1V6YA 4JCLA 2YDQA 2WKGA 3L9CA 1RCOB 3HJZA 3NVVB 4V33A 1XV8A 2O9RA 1OINA 5G4WA 1H7PA 3Q2DA 4GO8A 2JKEA 4IFKB 1L2UA 1NM9A 2D73A 3SUWA 4RDZA 3MTWA 1SO4A 1EEPA 3CTLA 2IQTA 3K8KA 3ORWA 2BC1A 1GRTA 4QJ3B 1BGAA 3CV7A 3MHFA 5D2WA 2YSWA 4UTWA 4ZSUA 1S2WA 4JIPA 3C0QA 1PKNA 3W38A 3D3FA 3EXRA 4YCOA 3CQKA 3DDMA 3ZT7A 4BQ4A 5AVHA 1DWGM 1B9BA 2V0TA 3R8HA 1VCVA 3WH9A 3KBVA 3GG7A 5JBFA 2V2DA 3WNPA 4MYXA 2VDGA 5LGXA 2Y5EA 3O6CA 2WOIA 3FCPA 3IIZA 3VDBA 4MKNA 3DECA 5TBOA 2EQ6A 2FPVA 4W86A 1A0DA 2CLFA 1UWQA 4LCSA 2OJPA 1QPNA 2Z1KA 3DXIA 2QCNA 2X50A 3NL2A 4AZCA 1GVRA 2J79A 4K8GA 4L1GA 1AJ0A 4LYQA 2DUZA 1EJWC 1ZALA 2C7FA 3IUHA 1NF7A 2WMGA 3V4BA 3BPWA 5T9CE 3GDKA 3WLKX 3G3DA 4JNYA 3WDRA 2G4FA 5BXRA 4F4RA 4PGLA 4X2PA 3VNDA 4Y8EA 2X0HA 1OF8A 4CCDA 4EXBA 2GRTA 1LWJA 5CSYA 4HMNA 4NZ4A 3KE0A 3IACA 1TA3B 1WQ5A 3VIOA 4N7QA 4MMWA 3WL0A 3W2LA 1XH2A 3WQGA 2NQHA 3HA1A 4TUFA 2B7OA 1NHPA 4G7EA 1IXOA 3IS4A 2ISDA 1JYWA 2VC5A 2Z25A 2ZA2A 4REQA 4QHRA 3TYBA 1OCJA 2BDQA 1EJRC 3CB3A 5EY5A 1SO6A 1UR4A 2Q8ZA 3CNYA 1O66A 3SY5A 1UQYA 3N29A 4H7CA 1GYMA 1GVIA 2JIEA 1ZZMA 3VKKA 2NQ9A 4AY7A 1NDWA 2QV5A 4B4FA 2IMRA 3TMLA 4TQTA 3H23A 4MYAA 2Y4SA 2C15A 4XTDA 3OYZA 3QY8A 4PSRA 4K36A 5DCEA 2GDQA 3GQYA 4RDWA 1BXBA 2H90A 4ATLA 2XH0A 3WQOA 1X8FA 4O1BA 3WH7A 2DU2A 4XTIA 3B8IA 3GD6A 2WC7A 3KOFA 5BROA 1DWFM 3GRTA 3F2BA 1XYLA 1U5JA 2GWGA 3AS2A 3TX9A 1L8NA 2C6QA 4WIWA 5HQEA 2UY2A 4FIQA 3S4TA 3TONA 2DZTA 2R1PA 5D2YA 3C4UA 1LOLA 4I9AA 1Z3NA 2VM8A 2JE8A 3R6IA 3E96A 1D8WA 3FIGA 1OGBA 5D9NA 3IGHX 3W7NA 3R13A 8TIMA 1FWDC 1JFXA 1HL9A 2PRHA 3S6OA 3SCOA 1GPFA 3MC5A 5EFDA 3TYCA 4RZBA 1ITXA 1H41A 5D2TA 2X7WA 3LADA 2FFCA 5JH1A 4H50A 4Q4QA 4LQ1A 3W24A 2EPKX 5AC7A 1BEUA 1HF6A 1P0EA 1HJUA 3VNZA 1W1B1 1KW1A 2QW5A 1S2CA 2BWGA 3FDKA 4QDPA 5LA1A 2CXGA 5I6SA 1XISA 1FWJC 2PE4A 2X16A 3E2VA 3Q65A 3LYEA 1GRGA 3SUVA 4IMAA 1XBZA 1GTHA 3DYOA 4U2ZA 2XVKA 8XIAA 1CENA 4EF9A 1ZJBA 2LLEA 2X0SA 5LZLA 3UG5A 3SADA 2AGKA 4NUWA 2YXOA 3ISIX 5D02A 3B97A 3UR7A 1GERA 2CKRA 3UYIA 3WD3A 5HAOA 1CT5A 4CN4A 1YDVA 4QG8A 4AIOA 2GJLA 1TUXA 5D9OA 4DHGA 3N6HA 4GXPA 2NT1A 4GIEA 3V35A 3AUOA 1Q6OA 2X8GA 5K7JA 1PSCA 2Z1BA 3C8FA 1V97A 1EC7A 1RY0A 3QRHA 3IC9A 1V3JA 3PK7A 3A5FA 3FJ6A 5C55A 2R82A 3OGSA 1XYBA 4UR9A 1W5OA 1IWBA 1XD0A 2WMFA 3TXZA 3WIJA 4E2DA 1C9WA 2QDGA 4DXKA 5TNVA 1RD5A 2OU4A 1F8WA 5KTLA 2KAUC 2RGMA 4GUIA 1KV5A 1MI3A 3ZJ7A 3HRDC 4JQ1A 1UW9A 2F6KA 2J8GA 4NZCA 1JZ3A 1CGYA 3AYTA 3ID7A 4E38A 2CDUA 3IJ9A 3RLUA 2XVGA 3ATZA 4Q4PA 2CERA 2PDPA 2DJXA 1FP9A 3MQTA 1GKQA 4ZTXA 1OIMA 3UQNA 1X1ZA 4ZQNA 2G0WA 5K2ZA 1IWAA 2P3ZA 3BLFA 2WMJA 1F9CA 3OQ8A 4NL1A 4U5IA 1W1VA 2WB5A 3HV9A 1HKKA 2XGIA 2CW6A 4F9JA 3D5HA 3FJLA 1FXQA 4AD1A 2X7VA 1FEBA 1YEYA 5EKYA 4YYFA 3N2BA 1CLXA 2BVYA 2VVNA 1OZMA 2Y5SA 3VPLA 3CHEA 5G5HB 3VCRA 1H7RA 4N4PA 4PMUA 1XPYA 3DBNA 3T55A 1JULA 4AW7A 4H4PA 1FFVC 4JTGA 4KMQA 4GIYA 4MTVA 2C18A 4NZ1A 4TV5A 2DSKA 2XJ7A 4JIEA 4ATWA 4DBWA 3NO5A 3WBWA 2H9AA 4H4YA 1U1JA 1FHDA 1AUSL 6TAAA 1FOBA 4DM2A 5A6TC 1E1CB 2XH2A 3URHA 2E4TA 2XFFA 4PMQA 4HNNA 2WNZA 1O1HA 3W70A 1UYQA 4O4VA 4JTJA 3DGHA 2VUYA 4CNTA 1N60C 1QMLA 5SWUA 3I7SA 3N13A 4Q4KA 4XAGA 1RP9A 3ZZ1A 4XAPA 5KITA 2GSJA 4IIFA 1ZMDA 1UBSA 3CZEA 4MADA 3A6OA 1UKPA 4XBJA 1BYBA 5K9CA 2EG7A 3V1HA 2GK1B 4LSBA 4OJYA 4R9OA 1KC7A 2EG8A 3WQVA 2YL9A 4LEFA 1EX5A 5FA5A 4J56A 8RUCA 3EMQA 3DGZA 2NV1A 3GUGA 4M52A 1GVYA 5I02A 5I3JA 4N6FA 2FZBA 5G1MA 3W7HA 4CVUA 2YX0A 3AXHA 2DH2A 3M46A 2QJNA 3GVVA 1EEXA 4GO9A 2QJIA 3DI0A 1LDCA 3ARSA 1PZ2A 4LYPA 2NT0A 4BQ5A 4NJGA 1ONFA 4H9UA 1AMYA 2WP6A 1YDYA 2A1YA 3O6YX 4PMOA 1NWUA 1TMHA 2YA1A 1WUFA 4YJ5A 4OIFA 2R1NA 4QJ4B 1OX4B 5HJLA 4B16A 1ZTVA 4W8AA 4AMCA 1YMYA 3RCYA 5G4HC 2QDEA 2EQDA 1WNOA 1RXOB 3QV6A 3NQVA 5I23A 3TP4A 2XIIA 4GNKB 1H1NA 3W2UA 3OB8A 5I3DA 3IVSA 5DCBA 3DK4A 1XD1A 2XN2A 1XSKA 3V3WA 3CQJA 2RJHA 4IP4A 3GC5A 3AXXA 3DYMA 5DFAA 2EQ9A 1AW1A 3H2AA 2B31A 1XC4A 4K8HA 1FQ0A 4US6A 2HXUA 3M0ZA 4IIBA 4ICMA 3IGXA 1XLLA 4BI7A 1A50A 4AZGA 1I2OA 3CUJA 4U4MA 3TU9A 2PRMA 3S1UA 3O2LA 4EPBC 5EMUA 1HP4A 4PTDA 3AAMA 4FXSA 1EOKA 2J7HA 4ZE5A 3ARQA 1TWSA 5A6JA 4HNTA 4L6OA 3NG3A 3MY9A 3H2OA 3IANA 3MUCA 2G50A 3P61A 3FEMA 2JEPA 4XD5A 1H0GA 1R5YA 2PD9A 4MY1A 5F4SA 3TAKA 4ML9A 4A3HA 4POCA 1M5WA 1ENUA 1KR1A 4D6FA 1W3KA 3RCMA 3M0HA 1LP6A 2GJNA 3TTSA 2RDWA 3JR2A 3BCFA 1I6NA 4N9DA 4GIRA 4JNZA 2OLHA 4WSKA 3K13A 1F3TA 4B2DD 4DX3A 5CJNA 4C91A 1VEPA 5A2BA 1NOUA 5DXXA 5HWNA 4KPLA 2BG5A 2QV4A 4A4AA 2YCEA 3OGRA 5HMFA 5DELA 1TE6A 3NZRA 4X0NA 2DGAA 1LOSA 3W23A 3LCXA 1XW8A 4AFYA 5LKYA 1LG1A 4GHRA 4MWAD 1VDVA 3D3AA 5LNVA 2QCHA 2WNNA 1TWZA 4ZO7A 4IZGA 1W1IE 4QQUA 2VUNA 2QCDB 4BR1A 4I9JA 3RLVA 2E67A 2XN1A 3KVMA 3WBYA 1UZHA 2ADAA 3MWAA 3B8UA 3UG8A 5E6YA 2GGIA 2BVTA 2EEXA 5ER0A 1VCGA 3NAVA 3VZYA 4QEHA 5D05A 3UA3A 2ZZ5A 2A79A 4M56A 1C93A 4TOQA 1IEWA 3PM6A 3P8IA 4WSHA 3WQWA 4FIRA 2C3CA 2ZYFA 1UJPA 3NM1A 1Q7ZA 4UWMA 3NSNA 4MB5A 3QFEA 5H8MA 2ZZBA 3VKCA 3CEPA 4D8LA 3SRFA 2C16A 3GFYA 3STGA 5EPDA 1UQZA 1PHQA 3HQPA 1E1FA 4J3SA 4AMAA 2NXGA 1L6YA 1G69A 1L0PA 2I14A 3FAXA 3SURA 3PANA 3DFNA 2DT3A 5EMJA 2GVEA 3N4AA 4TMBA 1C8YA 2I5QA 2OOGA 4Q8OA 3ONCA 4Z2GA 1F74A 4BI6A 2VRQA 2ISFA 5CGTA 2A7PA 4Y2WA 1AQMA 5BOEA 3QOKA 1QJWA 4H6EA 4UTIA 3TYDA 3N4EA 4ZB0A 3ARWA 3GAYA 1HQTA 4MLJA 4O50A 2VMFA 4CNUA 5A2AA 4QTGA 2XPKA 4Z2KA 2ZVIA 1XBXA 5DEZA 1BTCA 4RZ4A 3NGJA 3GXNA 5HUOA 1KTNA 1JAEA 1JCJA 1X38A 3OVQA 4D6IA 1OVDA 4O54A 1J8VA 2HMCA 1GVEA 1XIGA 4NI3A 1K8XA 3OTRA 2HPIA 4L4OA 4V2XA 2NQLA 3ITOA 3M64A 4J3TA 1XS2A 3LMYA 1J12A 5MHBA 1U1HA 1YIXA 2A4AA 3NVWB 2YGYA 1I2QA 4QE1A 3ES7A 1ZL1A 1VBJA 3TTOA 3AS1A 1S2UA 2E1WA 1PCWA 1PIGA 2YAUA 3GYCA 3QW3A 3OG2A 3WQPA 2ZDRA 3RPTA 3P80A 1Q7QA 2D69A 4C6FA 3Q4DA 5D8ZA 4LUSA 4JIHA 1YNYA 5I2UA 2PTZA 2QNEA 3LXAA 4ZOCA 1ISZA 3FGCA 1IEIA 2O9PA 1E15A 1N8IA 5HMDA 4HU8A 1S5MA 2NLYA 2ZX5A 4FZIA 3S8HA 3ICJA 2PGFA 1JPIA 4BS0A 2UY3A 2C91A 2GVGA 4IFKA 5EB8A 1HNYA 1HGWA 2ZTKA 3CXBA 5AYYA 5J8LA 2PLMA 1Q63A 4MKSA 3KFTA 4HHHA 3B40A 3VNYA 1VAHA 5CAKA 4RX0A 1KGUA 3Q45A 2DIEA 3U5UA 1JYXA 4XUGA 3TE9A 4WF7A 3AZRA 3WD2A 5JIPA 4A8RA 3KL5A 4IF2A 2WPCA 1A4MA 1XFCA 2PSNA 3TSMA 8XIMA 1IR2A 3GXMA 1Z41A 2XWDA 5LHFA 3R4IA 3P0XA 3LBOA 2EKGA 3U6WA 4EQXA 1B31A 2GGJA 1FKXA 2PCEA 3IIOA 3ALFA 3BC9A 2XUCA 4PMZA 2A6NA 3L4YA 5C9RA 5KINA 3QHMA 1ZS2A 5I0DA 1W9VA 4U28A 4XZIA 4H7VA 3WNNA 3H4GA 2C3DA 1GZGA 3K46A 3MI6A 2X99A 2GR0A 4J57A 4JYEA 2PWVA 2PDHA 2VX7A 1P1XA 3MP4A 4ZCWA 1GVQA 2X0YA 2QPUA 4GYKA 1JEHA 2EJ1A 4NHVA 5I3HA 4FNSA 1LLOA 4PCSA 1REQB 1GNXA 2ZX8A 3RUBL 5FJTA 4Y90A 4M6PA 1Y65A 1G4TA 2W9MA 5CSSA 3W7RA 3VE9A 5I03A 2GH5A 2BB0A 4CGTA 4DJFA 1TA3A 3LS9A 3WQ5A 1JROA 4GZEA 4XK2A 2FDMA 3NSMA 4LANA 2ZXDA 4YL2A 4TVYA 3CZGA 1FKWA 3F4DA 2YYUA 4BF7A 1WYGA 1IIGA 1KRCC 1ONXA 1GKRA 1HN1A 3VGEA 3TW6A 2B7PA 2KZHA 3CGEA 1EFZA 1ALDA 1B3ZA 3MUAA 1SPQA 4KGJA 3CGTA 1E0XA 1LUCB 3NPXA 4S3BA 3W82A 3UNDA 1NFBA 3WEZA 5J5DA 1PIFA 4MF4A 3SAZA 5FESA 4AX6A 2BY0A 3B0XA 1I2NA 1GOMA 4BJHA 2I1OA 2FPTA 4H9XA 3UD6A 1A49A 5EMMA 2HBXA 1MQRA 3RF9A 5C7HA 4DI9A 3NCOA 2BXZA 3N25A 3QGKC 1UR0A 2ANUA 2OZTA 2XISA 3PWGA 5C2CA 1BSIA 3I6TA 4XIMA 4ICCX 1GK8A 4TR9A 3T44A 3TQKA 2ZC8A 5J5RA 1UROA 3WJYA 4FP1A 4ZOAA 3I7QA 5FJIA 3BGAA 1QHZA 4ADWA 1RQBA 2RJGA 4DQWA 1JUKA 2IKGA 3R0KA 3QGAC 3S2CA 4NXSA 1LBMA 2AKZA 4MY9A 1J9YA 4ZO9A 5HJYA 3CBWA 5BRBA 4P8UA 1WOAA 1ITQA 4FOUA 3WDQA 1ZAJA 3W6YA 5AYBA 1NY1A 3D6NA 4Q8WA 2VELA 1IF2A 1LOQA 4KKXA 4IHCA 1OYAA 4OOUA 1PTDA 4HPXA 4K2SA 3CWHA 1C9DA 2W0HA 2P8BA 5EBUA 3WLOA 4QNWA 4KCTA 3K8MA 4UNKA 1FHVA 4K1GA 1V8EA 3ARRA 1E72M 3CC1A 2ZBTA 3G24A 5E0CA 4MNJA 2WXDM 4HHLA 3AMKA 1YQ2A 3DC0A 3EKZA 4N02A 1L6GA 3THUA 2V6AA 5LIKX 3U4AA 1CEOA 2VEFA 4E2VA 2ZXBA 1QK0A 1FWGC 2QJGA 3P62A 3GHTA 3U2CA 4M19A 1HKVA 1UA7A 3DI1A 4M82A 1XKYA 1JRCA 3L0GA 3SEPA 1OK6A 3EMZA 1QOXA 2DEPA 3MJMA 4YTQA 5D38A 3W1MA 3NPUA 1U1UA 2AQWA 1JCTA 4X9YA 1GWJA 5CLTA 2Y24A 4Q8VA 1EJ7L 4W7WA 3DFOA 1WUEA 2QEZA 5JMUA 3IAQA 2O9OA 4LY4A 1UKSA 1PX3A 3RU6A 2XHYA 3IJ6A 1J79A 2DZWA 1XDLA 5FJJA 1OQFA 5LIWX 1QBAA 4K68A 5HA7A 4O0KA 3LSBA 1FVPA 4QG6A 3HJEA 4P7RA 3RAOA 5AECA 5A8MA 5LNRA 2H8ZA 2WC3A 3T78A 2EPHA 2WZHA 4O53A 3WH6A 2YBTA 1NWSA 1X6NA 1POJA 1H51A 4QS6A 3QV8A 4AXNA 3VXGA 4CVWA 2AQVA 3G1HA 2IPWA 3TV8A 1V5XA 1IGSA 3NVDA 3AU6A 2OGJA 4GY1A 3UWZA 4I5XA 4LAMA 1QU4A 1BZLA 1I1WA 1S5VA 1CXEA 1E9IA 3CTTA 1FHUA 2ZX6A 4R7OA 5BOFA 4PUNA 3WKZA 3IV3A 1YLVA 3D46A 3WBXA 3HU7A 3ZVHB 4K37A 3CAWA 1R0MA 1KM4A 1V08A 2NX9A 2VENA 5A8GA 3VUPA 1LL7A 3LCGA 2FH8A 1IE7C 2E6AA 1QNRA 2Z24A 2CLEA 1Q2SA 3MPGA 4BF5A 3QQ1A 1QOPA 3JU2A 3W02A 2FDSA 3LD5A 3T40A 3W07A 3DG6A 1NFGA 5EMYA 3S42A 1KCKA 2ZUUA 1JL8A 3W29A 3GIYA 4FXJA 4IL0A 3FFSA 5I77A 2FGBA 1KXHA 4LYRA 1WKFA 2OG9A 1E9ZB 2X2YA 2CLPA 1H5YA 1S5TA 4Y9AA 4L9XA 2PP0A 4LALA 1TPDA 3CXOA 1KFJA 1T7LA 2PTWA 4GVHA 4MJMA 2Z2UA 2JFEX 4EK7A 2GQWA 1VBHA 4KRTA 5K9DA 3MHUA 4UQBA 3AN1A 1ODZA 3N4FA 2W61A 3FKRA 1Q8JA 3AXIA 1PXGA 1PPIA 3OVGA 2VFDA 4ZQCA 4IG2A 4IIHA 3QC0A 2V3GA 4S38A 1F3PA 1JGIA 1D8CA 4C1NB 2Z6JA 1Y0EA 1Y5WA 4GC3A 3UNTA 3VDHA 2G96A 5CSUA 3REQB 5D04C 3VD4A 2R91A 2HRWA 2PDMA 2I7GA 1OF6A 4HU3A 3H7RA 1XCXA 4Q8QA 4EAMA 3WDHA 3GAKA 5I3FA 1XIHA 1V3HA 3WLHA 4I3GA 4S3DA 3C2EA 1OJTA 3ATYA 1D9EA 3INPA 4O8RA 7XIMA 4IUOA 3TXVA 3AROA 4NRRA 4TTGA 2ZDSA 4CEXC 2ICSA 3TN4A 3II4A 1IXNA 4DXXA 2E9BA 4LY8A 5HNTA 1KBLA 4XUYA 4KWSA 4AX7A 1AFSA 3P5YA 3WD4A 4F79A 2C13A 3TAOA 2V5CA 4UFJA 2PDBA 2QCMA 4GK8A 3SCPA 4JN8A 2J78A 1EA0A 1V7YA 1RVKA 3EB4A 2WHLA 4ZBCA 3SO7A 4D8ZA 1DHPA 5BOOA 3W73A 5C9WA 1NSJA 3CHVA 4YTTA 1UMLA 2WVVB 5ECVA 3W7KA 4AVFA 4CU8A 4DWDA 3E2QA 1KCZA 2ZUMA 3WLIA 2C19A 4H6KA 3GYEA 4P2VA 1QI4A 3UETA 3D0CA 4GD0A 5K9XA 2VQTA 3MA8A 3EOEA 4Q8MA 3WUFA 3FV9A 1W32A 4YXGA 4L64A 4H9ZA 3WJWA 4E4UA 4LFYA 1CGWA 1XPGA 3W4RA 4JBRA 1EWDA 2VZVA 4CUCA 3CJPA 3ZQ9A 3ABRA 3QM3A 1NWRA 1OFBA 5A6BD 2D23A 2DQXA 1MQQA 1H60A 3B9AA 1G0CA 1VLIA 1V6TA 3NIYA 5GJMA 3EDDA 5KZMA 3VK5A 4GX9A 3AS3A 5M5DA 4MZ1A 3M4HA 1KCLA 4ZFMA 4F0HA 2YXXA 3WJSA 2RHGA 5FL1A 1KBBA 3VOHA 3PSWA 3WF0A 3XISA 1QPKA 3MCMA 1TMQA 2ACSA 1Q3NA 2QR6A 3BV4A 3ABXA 1XLHA 4E4PA 1WV2A 2CLLA 2XIMA 3S5SA 3PJWA 3UXAA 4JEJA 4DWSB 4GLEA 4LF2A 2PDXA 3GIPA 4LC8A 3FA5A 3WQ4A 5JCKA 1GYLA 2RDXA 1FDJA 1A3XA 3ZFHA 1J96A 1QCWA 3TVAA 2ZRXA 3LLXA 4WY0F 3WLQA 2OSXA 3BE7A 4AYSA 3BZGA 3QH2A 2OOFA 5I06A 5HR7A 2WPBA 1XWYA 3IIPA 1VS1A 5G2IA 1M65A 4DWSC 4J7RA 5BU9A 1ZU8A 1QK2A 1TPH1 3UGVA 4JR5A 1DIDA 4RV3A 4GQGA 5I00A 1WKEA 4EM4A 4D2JA 1KO0A 3TNOA 3L12A 4ROQA 2YA2A 4O1DA 1YPFA 1A5KC 3AU2A 4GCXA 2Y8UA 7PTDA 2YVFA 3PZQA 1ISXA 1W5PA 4ZE4A 1XG3A 4MZYA 2CESA 2O4MA 3LXCA 4LA1A 3J7HA 1QDSA 3RILA 3DH9A 3N1AA 2AL1A 3BMXA 2EJAA 1EX1A 2F2HA 4AWSA 4H19A 4KWUA 1TSIA 3U0HA 5FS7A 2PZ0A 2WNQA 3M0VA 4QIUA 2QKFA 2YYTA 2ACUA 3GDMA 3THCA 5A8NA 3BLEA 2FMNA 1H2JA 1GQIA 1PZ3A 4H7ZA 4HIBA 5BYWA 1V02E 5DO8A 2BMBA 4H83A 2FTYA 1VQTA 4KQNA 3NWRA 2INZA 4IFOA 3STFA 1LRNA 1TPB1 4AG0A 5I07A 5C2XA 2V5DA 5CZJA 1ECQA 1VKFA 2JIWA 3WL1A 5AYXA 4NNBA 2VXNA 1R3QA 4KRZA 1D7KA 3CZKA 3F4VA 3WLNA 2F84A 1YTEA 4O57A 1QI5A 2B0MA 1C8XA 3WG6A 4EWND 3BARA 2ZXQA 2GOKA 1KFLA 1SJBA 1KBIA 5CC6A 3LNMA 5M17A 3DHUA 2C8NA 3FYOA 4WR3A 1LROA 1S38A 3P82A 4OE7A 4EIVA 4W7UA 2VYOA 3W83A 1IXPA 4I7WA 2VQUA 1EXBA 5IBXC 4QCFA 2J88A 4AVOA 1W9UA 3FOKA 2ZUSA 1K4HA 3HGJA 2NSXA 1ITUA 4BQ2A 2FHBA 3B03A 2D3NA 5C54A 3CYVA 3KW3A 3D9XA 1DWIM 1NQ6A 1XC6A 3FAWA 2BHUA 3VGHA 2NQJA 3DK8A 1K7XA 3HGSA 4I9MA 3TQ0A 3WJZA 3KWSA 1TPWA 1PO9A 3QR3A 2PWEA 1D3CA 5E9XA 1NH6A 4XAYA 3G1VA 3BURA 1UP0A 3PN8A 3I4EA 1IIHA 4ZOHB 3VKBA 3TJXA 3DN5A 5KZDA 4AD3A 4Y96A 1H6VA 1O95A 3GBEA 3N18A 4NZ5A 3CS2A 2ZFAA 4LV9A 5I09A 1P0KA 3M9YA 3E0FA 4S3CA 2Y85A 4CD5A 1N5WC 1VPYA 2W55A 4JTFA 5GJNA 2PBGA 3VM7A 4A6GA 4ILSA 2HS6A 3STPA 5HNUA 3QJAA 4LAUA 4NYUA 1BYCA 4D6JA 3N34A 1CECA 3QMSA 2PLKA 3W1LA 4I5UA 4ACZA 1XINA 2GSEA 4HK6A 1VHCA 1E9YB 1RA0A 2GUYA 4G8TA 4M8UA 1JOAA 1P0DA 1DJZA 4E0CA 2D20A 3IJ8A 3H12A 2EKCA 4AISA 3W85A 4AVNA 1YXDA 3VKDA 4I8YA 3O0HA 4DZAA 1C8QA 1MRQA 3HURA 5CAHA 5CEWA 1K8YA 2V3EA 1EOMA 1VYRA 1FUYA 2PI6A 5EGRA 1SZEA 3E5BA 2HS8A 3TZFA 4AEFA 4QEEA 2J7BA 1F6PA 3U3HA 2OTDA 3QLDA 2V30A 1VIWA 7TAAA 1B0IA 4HTYA 3B9NA 3QV7A 5JBDA 1A5OC 1VBRA 3WZ0E 4AY8A 1G01A 4YWSA 3WELA 1US2A 3N11A 2O92A 4TVUA 2PP1A 3GXFA 3GO2A 4IQLA 3UY8A 3T8QA 3WBEA 2WP5A 4X2RA 4J1OA 3H8AA 4Q7IA 3W26A 3UWUA 4CCZA 2W91A 3RPDA 4RJEA 4OQVA 3KL3A 2VTFA 5CJMA 1E6RA 1JGMA 2Z28A 3V0SA 5REQB 4QGCA 1ZPTA 2OKOA 3ITVA 1S1PA 3P84A 4DJEC 4AHQA 3U9IA 1YHTA 3A21A 1AH4A 4GNJA 3FXGA 3MSYA 2QHAA 2E5AA 2J6XA 4Q22A 5FS6A 3TWAA 4QLJA 2FTPA 5DX7A 2VNCA 4TVDA 1SO5A 1POKA 3S5YA 1BAGA 2J8FA 1E6SM 1XRSA 3GR7A 4DIAA 1VEMA 2WMKA 3C2VA 3MU7A 4UCFA 4GA8A 3VOGA 2F6UA 1Q8AA 2C3ZA 3V5OA 4PUMA 3JUGA 3POCA 1H49A 3P2VA 4I9TA 1SO3A 1N8WA 4RW3A 5CLWA 3HV8A 2YLAA 3A4AA 4I90A 1K03A 3MO4A 3W7DA 4WDUA 2XN0A 3VNIA 5TD4A 3OA3A 5KZ6A 3H2FA 4QSFA 5I79A 4LBRA 2DJLA 1ADOA 4WDWA 3VIPA 3GG0A 1FCUA 2PTXA 5CPNA 3NQ6A 3SJNA 4FNRA 3VMNA 1EHNA 1W5MA 1G94A 4MPQA 2Y61A 4XAFA 1NVMA 4EMWA 4UTUA 4UFMA 3CQ0A 1ZNNA 2PEVA 3TLLA 3A4WA 3C0LA 1LT7A 5LYRA 3AYVA 3SCNA 4JX5A 2VZOA 3BAKA 2A7NA 5U25A 3RO6A 4WY0B 2TRSA 5JXQA 1ZCOA 3DFTA 3LMZA 3N6JA 5AC6A 3RLGA 4LAOA 5BMXA 1DPMA 1KLYA 2YPIA 4IP5A 3TROA 3UESA 3L5AA 4M6UA 2WNWA 3KCLA 3OZOA 4P7QA 3L7RA 2HCVA 3T6CA 1RK5A 3CV1A 3BLDA 4MNKA 2ZUWA 1YPXA 1KFKA 2QCFA 1CIUA 4FX9A 3S2LA 5C9ZA 2J4GA 1RA5A 2D0FA 4OKDA 3WK1A 3NL3A 4BQ3A 1F73A 1H1YA 2ZE0A 2F2KA 4C7DA 2D2OA 3CEUA 3UCQA 3ZSTA 4US5A 3TR2A 1T8XA 3UWYA 3ZT6A 2VURA 1ZK7A 2WLYA 4JN6A 2GR1A 2V69A 4Z0JA 1LL6A 3DC8A 3EDEA 2QCEA 3EA2A 1FWFC 4RPPA 1B4EA 3KCJA 2YW3A 3GNPA 4P8VA 3CASA 4AUBA 3U2OA 3CGCA 4PMDA 4OUIA 4WXYA 3VC5A 1GZ1A 1DQUA 1AD1A 2ALDA 3W6MA 3G2GA 1M3UA 1WXZA 4UCGA 2PRLA 4C6PA 1H61A 1XGZA 2OQHA 1QVBA 1DJNA 4C6EA 1LL4A 2X09A 4L5ZA 5HULA 4UFHA 4M24A 1DQWA 1K77A 4MIMA 3BG9A 4AIEA 1MQPA 1YQZA 4Q33A 4R27A 2QMKA 3LI0A 1TELA 4DNAA 4JFSA 3K1GA 5FF2A 4HOXA 1MVYA 3UW6A 2WMHA 4X61A 2D0GA 3QSRA 5BXTA 2RABA 5DY3A 1NF0A 1NU5A 4KGLA 3PFRA 1E3XA 2DZPA 4V15A 2V9DA 3QZAA 3A13A 3EKGA 2GJXB 4H4UA 2WHJA 1PUDA 1JRBA 1H11A 1VHNA 3PNZA 2Q71A 3GE7A 3H2CA 3R43A 2RGLA 5EBKA 1OZQA 3TOPA 1JAKA 4GXMA 5H2ZA 3EWUA 3NQMA 1LM1A 2PWDA 1GQKA 5C9XA 4W4QA 5KETA 2E5CA 3GR4A 3ZM8A 4ACYA 1FDZA 3WK0A 5HOSA 3W6LA 1W3HA 2VHLA 3B9JB 3QY6A 1JUBA 3GTFA 3GVRA 1NDZA 2SFPA 1R7OA 4KIEA 4RLIA 2WM0A 2GUUA 1QI0A 3CUIA 3PUEA 1W91A 3COTA 4KW2A 4YWOA 4F3HA 3VC6A 4IPLA 4PFHA 2YOCA 5DT7A 4GCAA 4MUPA 3VIFA 1WP6A 1VH7A 4JFVA 3KHDA 3N2OA 3GXTA 2OEMA 3F5KA 1Q6GA 5GQBA 1N5XA 3SN1A 4GPNA 3PUGA 2VX4A 2J25A 4H4IA 3SCQA 3B0YA 3UPMA 3LSCA 1XQKA 3CIXA 4FMVA 3L4VA 1Y8BA 3C5QA 4JDRA 1ZKQA 3B9EA 1TPVA 3B0PA 3FYPA 3THAA 3AHZA 3PP7A 3EX6A 1EWEA 3G1AA 1G67A 3IV8A 3SCUA 3O63A 3DKLA 4A8LA 1Z69A 4IJRA 3BOLA 5CZKA 4LPCA 4MB1A 4I5RA 1JIBA 3N12A 1PAMA 2QAFA 3BW3A 3MBDA 3GRIA 4M1RA 4DY1A 4ZFCA 4MHBA 2WAGA 1O5XA 1S39A 2QUUA 3LU2A 3O8AA 2PB1A 3VUSA 2DT1A 1RCQA 3FSTA 1ADDA 3LX9A 3IRDA 2OPJA 3CLWA 1NJJA 4L4LA 3EPNA 1F4AA 3GSMA 4EPEC 2HPMA 4UXDA 3L65A 2Y7DA 1J6OA 4QAIA 4Y7EA 2CKSA 3DIPA 2A3EA 3PAOA 1IXQA 3REQA 5IOBA 1DXFA 2ZX9A 4QS5A 3U48A 4YTUA 4L4PA 2IW0A 3L66A 3T2PA 2EXOA 1KD0A 1BTMA 4F0LA 5I78A 3GNDA 4FDCB 3N9SA 1M7JA 2I5IA 2F61A 1KFWA 2VFIA 2WPEA 1FP8A 2PGWA 3IGUA 1UWAA 1PWMA 4MKVA 1S46A 4O16A 3R58A 2YLLA 3C2RA 1TV2A 2EPLX 2X8RA 4YN5A 1R9ZA 3LGGA 2DIKA 5BMWA 3TEVA 4KFNA 3K2GA 4FNQA 5CC5A 4RXFA 3MBFA 4S3KA 4DPPA 4IT1A 2HROA 2OGYA 3I4KA 3V36A 5B7ZA 3CZLA 4UC5A 2E25A 3WMSA 3T4WA 5FCZA 4AF0B 5AKQA 4ZA0A 1HUVA 3OLIA 5G2WA 3R0DA 4GNVA 1A5CA 4O10A 1E4LA 4R7WA 2DSWA 1Y5XA 1JPHA 2OLAA 4V27A 2BZNA 5EYWA 1D3GA 3KLKA 4GKLA 3SBFA 4C6MA 3ANYA 2NLIA 3K4WA 4ZOEA 1X2HA 3PPFA 4PL1A 5CJ5A 1XYAA 4JTUA 3DBPA 1ZAHA 3RHGA 1HJSA 4GQBA 1F6YA 3ITCA 4QAWA 1W1ZA 1PTGA 4RZ5A 2J75A 3KTSA 1UWUA 3R7MA 3UR8A 4IXHA 5GNYA 2JGYA 2VOMA 1ZUAX 1JNDA 1WKDA 1PB0A 4TX8A 4O8AA 1E40A 1H2IA 3GNRA 3WFAA 3PFMA </