1KCZA

Crystal structure of beta-methylaspartase from clostridium tetanomorphum. mg-complex.
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
413
structure length
412
Chain Sequence
MKIVDVLCTPGLTGFYFDDQRAIKKGAGHDGFTYTGSTVTEGFTQVRQKGESISVLLVLEDGQVAHGDCAAVQYSGAGGRDPLFLAKDFIPVIEKEIAPKLIGREITNFKPMAEEFDKMTVNGNRLHTAIRYGITQAILDAVAKTRKVTMAEVIRDEYNPGAEINAVPVFAQSGDDRYDNVDKMIIKEADVLPHALINNVEEKLGLKGEKLLEYVKWLRDRIIKLRVREDYAPIFHIDVYGTIGAAFDVDIKAMADYIQTLAEAAKPFHLRIEGPMDVEDRQKQMEAMRDLRAELDGRGVDAELVADEWCNTVEDVKFFTDNKAGHMVQIKTPDLGGVNNIADAIMYCKANGMGAYCGGTNETNRSAEVTTNIGMACGARQVLAKPGMGVDEGMMIVKNEMNRVLALVGRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of 3-methylaspartase from Clostridium tetanomorphum functions via the common enolase chemical step.
pubmed doi rcsb
source organism Clostridium tetanomorphum
molecule tags Lyase
molecule keywords beta-methylaspartase
total genus 158
structure length 412
sequence length 413
chains with identical sequence B
ec nomenclature ec 4.3.1.2: Methylaspartate ammonia-lyase.
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05034 MAAL_N Methylaspartate ammonia-lyase N-terminus
A PF07476 MAAL_C Methylaspartate ammonia-lyase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 1kczA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 1kczA01
3UXLA 4GISA 3I6TA 2OZTA 2OG9A 2DW6A 3STPA 3TW9A 4X2PA 2OKTA 2MNRA 1EC8A 3DDMA 3SSZA 1EC9A 3NFUA 1TKKA 5FJPA 4HCDA 3VCNA 2ZADA 2GGEA 3N6HA 3BJSA 3UCDA 2CHRA 3N4EA 3R0UA 1L8PA 5FJOA 3ZLFA 2P88A 3OZMA 1KKOA 1TE6A 3KUMA 2AL2B 4E8GA 1SJDA 4JN7A 3PWIA 3R25A 3BSMA 3I6EA 2PP3A 3DG7A 4H1ZA 3UJRA 2PCEA 4KT2A 3VFCA 4H83A 4MKSA 3QTPA 3IJQA 3OW1A 4KPLA 4A3RA 3ES7A 4DHGA 4DN1A 2PTXA 2GGJA 2XH4A 4J1OA 4ROPA 3VC5A 2P3ZA 2GDQA 2PMQA 2XH2A 4F4RA 2HXTA 2QVHA 2AKZA 1FHVA 3RGTA 4JN8A 4GFIA 2QDDA 1TZZA 2GL5A 2OZ3A 2PTZA 3H70A 2OQHA 3FCPA 3T9PA 4E6MA 1E9IA 2FKPA 1PDZA 3GY1A 1KKRA 4YWSA 2QGYA 1JDFA 3EKGA 1ELSA 4KEMA 4JHMA 2GGHA 3RRAA 3D46A 3VCCA 2OPJA 3CYJA 3SBFA 4GGBA 5FJUA 4IP4A 1JPMA 3K1GA 4FP1A 2XH0A 4IL2A 3V3WA 4DXKA 3NXLA 1MNSA 1SJAA 3NZGA 3DFHA 1WUFA 3MZNA 4HNCA 2PTWA 4GYPA 2PU1A 4E4FA 1PDYA 2O56A 2PSNA 1NELA 1JCTA 4EWJA 3HPFA 3UJFA 1XPYA 3TWBA 3MSYA 4M0XA 4ENLA 4HCHA 3PFRA 3UJ2A 5FJTA 3U4FA 3PWGA 2AKMA 2PA6A 3MUCA 4E4UA 3DESA 3ZLGA 1W6TA 3RCYA 3CK5A 4J3ZA 4K8GA 3CB3A 3OZYA 4G8TA 3GO2A 3EEZA 4E5TA 3FV9A 2QJMA 5EU9A 3P0WA 3R1ZA 3UJSA 1EBHA 3TJ4A 1P43A 4Z17A 3GC2A 2XH7A 3ENLA 3DEQA 3BOXA 4GGHA 1MDRA 3H7VA 3SN1A 2NQLA 4G7FA 3NO1A 4MGGA 3Q45A 1KD0A 3QPEA 4HN8A 2PP0A 2QJNA 4GYPC 3ZVHB 1P48A 2FYMA 1YEYA 1ONEA 3VC6A 3P93A 2OQYA 3ZLHA 4ZCWA 5BOEA 3IK4A 1ECQA 1JPDX 2ONEA 3RR1A 4FI4A 3TTEA 3IJLA 3MKCA 3QN3A 3DG3A 1OEPA 1KCZA 4IT1A 2PGEA 4H2HA 2I5QA 3JZUA 3JVAA 3SN0A 3P3BA 3FYYA 3H12A 3FXGA 1MDLA 1BQGA 2QJJA 3S5SA 1FHUA 3R10A 3RITA 2QQ6A 2P0IA 2AL2A 3UJEA 4M6UA 3PK7A 2PODA 3VDGA 3THUA 4HCLA 3TWAA 4A6GA 4IHCA 3ES8A 1BKHA 5IDZA 1SJBA 3OTRA 3DG6A 2HXUA 3V5CA 3TCSA 2P8BA 3TOYA 3MY9A 4IZGA 6ENLA 5BOFA 3B97A 1SJCA 2OO6A 4MMWA 1IYXA 2RDXA 2PS2A 1RVKA 3UCCA 3RO6A 2PGWA 3DFYA 3SN4A 3CAWA 2PPGA 1R0MA 3JW7A 2PP1A 1R6WA 3GD6A 5FJRA 4DWDA 3T6CA 3OPSA 3I4KA 3OP2A 3DIPA 1WUEA 2ZC8A 3VA8A 3T8QA 3CT2A 4HNLA 2POZA 1F9CA 2QDEA 3DERA 3SQSA 4A35A 3R0KA 3N4FA 3R11A 2P8CA 3N6JA 3CXOA 3DGBA 3H8AA 2OLAA 3T4WA 2PTYA 4IL0A 2DW7A 3MWCA 4K2SA 2PU0A 3TQPA 4IP5A 2OX4A 2GGIA 4HYRA 4GMEA 1XS2A 1NU5A 3V5FA 7ENLA 1MUCA 2MUCA 3QLDA 3IJIA 1DTNA 4GIRA 2AL1A 2GSHA 3FVDA 2HZGA 5ENLA 3TJIA 3MQTA 2HNEA 3FJ4A 4K1WA 3UXKA 2XSXA 4DYEA 3U9IA 3QKEA 3ZVIA 4ZA0A 2OVLA 3V4BA 1EC7A 2XGZA 2OFJA 4H19A 2OZ8A 4HPNA 4KWSA 3UGVA 3ZVHA 4Z1YA 1EBGA 3S47A 4DX3A 3D47A 1MRAA 3Q4DA 3SJNA 2GGGA 5J04A
chains in the Genus database with same CATH superfamily
4XTDA 2BHZA 4GZIA 2V30A 2R8WA 1N63C 4H00A 1GGOA 4O4VA 4FLOA 4ZO8A 4UR9A 2OZTA 1FCBA 2XN2A 3ISIX 2G3MA 4W5UA 2YDAA 4Z08A 2DZPA 4S3EA 2EQ8A 4KWOA 2H90A 3DGZA 5EMUA 1WPCA 4P8UA 5C9XA 3W7RA 3GDKA 2V5JA 4EXAA 3R0UA 3C8FA 1L8PA 2VNCA 3KZPA 5A8NA 1ZY8A 2I9EA 3EKLA 3F2BA 4ZZ9A 1BAGA 3LRLA 2WMFA 4JN7A 1M7PA 5D8ZA 3BSMA 2OLSA 1NM9A 2G97A 4UFHA 3DFSA 3WH8A 4I90A 1IEIA 4CQCA 3E3HA 3R8RA 3SUTA 2D20A 1YYAA 2BNJA 3VAVA 1ZL1A 4KKXA 1S46A 1LQAA 3M46A 3WENA 2P3ZA 1V59A 2WVVA 5I00A 3WH7A 3R13A 4F4RA 3GXTA 1XDJA 3M07A 4QGCA 1K9FA 4OGZA 2D69A 2WJDA 1VEOA 1DBTA 4PL1A 4IJCA 5GJMA 1K4GA 1HGWA 3S0CA 1PYMA 4GX8A 2VT0A 5DMMA 3M0JA 3H70A 3QOKA 4XKYB 5BXTA 3URNA 2CLKA 2NWSA 3GY1A 3CO4A 1YBQB 5DO8A 1JDFA 5LHFA 3M64A 2HCVA 1EA0A 1ONWA 1YPFA 4LSBA 5XIMA 1JXJA 4M1BA 4QBXA 3MHGA 2REQB 4QAIA 3VOCA 5KZDA 1TR1A 2C16A 2XZ7A 3B9NA 1NDWA 4LRTA 2Z29A 3NXLA 2F84A 3R79A 1DXFA 1FX6A 1UA7A 4HD5A 2ZZ0A 2QF7A 2PTWA 3AJXA 1TVNA 2H8XA 4QITA 4S1FA 4E4FA 3VFLA 3B0UX 4LV9A 4YTTA 1UKOA 2UBPC 1US2A 1R3TA 2PB1A 1V6TA 1FP9A 1X96A 2J66A 4EE9A 1V6XA 2C15A 1KXTA 3HO8A 3OLGA 1OT2A 1KR1A 1M9HA 3NPWA 3UG8A 4M0XA 1W17A 3PFRA 3ZR5A 5DEZA 4C6KA 3PWGA 1KW1A 2AKMA 2WNWA 1JR1A 3QY8A 3CNYA 1WKFA 1ZSXA 1W6TA 4HU8A 4ZOHB 4H50A 3ABQA 3E2SA 4ILSA 2DV0A 1BYAA 4V1YA 2NSOA 2R1NA 3FEQA 1HUVA 2PCQA 4MM1A 3RNMA 1TZ9A 2RUSA 1PB0A 2D2OA 3EWXA 4QEEA 1MQPA 4XAYA 4AD0A 3UPWA 4RPQA 4M82A 4O28A 1J0JA 3FGCA 4A21A 2HEJA 5LA2A 4I5RA 3USBA 2P0OA 4O54A 3W1QA 4C1NA 5CEWA 3R12A 1NFBA 3KAOA 2FYMA 1W5OA 3BSHA 3MI6A 3TMLA 1Y7VA 5GPRA 3AU6A 2OX1A 3W6LA 3MCNA 2FFCA 2A3CA 2DZBA 2JF7A 3VMOA 4JFTA 4EMIA 4YXGA 2BWGA 1WZAA 4ICCX 4AZGA 4C6CA 3Q6JA 4XZ9A 1MFUA 1H2JA 1JQVA 3KCLA 3TA6A 3WLIA 3CIWA 4ZL1A 2RGMA 2J78A 3PPCA 3GC4A 1H7RA 3PSVA 1ALDA 3MSGA 3MP4A 4XKYA 3UJEA 8TIMA 2ZZ6A 4NAEA 1E73M 4GJJA 1RLCL 1MQQA 1KFEA 5IDZA 2EG8A 1HO4A 4FOKA 5M17A 3WQVA 4B90A 2A6NA 2BOGX 4I7WA 3CMJA 4AF0A 1QVBA 3IANA 1L6SA 3WG6A 3EA1A 3VE9A 1XKYA 2V0TA 4D71A 1SJCA 3VUPA 3L4VA 1E55A 4W8LA 1EHAA 1G7VA 4PEEA 3SW6A 1JF6A 4Y8FA 4YTSA 1B3VA 2FDMA 4NT0A 4KMQA 2VELA 4AUBA 1FHLA 2WBGA 3S6DA 2NSXA 2A4AA 1W5QA 3ARPA 1AG1O 4W7VA 3WMCA 3Q94A 1Q6GA 3LYEA 3E0IA 1TV5A 2E1DA 3V75A 4LU0A 2POZA 1EP1A 3KDNA 3PULA 1BF6A 3DFQA 1RD5A 4IIFA 4UCGA 4V28A 1E1CA 2QIWA 3KEHA 2X0YA 2VX7A 1BZLA 1NOFA 5HAOA 4O0KA 1VYPX 1B3OA 1EL3A 3MDWA 4MKVA 1FWAC 2WJEA 1LBMA 1TV4A 1T7LA 3WDRA 1EDTA 3I3BA 2PDLA 3A4AA 1QOQA 2Y5SA 4U33A 1QI3A 5ABGA 1JD9A 1FHDA 1K02A 2P3EA 4FXRA 2PE4A 1PBGA 3C2RA 1V7AA 3RN6A 1MI3A 3DOPA 5E1QA 3DFNA 5ENLA 4G56A 4GZJA 5C6MA 2HSAA 3UQNA 1V4YA 3L2LA 4BEUA 1ZXIC 3DFTA 4N0RA 4H4UA 4PTDA 2I17A 3VKBA 3KL0A 1B30A 1GOIA 3GSMA 4B2DA 3SCRA 3UEQA 3VK5A 4UFLA 3SRDA 3O1NA 2WWCA 4XVDA 4PTXA 2QUMA 3BDKA 1JYXA 3W1TA 3MUY1 3CL6A 4BHYA 1ONXA 3SJNA 1LVLA 1JL8A 1NFGA 2QUVA 3LTYA 4RNFA 4UIOA 4NZCA 1WDPA 1UP3A 2QPUA 5HNTA 4DXVA 1VFHA 4AZIA 1RA5A 3LN3A 2E5BA 2WM0A 3TW9A 4G7EA 4TTGA 2QS8A 5I24A 1UH4A 7XIMA 3A23A 3MI2A 3MJYA 1LYXA 3T08A 3CQIA 2EGZA 2OO0A 5A8PA 1Q6DA 3NL5A 3N6HA 1B0IA 1TQJA 3FVMA 3LEPA 2QKFA 4KWWA 3ZLFA 3BGGA 1TELA 2V3BA 2CXEA 4LUJA 3LENA 4CQ9A 2V2DA 1A53A 1KM2A 1ZRQA 4HNNA 4CVUA 1J11A 2Z00A 4HJWA 3TSDA 1H51A 2IPJA 2Z2AA 4NEWA 4JFWA 1BWCA 4NJJA 3KVLA 1SZNA 3I10A 2XN0A 3HQOA 2XPKA 4EACA 1LQ2A 5D9OA 3NL3A 1WDWA 3WLLA 7TAAA 5I09A 2Z7KA 4XSLA 3PBMA 4WDUA 3DH7A 3G18A 2VCCA 2HK0A 3TAOA 3PZMA 4RXFA 4UTTC 3K4WA 4DNMA 2CLPA 4HJFA 1EDQA 2FKPA 1M1BA 1ZPTA 1L2QA 1O68A 1A3HA 4GINA 1NWUA 5B7YA 3AMDA 3I65A 4PGLA 3J7HA 5BU6A 3UZYA 2VWSA 3QBUA 1F73A 4DJEA 3ICJA 1OG6A 4XQ6A 1W56A 5D2VA 4IG2B 2XINA 4Q32A 4PFMA 3W2KA 3AFBA 4XAZA 3SBFA 2WSRA 2JALA 1LRNA 1UWSA 4NXSA 2WKJA 4QCEA 5I3JA 2G3NA 1IZKA 1B3ZA 1H7PA 2WM1A 2BC1A 4V27A 4GJIA 3IAQA 4LJ3A 3L9CA 5H91A 1XUZA 4Z2LA 1IWPA 1OF8A 3KL3A 1V97A 1FUYA 1JXKA 1TB3A 3VGFA 4PMXA 5U25A 3EX4A 1FY6A 5EBAA 1X1ZA 3FDKA 4ZO6A 1SZRA 4P7RA 3VE7A 1CGTA 4Q22A 3WNNA 5D05A 5JIWA 4FX6M 3PANA 3NQDA 1D2KA 1RY0A 1BKSA 1VHNA 1LBFA 1GKQA 3N6QA 4EF9A 3M0HA 4S3KA 3KOYA 2O9PA 4CNPA 2FHFA 1S5TA 1Z7AA 3S2JA 1MW3A 4QRNA 2X1RA 3VOJA 5L9FA 4O0ZA 5IOBA 4FEZA 5IFTA 3UR8A 3W26A 5D30A 4H9YA 2NW0A 3NVYB 4JY9A 4DNAA 2W5FA 3GO2A 3GS6A 5E93A 5HJLA 3DC0A 1Z6KA 2F5ZA 4AY7A 1P43A 1V5XA 4ZOBA 3NM3A 3UW6A 5C7VA 1Z3NA 1VRXA 4TIMA 2OT1A 5CC3A 1GETA 1D7FA 1EBDA 2VFEA 3SY1A 4US5D 1UH2A 2XJ7A 3H2FA 3MO7A 1KD0A 1XIMA 1TTIA 1IQ8A 5G4HC 3USZA 1YMYA 3RG6A 3CUZA 2Z27A 2PURA 4GRTA 3ZJ8A 3P93A 1V0KA 4PA8A 5MKGB 3GYCA 4XBSA 3C61A 2Z0IA 1XIIA 4W87A 3ARTA 4PRWA 4WR3A 2YIHA 2GR2A 2H3BA 1I6NA 4DWSD 1NQKA 5EMJA 3QFAA 2C71A 2Y7DA 4GPNA 1XBVA 1MDLA 3OGRA 1OIMA 3IJ9A 2GJRA 4HMDA 7ODCA 2WC4A 4UFJA 5AYYA 2VEFA 2VHLA 4MFEA 5KVHA 4LC8A 3UERA 3WNKA 4NG3A 4HCLA 5E09A 1UASA 3E0WA 3U0HA 1UR0A 5HJYA 3DG6A 1R47A 3C3NA 1E5NA 5DY2A 1TMHA 5H8UA 2X2YA 2HS6A 2VEGA 3QSTA 4ZENA 3NOYA 4IMEA 3EB3A 1CI1A 1O95A 3HG4A 1K8ZA 3RPDA 4MMWA 3NNTA 4S3DA 3ZSSA 1AMYA 4C6JA 3PPFA 1EHNA 1RAKA 3MCOA 4D9PA 1GVRA 3I4KA 4JL1A 4LYPA 4AZCB 3L4WA 3UWZA 1CX9A 3MPGA 2KX9A 1UKPA 4AZ7A 3K46A 4AEEA 5JH2A 1M04A 1XKJA 1P7TB 4YTQA 3M41A 2GOKA 1N8FA 3REQA 2XVNA 2GWGA 3DERA 1FH8A 3SADA 3GRSA 2CBUA 5BRPA 2GYIA 2J4GA 3WNLA 2VR4A 1E43A 2YL9A 3H54A 4UTIA 1NP0A 3WDIA 1ZU8A 3AM9A 3W7GA 3M44A 4NJIA 3CWHA 3LBMA 1XLGA 3SQPA 1W31A 3UVIA 2W6RA 1DTNA 4HSOA 2I56A 4RW5A 4DIAA 2J7DA 4AWUA 1LT7A 5FOOA 3UD6A 3CV1A 1DVJA 1FCVA 2PDCA 3LLFA 1GQJA 1QW7A 1MEWA 3SM0A 3QFBA 3NDOA 3WBXA 4CNOA 4CNTA 2INFA 3GH4A 3CS2A 4O17A 9XIAA 1EA9C 3G1VA 1XRTA 4ZA0A 3G1AA 4A8RA 3VNKA 4JTSA 4HA0A 3THAA 3IWPA 4H04A 3PWAA 3UGVA 1XYAA 3F7JA 5PTDA 5HATA 1EBGA 3RM8A 3HFTA 2CLOA 4LGXA 4QE1A 4LEFA 2D22A 5MKGA 4XD5A 3UG5A 3RU8X 3CZLA 4GY7A 2E6YA 4CKQA 3NO5A 3V0TA 1KBIA 3BXWA 3LX9A 3EWZA 3LGEA 2FZNA 4X2PA 1U1HA 2AAMA 1YLVA 3BW2A 2DVTA 1F61A 2EBNA 3LPGA 4N9DA 3RYSA 1OCQA 1UROA 1TJRA 3VCNA 2QV5A 5C71A 1TV2A 1DEDA 2ZVIA 4JIEA 3OIXA 2V2CA 1G4TA 4PSPA 1A0EA 1KFBA 1JAKA 3T0AA 3W1UA 2HPIA 5REQB 5C55A 3B8DA 5M03A 3WQ5A 1EJXC 4HOZA 5CPMA 2G3JA 3GXIA 4INFA 2QULA 1Q2RA 1ZALA 1EXPA 4KFPA 1K6AA 3ES7A 3F4VA 3TAKA 3FK4A 4AF0B 1H49A 3EX2A 4ZO7A 2Z1KA 2IS7A 4OUEA 2B31A 4OV4A 4LBSA 3W2NA 4ROPA 1MW0A 3N9KA 3W73A 2UY3A 3YPIA 4GCAA 2HXTA 4FDCB 3WD1A 4H6RA 1PIFA 2VX6A 2YOCA 5I3DA 1WZMA 4PCFA 5HXMA 3W1NA 2PWDA 4HMCA 4M80A 5CCZA 4LCQA 4JTLA 4W9TA 2WCSA 2D3LA 1E9IA 1G6CA 4W84A 2NZLA 4I6VA 3GTHA 4RZ5A 3AS3A 3MZ2A 1PDZA 1PZ0A 3L0NA 2OEJA 3EA3A 4XK2A 1RP9A 1Z89A 3BARA 3ZJ6A 2EKGA 4JHMA 4XIMA 3AISA 2TRSA 1O7AA 5ABTA 3IV3A 4PZVA 4Z1DA 4LY4A 3CQKA 1MMFA 2FHCA 1JPKA 1WA3A 3E12A 2W4XA 4DRSA 2WOIA 3S2NA 1PE1A 3OODA 3BVJA 1SJAA 1TUFA 3L68A 1VLWA 3KVKA 4HNCA 4H4ZA 1H3GA 1X6UA 1XCFA 4X9SA 5FF0A 3QSRA 1NDYA 3EB2A 4JDRA 4OV9A 1K8XA 3VDAA 4AWTA 3LNPA 1OM0A 1HJVA 1LROA 5F4SA 1US3A 5LHEA 2RDWA 3IGUA 4ENLA 1Q5MA 3U7VA 1L8NA 1AW2A 4AC1X 1C90A 5FJTA 3BLIA 4YU1A 2ZXAA 1GG0A 2OXNA 3KXQA 1MSSA 2JFEX 3VU2A 2QJHA 1CCWB 3GRTA 4QLKA 4P7OA 5EMKA 3NYDA 3VGEA 3T09A 1QOXA 3QGAC 2QJMA 2I5GA 4GO9A 4UOQA 1NWRA 1PX8A 2J77A 4YN5A 2PLCA 1XISA 3THQA 4MNJA 4O1FA 3UU0A 1TG7A 3FXYA 2ZUVA 1J0KA 3QR1A 2ZOXA 3QZEA 1B31A 1TWWA 1MDRA 8XIMA 1V3JA 2A1YA 2Y8VA 4ZXOA 3MC5A 1OD8A 1J6PA 4R7JA 1DQXA 3ZOAA 1BVWA 2CZ5A 2EAWA 4HN8A 4HHMA 3TYBA 1A5KC 1NF7A 1YEYA 2OYKA 4OT7A 3CHFA 1CGVA 1Z41A 2XSAA 4PCSA 1ZGDA 3VC6A 5BWFA 4XZMX 4HZ6A 1DWIM 3SZ8A 2OMAA 3W87A 2J74A 1ECQA 4H7CA 2ONEA 2F2KA 1QPQA 4B9ZA 3VD9A 1PSCA 4O0QA 3I7SA 2Z1WA 3QW3A 1S2UA 4UZSA 1J0HA 4RL3A 3ID7A 4TXEA 3TZNA 3TROA 2I5QA 2PF0A 2QPSA 2XFFA 3BOLA 3BC9A 1UPMB 3PB2A 3EDKA 2AL2A 3L4TA 4LYQA 4AQLA 1FP8A 5C9RA 3W82A 4H6KA 1MXSA 3TWAA 1XSIA 3IUIA 4KF1A 1TMQA 1SJBA 3BAYA 2PWEA 4HHPA 2O0TA 2HXUA 4M5PA 3CASA 1KTBA 3TOYA 3MY9A 2EPHA 2NLYA 4H41A 1NWSA 3QR3A 2G4FA 1CLVA 5SWUA 2Y63A 2PGWA 5KITA 4IMGA 4UFMA 3A7UA 1IT7A 4YTUA 2WQPA 1BTMA 3CIVA 1KXVA 3LLXA 3TCEA 4DF1A 4PODA 1CWYA 1KNWA 3GU9A 4X3ZA 3MO4A 1XR2A 4KIRA 2CWNA 5FCZA 1FWCC 1EFZA 4GE8A 2XVPA 3AIBA 5CG0A 1WOBA 2PAJA 4QQUA 4A35A 2BY1A 1FWRA 5AYZA 3P60A 5HJXA 3GH7A 3EMCA 1PZ1A 1H11A 1M03A 4TVYA 1XIHA 3W2UA 3GVGA 4IL0A 4RW3A 2DW7A 3CBWA 4EM3A 1JPIA 3EWBX 3MYPA 4JFUA 3TTQA 1C92A 2BVYA 1XIJA 4F2BA 5K7JA 3EWYA 1CW2A 2WLYA 3OC4A 1L6WA 3PZOA 3E49A 4QJ1A 2XSXA 3MUIA 2WB5A 3C2FA 4JX6A 5A95A 4Y96A 1U1JA 3VXGA 5TF0A 5DANA 2IKHA 4R9XA 5EPDA 4KEUA 1G9HA 1GYMA 4F0KA 1A5SA 4HPNA 5HBFA 4MIMA 1TWSA 4HPJA 1UP2A 1SFLA 3TC7A 3CPUA 5HQMA 3S2LA 1GW9A 3ECQA 1UJPA 1ZJIA 1B9ZA 2QAEA 1RLDA 3BG5A 1F8IA 3IJ8A 3MUAA 4GI9A 4IJBA 1V02E 4KERA 3GM8A 2IPFA 2EO7A 3GX9A 1V08A 3CZJA 2ZADA 3MVTA 2C3DA 2QHAA 1S2WA 2O9TA 2CHRA 3WD4A 1KFCA 4L80A 4WY0F 2VI0A 3OZMA 1KKOA 3WF4A 1H6VA 2XYLA 3S2MA 2O9OA 4GACA 1KLZA 3UG4A 4LBUA 4NNCA 2F7FA 3IJQA 1C9DA 2C1HA 4GI4A 4FK9A 4CEXC 2F6UA 4JTUA 2H3DA 3IVSA 1K03A 2F9RA 2GGJA 2BMBA 3BCJA 4KRUA 2OQLA 1R5YA 2PC4A 1N62C 1B3XA 5CC6A 2VWTA 2R82A 3WCZA 3HM7A 2B7PA 2QVHA 1N55A 3QJAA 4KCTA 4RXGA 2PDGA 4J3XA 1E0TA 1IWBA 1UOZA 2VFFA 1EWEA 3S9YA 2GUYA 4L4LA 1NEYA 4JYEA 2UV8G 3FCPA 1IWAA 1H63A 2YLAA 1A47A 4NZ4A 3AC0A 3KRZA 5BU9A 1CEOA 1QI5A 3REQB 5G2IA 3WLMA 4TMCA 3BJTA 4O12A 4ZXLA 4ZMGA 5CBBA 4KEMA 1W32A 5JBFA 3T55A 4PB4A 1R7AA 3M16A 1X7FA 3M0LA 1VR6A 2WMKA 3ABXA 4AZBA 4XZBA 4Y7EA 1UR1A 1LF1A 3UZXA 3MT1A 1RCQA 1K7XA 3C5QA 3CEPA 3TN6A 5F2MA 4ML9A 1Y8BA 4M3PA 4NF7A 4Z2KA 4Z2IA 1WUFA 5A3HA 1G94A 3W7EA 1OFQA 3N2BA 1J2BA 3O07A 2BXYA 2OOGA 3AYTA 2EPLX 2A7PA 4CCZA 3MANA 3U8GA 3V0SA 1TPB1 2Q6ZA 3KX6A 1OFDA 2IKIA 3U2CA 3VX0A 1W2VA 4EXBA 1NAL1 2XTKA 1NELA 3JUGA 3SECA 1T8XA 3QF0A 3W7HA 3CUGA 3S9ZA 3HPFA 3UJFA 2J13A 5J8LA 1OIFA 2G50A 1SVDA 3F4NA 1E1CB 4EQRA 3PZGA 2YYTA 3BZGA 4HGXA 4N9BA 4N2YA 2QCNA 3T8LA 4YCPA 1ZDLA 1UZ1A 5GNYA 4BWLA 4RV8A 4AEOA 1TV8A 1LJYA 1XLJA 4N02A 4EPDC 4L5ZA 1GOXA 3DECA 4MZYA 3AS1A 4Q7BA 1VPYA 2ICSA 1SSDA 3SUWA 3EBVA 3LB8A 4ZO9A 5JXQA 3AALA 2YZ5A 1VGAA 5D9PA 3HIJA 4DO7A 4ML4A 2WVSA 4M24A 4MY9A 3W75A 4RUBA 5KMYA 4LAOA 2J27A 2H9AB 2YFNA 1SO6A 3PJTA 5IRPA 1I4NA 1K9EA 4GQBA 3TTYA 4F0HA 2NV1A 2WHKA 4NVTA 5FESA 3EDDA 1XYCA 5I03A 4UTHA 3NPVA 1AL7A 3CGDA 3SJ3A 2TODA 4BFAA 5A8QA 2D0HA 1MOKA 1VBJA 5D8WA 2CCRA 3WDHA 2PUZA 5AYXA 3WLPA 1ZMDA 1M3UA 2VC9A 1OWQA 4NZFA 3PZ9A 4C6QA 1EJTC 4DQWA 5HNNA 4NRSA 4NX5A 1W1B1 2Y88A 1XPGA 4HMNA 4HB7A 1U1UA 1KM4A 3UYIA 4H2HA 1N2VA 2ATSA 1GVIA 2GPTA 3NQ2A 1Z69A 1N7KA 1AZ1A 1BQGA 1ZS2A 4JL2A 4IIHA 4R3UA 3OVRA 4CCDA 5DF0A 1QMLA 4AHQA 3WQ8A 2PODA 1M6JA 4ZOAA 1NIUA 5C2GA 3VNJA 4JEJA 2ASHA 1JGIA 4NI3A 2YW4A 3GNXA 6ALDA 1DJNA 4QE5A 3UR2A 3M0XA 5AHNA 1QHOA 3WNOA 1C8VA 4YMZA 2I57A 4TVUA 1FDYA 5DT7A 1J10A 4E38A 5K3VA 3CTLA 1T96A 1TA3B 1XX1A 5EYWA 2DUZA 1HN1A 5FA5A 4RE3A 1XGDA 2ZZ3A 3GTXA 5CSUA 3KRSA 1R0MA 2PP1A 3WK1A 4JFVA 2QXWA 5AN7A 1YRRA 4I3GA 5ER0A 4M51A 4MDPA 4GKLA 3MHUA 4A3HA 1AD4A 3N9SA 2O7SA 4LXFA 4H4PA 3IIVA 3CL8A 3GYEA 4K3ZA 2OWWA 1PTAA 2FH6A 3L2MA 7REQB 4GH1A 6CGTA 4JQAA 4AVOA 2ISWA 3KCJA 3R11A 1UD4A 3WF1A 1D9EA 4LIIA 1XRVA 2XIMA 3CXOA 3KBSA 3RX4A 4UTUA 2NWRA 3RR4A 2WPFA 5K2ZA 2PDIA 2VCAA 1OFBA 1WNOA 4NIRA 3S3GA 4YS1A 3E38A 2VX4A 2HE5A 3EA2A 3NQFA 3HOJA 5CAKA 5I6SA 1V0MA 4GOAA 4US5A 1HO1A 4ZQOA 3TP4A 3MQTA 2C8NA 4OECA 4XBJA 3ATZA 1U30A 5FS7A 1EJSC 1SZFA 3UXKA 4DI8A 4H2CA 5CPSA 5EKYA 4EQXA 3WELA 3WUEA 3GXMA 1K70A 1VLIA 2NPXA 4RDWA 2WYSA 5RUBA 2TYSA 1FDZA 3HPSA 2WJFA 5D2XA 3A47A 3GFYA 3PUOA 4QR6A 2WNNA 1NF0A 2BVTA 3KVJA 3KL5A 2ZRUA 4YHGA 2WWDA 3IUHA 4PMJA 5JCIA 1P0KA 1LL6A 3EYPA 4NZJA 3O7UA 4Q8VA 1XI3A 2QAFA 1S2VA 2I14A 2ABAA 3WN6A 5M5DA 3SCVA 4KIEA 3W6MA 2CXGA 1WKEA 3RJXA 1TPDA 1ZCCA 4DWSA 3LCHA 2UWFA 3THDA 3AXMA 4HOWA 2NQ9A 2YPIA 2AL2B 3ZT5A 1E5JA 1YXYA 2WCAA 1KQZA 2DT0A 2PP3A 2JEQA 2Q09A 1XF0A 4CNSA 3LCIA 1ME9A 4FX7A 1EKOA 4AZCA 1XW8A 3T2QA 5I23A 2VR2A 1AL8A 3IVUA 2QCHA 2PDJA 1VFSA 5KTLA 3UPBA 3RCMA 4PRTA 4UXDA 2CHNA 3H4XA 1XICA 4ONVA 4ZE5A 9XIMA 4JTDA 4IQEA 3WUGA 1U2YA 4HNTA 3LI1A 3L7RA 1B54A 3DI0A 1C7TA 5A6TC 3JZEA 4H4IA 4UBPC 1QCWA 1XXXA 4DUXA 3URBA 1JAEA 1XH0A 4UB9A 1R2RA 2BODX 4HTYA 4OZOA 3CAQA 1OFRA 2DZWA 1C7SA 3PZVA 1BG4A 3BMVA 2X42A 3I7RA 1NY1A 5BRQA 4EWND 3H55A 1OK4A 3L67A 3T81A 2ZA3A 3T2PA 3V0UA 4PMNA 1E4NA 1WZKA 4A05A 1T6MA 5ABEA 3WJWA 2DPEA 4IIBA 3AICA 2E8ZA 3GQYA 1OC7A 1N5XA 3B8TA 3RU6A 4CQAA 3DUGA 4V2XA 4XBKA 4PYSA 1A49A 4H9VA 1BWKA 3IGSA 4K7ZA 1KBLA 3RF9A 5E6ZA 3DGHA 5LKYA 2OEMA 4S3FA 3AMZA 3WH6A 4JICA 4JOMA 3B3DA 2UZ9A 4J57A 2V6AA 3S4TA 7PTDA 2WOQA 2BY3A 3S9IA 3L5AA 3PFMA 3IAPA 3SSJA 2W55A 4Q8QA 3DJJA 1QI4A 4DXXA 1TUXA 2AAAA 5GQBA 3FX4A 5K4ZA 1O5QA 2JKEA 2ZX9A 3GIPA 1X6LA 4WDWA 1IXQA 1DWHM 2GVEA 2X41A 2NV2A 2WMGA 4EX4A 1Z32X 5HUPA 2ZXQA 2CZEA 3G8RA 5CSSA 3G2GA 1BF2A 1RHCA 3B9JB 3OZYA 3MP5A 4Q4OA 3W7DA 5H1WA 5D4YA 1MZHA 3UWQA 4WK9A 3W1MA 3TXZA 4GQRA 4XUGA 1YPXA 5D9MA 2HVNA 3AAMA 4PH6A 1E4IA 3BAIA 1P0DA 2R1PA 1UQYA 5KZ6A 3GC2A 1ZP4A 1WOAA 2VZUA 3DEQA 3BOXA 2WZIA 4KS0A 5FL0A 1GTEA 3D0CA 3DI1A 3HQPA 3V1PA 2NLIA 5AHMA 1P48A 4L9XA 4MYAA 1RCXB 2YX0A 4FMVA 4KRTA 2OQYA 5C0QA 2ZRWA 3O06A 3NQAA 3TE9A 3ITGA 5LIXX 4DAFA 4OOZA 1SQ7A 1GHRA 1B1YA 1WAWA 3N15A 3N3TA 1O4UA 4FI4A 1WO2A 3KTXA 3QN3A 4UCFA 1EP2A 3MBFA 4DUVA 2ZIDA 1PX3A 2Y5JA 5F4WA 2ZZ5A 4RKAA 3ATYA 3SCUA 3TA9A 3MB9A 4AD4A 1MVYA 1R3QA 9CGTA 3N2TA 2FB3A 1JPHA 5LA0A 1C9WA 1XCXA 3H4GA 3GBEA 5HMSA 3HGOA 2H6RA 5REQA 3TIMA 1E1EA 1SFSA 4MJZA 4CGTA 1M65A 1VD6A 1P1MA 3GUWA 4EQSA 1Q6EA 3UY8A 3FHQA 5FEPA 4U2YA 3CEUA 3AIEA 4IWWA 5I07A 4JQ2A 3MYOA 3NURA 3CTTA 4C1KA 4M7SA 2VO5A 4H4SA 1EP3A 3PG8A 4Q8NA 3N13A 1JRPA 4L7ZA 4O18A 3S1GA 2WCGA 3CAWA 4HVXA 3SCPA 1FWTA 4LUYA 1XLEA 1I9CB 2TSYA 3G6LA 1W3NA 1OYBA 4MTVA 3CGCA 4B5VA 1R3YA 3M9YA 4BWLC 3T8QA 4EAMA 5I2UA 2ISDA 1QNVA 1AQ0A 3MMUA 1JYWA 3TZFA 3LQGA 5AZ0A 4JX5A 1XFCA 1TTJA 2I7GA 3W25A 2HK1A 2VGIA 2VZOA 5CGQA 3OG3A 4LW7A 4MNMA 2J88A 3STEA 1IHIA 1RVGA 2YCEA 1JYVA 2FFIA 3OVPA 2Y0FA 5BMXA 2AMXA 2JIWA 1W0MA 2PD5A 4JTTA 3PG6A 1UR4A 4ROQA 3LU2A 3VKKA 2HZGA 1W5NA 1HJWA 4IOTA 3GR8A 2IPGA 1W3TA 2QJGA 4XO7A 2YJQA 2GLKA 4XG1A 3WJXA 2DZUA 2BGNE 4XTIA 2V81A 2X40A 3EOLA 2BXZA 3CHVA 4ACYA 4TU1A 3APYA 1G4EA 3TH6A 4KWSA 2IMRA 4FXSA 5C9WA 3W1PA 1PCWA 4N4QA 1DIOA 1Q4WA 3A64A 4DY1A 4QG9A 3LV5A 1BWLA 4PUKA 3EAUA 4Y2WA 3TMQA 1CGWA 3FJNA 4CLMA 1R38A 1LBLA 4UZUA 4B5UA 1XLFA 4KETA 4NX0A 4HU4A 3W7NA 2EHHA 1F3PA 3MDUA 1VIZA 3MSDA 1TYTA 1V6YA 3IV8A 3QPYA 3D3AA 4UQDA 3UNDA 2XIIA 1JJKA 2TPRA 1QPKA 1QO2A 2ZUUA 3IIZA 3CGEA 1PIGA 3TYZA 4B15A 3LTPA 5C2XA 1UIPA 3ZO9A 1MEIA 4L6DA 1HNYA 2WC7A 4GBUA 2F38A 2WLZA 3OLEA 3LHUA 4IMAA 1BXBA 1KN0A 1I75A 2NXHA 3PWIA 3GZ3A 3SR6B 3INPA 4LB4A 4Q6JA 3QGKC 1B4EA 1C3FA 1HKWA 1QWGA 3W81A 2A85A 5EMMA 1RALA 1LCOA 3BAJA 4D6GA 4C7DA 2FPTA 4MHBA 4XZIA 2FTWA 2PC8A 3KRUA 2DUXA 2X1TA 1NTHA 4ZGYA 4AFYA 2O55A 2PMQA 3PNUA 3O05A 1NVMA 1FO4A 3GFZA 5HMDA 1XJBA 2PLKA 3AIQA 1VQZA 1GRBA 5J5DA 4PBFA 4BF9A 4GVFA 1AH3A 3OHMB 4JTGA 1P0NA 2HVMA 5FACA 5G5IA 1R3SA 2QCEA 2DY3A 1DE5A 1GOWA 3L23A 3U4AA 4FX9A 4GI8A 1KFJA 1JG9A 4JNZA 5LNWA 4HA4A 1A80A 5U7SA 2Q8LA 3ITCA 3CIXA 4B4HA 3VKDA 4BR1A 4JCMA 5AC6A 4WGXA 1E40A 1M01A 1YXDA 1R2SA 2YXXA 3I68A 2Y4SA 4FZIA 3VMPA 3Q37A 4JCLA 3W29A 2TPSA 2QGHA 4BURA 1OGBA 2VL4A 4MB3A 5CPNA 4S38A 3Q58A 2X7WA 2OSYA 4FALA 4GQQA 4FNUA 4YVPA 3CC1A 8XIAA 1YTEA 1YXCA 3TYUA 1STZA 2CBVA 1BYCA 2PTDA 3G1RA 1UKQA 3NSXA 3WLKX 1X2GA 1OX5A 2Q01A 2PDHA 3GXFA 1FFQA 1DPMA 1SB3B 4LX4A 4E2VA 3PP7A 1DJGA 3W01A 4PUEA 3VOFA 2VQTA 2CDUA 5BRBA 2XIOA 3RCNA 4R53A 4OIFA 4LAZA 2Z2UA 3L8KA 2YVFA 3FAWA 2EJAA 1A5CA 1U22A 1HW6A 2WNQA 5M2FX 3MW7A 4OKDA 3UJ2A 1BSIA 4IIGA 3KTSA 1BPLB 1ZFJA 2Z24A 3TX9A 4JIIX 3LS9A 3CGBA 3A3HA 2FMNA 3ZLGA 4A2RA 2FZBA 3NDZA 4J3ZA 7CGTA 3P2VA 4LANA 1XP3A 2CEQA 4QNEA 5AC5A 1GOOA 2C14A 4P61A 2ZUSA 4W8BA 4NRRA 4CD8A 3AMKA 5JIPA 1CB7B 4FF7A 1YQZA 3GH5A 3EOOA 3RLVA 3SY5A 2XH7A 4QLJA 2HBXA 4RPPA 2R1MA 3VIKA 4TR9A 3VD5A 3WQ4A 2EG6A 4ORIA 1W9DM 1BGGA 6PTDA 3UWEA 2G3FA 3ZQ9A 2ZA1A 3HU7A 2WPCA 4B2DD 3W2JA 3M0KA 1ONFA 4ZB0A 5BOEA 2V3EA 2W92A 3WEOA 1RSCA 3KS6A 3TTEA 2E0PA 1TPC1 4AWSA 1UD6A 1DJIA 4PRRA 4H4RA 1OD0A 3LPFA 4TUFA 4RLIA 4LB3A 4ZB2A 3W02A 3GVQA 4M1RA 4D8LA 3LHWA 3UWVA 3H12A 3RO8A 4JQ4A 3K1DA 5DX7A 4S3AA 1FA2A 2DSZA 3DENA 4LAMA 4LAUA 3WLRA 4Z2GA 1W1TA 3SRHA 3OGVA 3N4AA 2VM8A 5T9CE 2CPUA 2F2HA 4DJFA 1V3KA 4X0VA 5K9CA 1RBLA 1FECA 1M53A 4CQ8A 2X0SA 3HN3A 1SW3A 1LRTA 2E6FA 4E0CA 4UTLA 2JKPA 4IPNB 2PF8A 2OO6A 1SR9A 2PS2A 2X1UA 2VFGA 2ZZ1A 3VZYA 1J0ZA 4I8YA 2P76A 5JCNA 1R6WA 3SCTA 4A3QA 4AD1A 1GQNA 2A79A 4H4VA 4IIDA 3RLUA 2V6OA 4YNGA 5FEXA 1YDOA 2JK2A 3M4HA 4K38A 1KGXA 4TX9A 1ADSA 1YKWA 1YDYA 2X1SA 1GORA 2E25A 4RZBA 4DELA 5E6YA 4FNPA 5FI8A 2W61A 3KLKA 4MWAE 4N6FA 4DVOA 4O1EA 2DZAA 1CB2A 4BCEA 2EKCA 3LZ5A 4FF5A 2VGGA 3M5YA 1MFVA 1DWJM 2GGIA 3SFWA 3V5FA 1ZB5A 1MUCA 2WQDA 2XZ9A 4EM4A 1CECA 1EJVC 3VKJA 4DF0A 4H7VA 4WRHA 2BY0A 2PDKA 5FS6A 3LLDA 5KZMA 2XFRA 4PTVA 1HVXA 3HMJG 4GUFA 4QHRA 1LWJA 4NUWA 1XLMA 2ALRA 4B3KA 4C5ZA 1GRHA 2FJUB 4F0LA 3V4BA 5HMEA 4UWMA 1WDDA 3LZ3A 2GVYA 4J7RA 3AXHA 1JCLA 1TE1A 3GNPA 1MO9A 3Q4DA 2W3SA 2GGGA 4M19A 4ZB5A 2DEPA 1AQHA 2V3FA 2BDQA 3AXKA 4NAEB 4O8RA 3IC9A 5EL1A 1Q6FA 1OF6A 1Q7QA 4NNBA 5D04C 1FWEC 2ZUTA 4YCOA 5T91A 3M6YA 4W5ZA 3QZAA 3GVRA 3FJLA 3NRZB 3C0JA 1T40A 3VYLA 1XH2A 4FPSA 3ZSTA 2CZDA 2WMIA 2P88A 1Q6QA 4E2OA 4HNVA 1DXEA 2H9AA 2GDUA 3AYSA 1SW7A 3KUMA 4TVWA 1PTDA 1LRQA 1AOGA 3NGJA 3L21A 1QK2A 2Q3RA 3HGSA 3OVQA 3UJRA 4MKNA 3S1VA 3LG3A 3K8LA 2WNZA 3FKKA 4KPLA 4UC5A 3CMFA 4KW2A 2BB0A 3H2MA 1FCUA 2CW6A 3G5EA 3LCLA 4NJKA 4PSRA 3VGHA 1OX4A 2GDQA 3W70A 2XH2A 4V15A 2XSBA 2E6AA 1V6VA 3E5BA 1H7NA 5D02A 2FTPA 3GW0A 1FHVA 4AWEA 4C65A 4K8EA 3NM1A 1LUCB 1HF6A 2X99A 3PVFA 4H9XA 4F0MA 1I0BA 4JGDA 1W1IE 5DBUA 5I7GA 2YB1A 3TU9A 2OQHA 2ZKMX 2F61A 4XD3A 1X38A 1XIDA 1EO5A 3W7CA 4EPBC 3C0QA 3H2CA 3HBLA 3GD3A 1KKRA 3D5HA 4JDBA 5AB3A 3IVTA 4JTIA 1CLKA 3AZSA 4FLRA 4NNAA 5CAHA 3NG3A 3WD2A 2E1WA 1OINA 4UMCA 4DPQA 1EOKA 1X2HA 3KWSA 3S5ZA 1QFEA 2DFAA 5CJ5A 1Q6RA 5JBEA 3WDJA 3CB8A 2R9ZA 1EIXA 1OK6A 3V3WA 4ICNA 2WBKA 4DB7A 3PPHA 1LOLA 1MNSA 2QPXA 1UZ4A 3NZGA 3EWUA 3GLCA 1TTPA 3FJ6A 4D2JA 2X05A 2Y85A 4M8UA 2VENA 2V63A 3NZQA 3OQ8A 4H9UA 1WXJA 2PDWA 2O56A 3ABZA 1X39A 1Q1RA 1W1A1 3BLPX 3GUGA 1V3HA 4Y90A 1H41A 3W7MA 2J7BA 3WD0A 3MSYA 5FF7A 1R3RA 2Z1SA 4W93A 4PTWA 3U4FA 3NPXA 3SURA 5A2AA 4BQ3A 3P8IA 4PUNA 4QDPA 1A5BA 2PA6A 3QM3A 3T40A 2YL8A 3SO7A 4HZMA 1HKMA 2WKGA 3RCYA 3PZNA 4G8TA 3EEZA 3K30A 3ITYA 3WIJA 1DQWA 1S2CA 2GJLA 3BAKA 2A3EA 3OO2A 4EF8A 2WVTA 4MB4A 4UTKA 1EXBA 1T5AA 5JH1A 2J25A 3K8KA 4HK5A 3CLWA 5T8GA 3G0XA 4GX9A 1MXGA 2VOTA 1KRMA 3BUVA 3GRIA 4N9CA 4J3UA 2ZWZA 5I06A 5JCMA 4U3CA 3EWCA 1HFBA 2FZ8A 1D3HA 4NASA 4PBEA 3W4RA 1XBXA 3AQUA 4F2UA 5FSDC 4ACZA 1N5WC 4P7QA 2C3CA 4JTQA 3KP0A 3VM7A 1H4PA 2V5KA 3F1QA 1Z48A 3W7IA 1J12A 3P62A 1JZ3A 4ZR8A 1IE7C 4X60A 3UZJA 4RNHA 2VTFA 1KM1A 3W84A 3MKCA 5AVNA 2GQAA 1OEPA 4JXCA 2DZTA 2AAQA 5I78A 1K8CA 3JVAA 2AMGA 3MVIA 4QE4A 3LM3A 4LS1A 3FYYA 2C13A 2FTYA 1AUSL 1W9XA 3MHFA 2WXDM 4EXQA 4M6UA 2O92A 2DVUA 1J18A 1KTCA 3QKZA 1VPQA 3ARXA 1RD6A 5E9XA 3II1A 1VCVA 4C6EA 1SGJA 1J5TA 1TVPA 2CBJA 2OTDA 3ITOA 3VDBA 1B90A 1QNOA 5CJNA 1TPEA 3LBOA 2R14A 4BF7A 1KXQA 4I8DA 3A7RA 3WQOA 5DN1A 3DFYA 2PPGA 4I9TA 3GNOA 3PTDA 3JW7A 1WE5A 3SUUA 1VFFA 1AJ0A 1EIBA 2Y1HA 1EO7A 4P8WA 4KESA 3DIPA 1H7WA 1OB0A 1ZX9A 1UWQA 3A3WA 3DHFA 4PULA 3LRMA 1XDMA 3PS7A 1UD8A 1F9CA 4NYYA 3XINA 5DXYA 3O6AA 2I16A 2BY2A 2IW0A 4D8AA 2D23A 5CH9A 2HPMA 1JCXA 3H22A 1YNPA 4EK7A 5K9DA 2PTYA 4MY8A 5A6MA 4DJFD 3I3DA 4S2CA 1Q3NA 1YDNA 3RLHA 2FB2A 4O8AA 3E6EA 2WANA 3FEMA 4HPGA 4GZEA 4GIRA 3A22A 4MWAC 2BV9A 3G0SA 1V6WA 3B9AA 2INZA 4M56A 3TJIA 2CLHA 2ZRYA 4NZ5A 4YWIA 2BHYA 1XIFA 1R87A 4GD0A 3FNDA 5FMHA 3N1AA 3AXIA 4DI9A 2V5LA 3NAVA 1OC5A 4W8AA 4NAFB 5CPLA 1CZ1A 1I2NA 2E4TA 2E9MA 4S3CA 1F6YA 3FAXA 3SCSA 2DSKA 1WB0A 1SW0A 1POJA 4POCA 3FA5A 1CNVA 2G0WA 2GSJA 3NS1B 4MWAA 5DQPA 3RRXA 1REQB 1DIDA 5J04A 1Y0EA 4XV0A 5G5HB 3L4YA 5FS8A 1V7YA 3AOFA 4MLJA 2B7QA 3N3MA 4K37A 4TV5A 4MZ8A 1H0GA 4ICMA 4ASTA 3AS0A 4WQ6A 1BXCA 1FWWA 4AMAA 2NX1A 3GU2A 3R43A 2XM1A 1VS1A 3QRHA 2XGIA 4UTWA 1KV8A 3UNTA 1ISWA 1ZNNA 4FHAA 1UWUA 3JR2A 3W72A 1D3GA 4FOUA 1EEPA 3AHXA 4IXHA 3N4EA 3PAOA 3TKFA 4Y8EA 3GAKA 4WJXA 5JUVA 3B4YA 1TE6A 4IX0A 1TJPA 4H4WA 3G1SA 2PDUA 3NIYA 1BWVA 3DG7A 4H1ZA 3A12A 4WX2A 1GTHA 4UR7A 4ZTXA 1XC4A 4IPLA 2E5AA 2J8GA 5FKYA 3QTPA 3RIKA 4QJ5B 4JS3A 3QFWA 4MY1A 3R2GA 5C9ZA 1GYLA 3T07A 1GVOA 4YYCA 3BLKA 1S1PA 1VBRA 2QCGA 2DT1A 2BG5A 3NA8A 1ISZA 2OLHA 3S6TA 1H5YA 2BVDA 1Q2SA 3L4XA 3N18A 4O53A 4P5UA 5A6SA 2HNHA 1UP0A 4MB1A 4C1NB 3CHEA 5FF3A 2GL5A 1L6FA 4C7GA 3WUBA 1BVZA 1KGWA 3SCQA 2D2HA 1D3CA 2VEPA 4TQTA 1LOSA 3GB6A 4HHHA 1GESA 4C6NA 4IF2A 1SMDA 2ISSA 1QT1A 2QGYA 3WFAA 3EOEA 2CIPA 4NQ1A 4XIAA 3B04A 2ZZBA 4QIUA 3QV7A 4LS0A 3ZR4A 3EWWA 1J6OA 1C91A 4HHLA 1QBBA 4AB4A 1B57A 2IPWA 1G1YA 1SZGA 2EJ1A 5HUOA 1DJXA 1OZQA 3K5XA 3IIPA 5H8MA 1UHVA 3TTOA 3GZAA 2XDFA 4AX7A 1FTXA 3EPNA 3F4CA 1TJ2A 3QY7A 1RXOB 3W28A 3EF6A 1XD1A 3TR2A 3RK8A 2NV9A 2PZNA 1QHZA 3W2LA 3GHRA 1CENA 4GA8A 1DJYA 4IISA 1JZ8A 1F6PA 1VJZA 1HKVA 1IGSA 3TWBA 4GXMA 1E70M 1V93A 1M7XA 3NSNA 1QHPA 3ANYA 4O1AA 4MLRA 4QS5A 1QNRA 4JY8A 3ZIZA 3DJGX 1K9TA 2RH9A 3FN9A 4DBEA 1HGYA 1AODA 2EXOA 5MF5A 3CK5A 1BSLA 2X2GA 4Y9NA 2QZRA 5I3HA 2ACRA 5LA1A 1EBHA 4JKMA 4KCUA 5TR3A 4B16A 1YE4A 1VZWA 2F8QA 1NOUA 2C19A 4O15A 3WL0A 1CXFA 4J3VA 3H7VA 3EWDA 4UTMA 4XZLX 1WP6A 4MGGA 1SZEA 3HG2A 4JTRA 3TJXA 1R3WA 3QPEA 4N6EA 1UA3A 4GABA 2V3GA 2PP0A 3L4ZA 3ARUA 1BEUA 5LSMA 2A3LA 2E6DA 5IBXC 4JIPA 3P0XA 3GXDA 3C4UA 3M6DA 3UXIA 1NARA 1GHSA 4RDZA 1UKSA 4H4QA 4PUUA 1JPDX 2KZHA 3VKCA 2GFTA 1LP6A 1V51A 3O6YX 1EF2A 4CEUC 3TLQA 2CZFA 3EANA 1U5JA 3LCGA 1Y5VA 1G5AA 3OB8A 1AFSA 1JROA 1ADDA 2HTMA 4IGHA 3ZYZA 4B3ZA 3M7WA 2FGZA 3CUXA 4I7VA 2V67A 4RZ6A 2DVXA 3E74A 3N2XA 4L6OA 1ZY9A 3NQ7A 1P6CA 4O13A 4H6QA 1E3XA 5C9UA 3HRDC 1BKHA 4S23A 2B4GA 1ENUA 1F3XA 2NQ5A 5HWNA 4ADSA 3HF3A 3EX3A 4LYKA 1Q1WA 1L2UA 4UMBA 3QEZA 1RPXA 1EGMA 2FZ9A 4I9AA 1YE6A 4GQGA 2WPBA 1R30A 2CKRA 4HT3A 3TQKA 3LXCA 5CSYA 2ZUNA 3TXVA 3BG3A 3VIHA 2Q02A 1UUQA 3WMSA 1QWKA 4G9PA 3CZGA 1NJJA 3MWAA 5LIUX 3O3RA 3APGA 2A21A 3L0KA 2YA0A 4G2DA 4O57A 2WZTA 3BICA 1AD1A 5D38A 2JK6A 2D2JA 1JNDA 2OLAA 3MSRA 4F2TA 1ME7A 3G77A 3CPGA 4K8HA 2EF9A 5LIYX 1CLXA 4ADWA 1VJSA 5I3IA 3HMCA 3O63A 3GK0A 1LM1A 3DYOA 3EKZA 2WMJA 4GI6A 2AL1A 1NWTA 1KCXA 1ZBKA 4GR1A 2VD9A 3AIVA 3C3UA 1GV4A 1BYBA 4GKTA 4IH3A 2FVMA 3VDCA 1LL7A 3AJ7A 3SGGA 4Q33A 2BOEX 4PUJA 3UP8A 3O6CA 1FH7A 3NUKA 3OJGA 4AHOA 3GKFA 4JNMA 1XGZA 3TNBA 1F4HA 1BQCA 4LUIA 2V68A 3CMGA 2YDQA 5FD0A 2VCBA 2DDXA 1QATA 1PX4A 2R24A 1TYPA 1GT8A 1FEAA 2WW5A 3D47A 3UFYA 5T9BG 2JF6A 3EPMA 4BV6A 1XGEA 3F2CA 2AOSA 1PVNA 3BG9A 2OG9A 3GTIA 1VKFA 4AMCA 3NVWB 2EPKX 1DJHA 4PFHA 3ZZ1A 1GERA 2CYGA 1ISXA 1HL9A 3G1XA 3W24A 4GC3A 1UUMA 3QMTA 4LY8A 3GNNA 4KRZA 4BKNA 2VD8A 3RX3A 1HJSA 1WXYA 3PJWA 2JBMA 5A2CA 2YBUA 1X1NA 4LYRA 3ZR6A 3GHSA 2YSWA 4E8GA 3WX7A 3MUXA 1K4HA 4KT2A 3TQVA 2PWUA 4DWSC 3SB0A 5B7ZA 5JQ9A 1H60A 3EOSA 2DH3A 2OWCA 3H21A 5DCDA 2W79A 4A3RA 4K1GA 4DN1A 5ABFA 3OBAA 4ZSTA 1P7TA 4TVDA 1LG2A 3OZOA 3S1WA 1IXNA 5JCKA 1YTDA 3LBCA 2E67A 1W1PA 3L4UA 4AAJA 1IXOA 1QW9A 2E3TA 4U31A 3NOEA 1FH9A 1S3TC 1JVNA 1QOPA 5AKQA 3VINA 3WLTA 4LF2A 3W71A 1GJPA 3UZWA 4JN8A 1ZCOA 3W0KA 1TPUA 3BWWA 2DZVA 2QCDA 3EMZA 4BEQA 1V3MA 1ESWA 3VMNA 3CH9A 3WLJA 4B5WA 4MVAA 4MPQA 5A6KA 4YWSA 2DIKA 5I5RA 2VOMA 4MOZA 3NQEA 3NQ8A 3RRAA 3W38A 3TYEA 1KA9F 1E9LA 3JU2A 4AD5A 3L2IA 1JDEA 1KO0A 3C8NA 3MKVA 5AFDA 2ZA2A 4Q7IA 3T78A 3VGBA 3QH2A 1QTWA 3CUHA 4DXKA 1GEHA 4QCFA 3FHAA 4C1LA 3KDOA 4IPPA 3BL3A 3SCOA 2WO5A 4DBWA 1MNZA 2J8TA 3DHPA 3LA4A 6REQB 3WQPA 4XZWA 2YYUA 5LGZA 1FOBA 2OU4A 3L5OA 5CZSA 4BI6A 3S83A 3HQ1A 4HYVA 1NFPA 4GZ7A 1I60A 4JIHA 1E6RA 3LCFA 3GBDA 2HROA 1W3LA 3LTSA 3QC3A 1NPXA 2C6QA 1FQ0A 1AW5A 5CPTA 3TC6A 3KCOA 4UOJA 3I7QA 4FIQA 3DYPA 4MWAB 1VF8A 5JU6A 1GRFA 2GRTA 3K13A 2ZDSA 5FS9A 3DESA 3BW3A 3BPWA 1UD2A 4DPPA 4GY1A 2HJPA 1GVEA 4TV6A 4K6AA 1RH9A 3S5YA 2HS8A 3AHVA 2CLLA 5K4XA 3RILA 2I5IA 3VTRA 1AK5A 4A2SA 1QPOA 4B5NA 4DWSB 3MMDA 3ENLA 2CU0A 3R7MA 3QQWA 3S8HA 4IX2A 1TJ0A 5CSRA 3SN1A 3WBEA 4DUWA 3NO1A 4ZBCA 1UG6A 4AW7A 4F3HA 3ME3A 2R1LA 1TVLA 1XQKA 1M7OA 1TTQA 3AROA 4QDWA 3VM5A 3W7OA 3QHOA 2PLMA 3QLLA 4Y6GA 4GK8A 2YKKA 3R5EA 2V82A 4JX4A 4AZHA 2MANA 5DXXA 5E9AA 1OBAA 4MWAD 4X61A 4UQBA 2ESCA 1XYBA 4ZFCA 3DG3A 3D6NA 1TJ1A 1TPFA 4NYUA 2PGEA 3XISA 2EPNA 4B5SA 2E5CA 3OYXA 1T41A 3SN0A 1W5PA 1NDVA 2WZEA 3N9RA 2V8ZA 2C1IA 2CESA 1VFUA 3P61A 1FHUA 1E6NA 2QCDB 3N73A 4WGHA 4WXZA 3PSWA 2V3AA 1KXHA 4BQ5A 1I1WA 4LTSA 1HG3A 4GNKB 2YLLA 4MF4A 3VIMA 3B8IA 1E9YB 4PMDA 2PFHA 2V5BA 3OTRA 1HX0A 2P8BA 1FDJA 6ENLA 1O94A 3IACA 4D6CA 1J5SA 2ZICA 4Y9OA 5JMUA 3B97A 3QW4B 4L1GA 5KSWA 2ZVRA 4EPEC 2J9ZA 1LT8A 3MBDA 3VNLA 5J5RA 2QYGA 5D33A 2OODA 3GD6A 4YVVA 5FJRA 4E4PA 4BI7A 6REQA 4XAFA 5LNSA 2ZCGA 4Q3MA 1A0DA 2ZZ7A 4WXYA 4D6IA 5LZLA 1N8IA 3PAJA 3ABSA 5G1YA 5D37A 5F2LA 2YR1A 4OOUA 3QY6A 2VFIA 1W3IA 3R6IA 1LLOA 4AVFA 3BOFA 5JCLA 1LWIA 1RQHA 1K77A 3LNMA 5EBUA 3W00A 4LUSB 1ZAIA 4NZ3A 3N6JA 3H8AA 2QUTA 1KBJA 2JEPA 4GQ0A 3MWCA 3TN4A 1R9ZA 1VFMA 2V2HA 2V3DA 4E2BA 4ERIA 3NJ3A 4HSNA 4BY3A 1F7BA 3LDVA 3LMYA 4LNCA 4WCJA 3T44A 4QX4A 3WMBA 1PHQA 1E6ZA 3FVDA 4FO4A 3M0MA 4OUIA 1FVPA 2J6VA 1MUWA 4IFKB 2PI6A 4NU7A 1XH1A 3A6OA 3FJ4A 1Z42A 1LOQA 3ABOA 2PWHA 1AQFA 1V79A 1B3WA 4K7VA 5I3KA 3E1F1 4G6CA 4IUGA 1AJ2A 2OVLA 1Y5WA 4NJHA 2XHYA 1HVQA 1EX5A 5M3WA 3P84A 4IXXA 1DYSA 2VC5A 4BZYA 1MRAA 4K8DA 3EDFA 4OHQA 4OTKA 1JRBA 1S5NA 3V16A 1CPUA 1F76A 3R07C 2QNEA 3PJXA 4J3SA 3L66A 4GISA 3I6TA 4OBTA 3E5PA 3PUGA 2BTMA 3F03K 4YL2A 3STPA 1EC8A 3N2CA 1WX0A 3VI2A 5HWJA 1DOSA 1RP8A 1KM0A 2YW3A 4G1NA 2GGEA 4E2DA 1OFPA 1TPWA 1XLKA 2PWGA 5HQLA 4G5DA 1TQXA 3MJMA 2G4JA 1Q63A 3TJLA 2C3ZA 3CV2A 1TA3A 3WNMA 1W1ZA 3AUJA 4GH3A 1VYSX 4MJ4A 4PUMA 3MA8A 2J6XA 5HWMA 3G1FA 3I6EA 4F9JA 3VX1A 3C2OA 4ACZB 3H2OA 2GR0A 3AIWA 2ACUA 4WEVX 3W1AA 3CZEA 3RDKA 2ZUWA 2FZMA 2XH4A 2Y70A 2WHLA 1R46A 1UW9A 3TONA 4Q8TA 2C0AA 4M29A 4L9YA 1W3KA 4AXKA 4B5TA 2X16A 4WLCA 3M43A 5F2GA 5AHFA 4D6JA 3M0VA 4UTWC 2DORA 4D6HA 3ITVA 3PG9A 1EQCA 5CJMA 1EH9A 2J9XA 1TZZA 1CXEA 3NCOA 1TWDA 3QGVA 3VIIA 4EOUA 3G24A 1O5KA 4M6VA 2PWFA 2VZVA 1MUMA 5U4NA 3BLEA 3A5FA 1GVQA 2ATMA 3POCA 4WZHA 8RUCA 3GR4A 4H3DA 1HIZA 2C79A 5GJNA 5T26A 3TN3A 1GVSA 4N42A 3B03A 3Q65A 1DV7A 3LRKA 3CYJA 3HG5A 5FJUA 3W83A 2PGRA 2XISA 1HXJA 1FWFC 4IL2A 4LRSA 4E3VA 3A4WA 1RZMA 3NEVA 7A3HA 3ALFA 3ERPA 3S2CA 4IPIA 1ITUA 5BMWA 1WZLA 1GYNA 5D09A 3A9IA 1M5WA 1JZ5A 3RPTA 1XLIA 5BROA 1UB3A 2NT1A 3PJUA 1X1OA 1W8GA 1GCYA 2YDSA 4Q4KA 4HQVA 2ZWYA 5TNVA 3L5LA 5D03A 2X50A 1I1XA 4EQWA 4HIBA 4IM4A 2PD9A 3BZJA 1A5LC 3SFKA 2CLMA 3STCA 5AHLA 3FYPA 2H8ZA 3R94A 3WF3A 3VIFA 1KRAC 1YX1A 1HP5A 3ALGA 1B2YA 4QROA 2HQAA 2CITA 5HOSA 1OFAA 2JGYA 2RDTA 4PBGA 1GKPA 3CPRA 2RFGA 4CD6A 1VFOA 1XSJA 2UY5A 5CQ1A 2PBGA 3E02A 3B8VA 1ODZA 3LHTA 5EU9A 4KQNA 3SR7A 4C6MA 2GJXB 3R1ZA 4HK6A 3WK2A 3TSMA 1TCDA 4EAYA 4A29A 2ZBTA 3RMEA 3R8GA 3GDRA 4X9YA 2QCMA 4F0RA 4C6FA 4UTTA 3TEVA 4GGHA 1R85A 2OR2A 4K68A 4JTAA 1EZ2A 3NVTA 2VFHA 5FAGA 3Q45A 2DH2A 1DORA 1MQRA 4H8NA 3HFYA 3BLOA 3NWRA 3OA3A 3A4JA 4P8VA 4XKMA 5HDRA 1H61A 3H6OA 4W4QA 4V33A 3PNZA 3GG8A 2QCCA 4ZSUA 3CT7A 1Q6LA 1CXLA 3HB9A 2CWXA 1JQXA 5KEZA 1YBQA 2NVCA 1FWSA 3FDGA 3NXFA 4AY8A 2RKXA 1A50A 1AH0A 1XHCA 1PAMA 2YFOA 1KCZA 2O4MA 3GD4A 1GWJA 1E0VA 4AH7A 5I77A 3IEBA 4A8NA 1R86A 1KCKA 1W1YA 5A6LA 1F74A 4PUDA 3IUDA 1GOKA 2TAAA 3BANA 4U2ZA 1X97A 3CM4A 2ZE0A 1MXDA 2QJJA 3S5SA 1SR0A 1O1ZA 4AYSA 1I2PA 1HJUA 1JRCA 4DM2A 4C7FA 1PZ2A 2NT0A 2WAGA 3LUTA 4YVXA 3O6DA 2ZX6A 3I4EA 1KRBC 2OWXA 2DJXA 3UWWA 4HP5A 2R94A 4ZE4A 4LCSA 4WD0A 5CG7A 3M5VA 4C6OA 3ZS4A 3WQGA 4F8XA 1H1YA 2NXGA 1SO3A 3RO6A 4PTMA 3SN4A 4HA1A 4TTUA 1GJWA 1UC5A 4JIRA 3SY8A 3VIGA 3W1XA 4R85A 4A8LA 4O10A 4E3TA 1GJUA 3W85A 4AZ5A 4DLMA 3MV11 3PZUA 5AC7A 1JYNA 3OG2A 4I5XA 3SQSA 2WVVB 2CLEA 1OSEA 3R0KA 1QUMA 7TIMA 4QP0A 4J9JA 4L65A 3CO8A 3LM7A 5DRCA 3NYZA 1I2OA 2P8CA 3PZQA 3TYDA 3GNRA 2EG7A 4ZVJA 3CAVA 5EMLA 3W7JA 3H4WA 4KH2A 2BXVA 4ATDA 4DJDA 1XG4A 2ZZCA 3EAOA 4HYRA 4IGNA 4OBRA 3SUVA 4JEQA 1KFWA 2A7RA 4JTJA 2A8XA 1CTNA 3S1UA 3FY1A 4FXJA 5AZ1A 1GXFA 1NHPA 1RJRA 1UMYA 5CC5A 3NZ1A 3QKEA 3P5ZA 5EY5A 4FIRA 5LIKX 2OGYA 1MW1A 3KBWA 4DJDC 3L5MA 3IPWA 3E0FA 5HNRA 4CD4A 4BJHA 5TQLA 4Z1YA 1OQFA 3P8JA 2Z6IA 4WKHA 3LB0A 1F2JA 2E5DA 3M0IA 1YIXA 1SYTA 3QV6A 3LPOA 3QMSA 5HANA 3R89A 3B40A 2YZRA 1GG1A 3BCFA 2ZDRA 1GEUA 4D6FA 3UY7A 2B0MA 2VZSA 4NHVA 3PBWA 2C18A 4PEKA 1EWDA 1YDVA 4PE8A 4TVCA 3V5OA 2XU2A 4IQDA 2CERA 4ECLA 1PYFA 4XZHA 1K3UA 4XX6A 3DZ1A 5C5YA 4F40A 3VFCA 4NILA 5JRBA 1JNEA 3OIHA 3IJDA 1KBKA 3GNDA 4GIEA 1GUVA 1H09A 4DBSA 3LOTA 4HMEA 3BQ6A 3CUFA 1W9BM 3WF2A 2A2IA 2Z6JA 2E68A 2ZZ4A 4PMVA 4QLLA 3P74A 1PKMA 3RPMA 2GVGA 2XGBA 3RJYA 5I02A 3G8EA 1A4LA 4Z1CA 3QHMA 3P81A 1JCYA 4AY1A 1U5VA 5H6HA 4J5NA 1H1NA 4HKPA 4DM1A 3ONBA 3ZXWA 1KQYA 2OZ3A 4G1KA 1X8FA 1TV3A 1EB3A 3T9PA 1R7OA 4QS6A 3WZ0E 3V1HA 4C91A 3ITXA 2RGLA 5DLCA 4W7UA 1GOMA 1OABA 1M7JA 1SMAA 4LC6A 2Z2BA 2W91A 4ZODA 4OU1A 1N61C 2PWVA 3K2GA 4Z42C 5LNUA 2Q8XA 1DHKA 1ZUAX 1PCKA 2XH0A 4UQCA 4NZ1A 4ERAA 1ODUA 1V0LA 1LDCA 4AXNA 3BGAA 1F07A 5F1UA 2GK1B 3AZTA 4UMAA 4X22A 1S5WA 3BGJA 1KB3A 3MU7A 1QBAA 1NQ6A 2Y6ZA 1K7FA 2VRKA 1VHCA 1XBYA 4J3WA 1O5RA 3CZKA 2L5HA 3KFTA 3S42A 1UZDA 3P67A 1GEQA 2B81A 2GVJA 2DZSA 5DFAA 5I79A 1OCJA 3UESA 5GVJA 3S5OA 5C54A 1XWYA 4C6IA 2B7OA 3U7BA 3E9AA 3D9XA 3CH0A 3UZ5A 4F9DA 3KBMA 4ZEPA 4J35A 4RK8A 4KCWA 1W9VA 5BCAA 4XD6A 2GVLA 3UG3A 3P0WA 3IJ7A 2ZTJA 3TJ4A 2ZUMA 1E6SM 5HR7A 1UWAA 4Z17A 1T99A 2WBAA 4Q4QA 2WSQA 2EPOA 4DJED 1PS9A 4FNSA 3LHZA 1VRDA 4KGJA 3KZSA 4HBKA 4J27A 2NQLA 4MFDA 1DJWA 2ODOA 2G41A 1HZYA 4OVXA 4LH8A 4J56A 4GUGA 3U2ZA 2NQHA 4IIEA 2D3NA 2FPVA 1RCOB 3PM6A 2DSUA 4AVNA 3ZLHA 4JN6A 3GWQA 1UQZA 3URQA 1OHLA 3KW3A 4JIQA 3AMLA 1DJQA 3N25A 4LVAA 5CPQA 2VEKA 1PWLA 1OX4B 2CETA 3RAOA 4YIWA 4GNVA 8A3HA 2HWGA 1VPXA 1Q13A 3ARYA 3MI3A 3B06A 4IT1A 1MO0A 4DJEC 3OU8A 2AGTA 1H7OA 2PDMA 3BE7A 1CT5A 3JZUA 3P3BA 3KP1A 4HPHA 1KM3A 3FXGA 1EF3A 1VBUA 2QQ6A 2VZTA 2Y89A 1EPVA 3GDLA 2ZXBA 2WVUA 1DIKA 4I6KA 5M1TA 1QR7A 1ITCA 2YCLB 2I1OA 1EJUC 3SI9A 2CZVA 1Q66A 3BSGA 3NQBA 2GR3A 2NUXA 1FCQA 1XCWA 1IYXA 1GVFA 2P5NA 2ZZ2A 2RDXA 4JTCA 1EEXA 1I45A 1S3HA 2Z1BA 1GONA 4PMUA 1Q6OA 4GUIA 4LUTB 1FKWA 4KWVA 3M47A 4KEZA 1DHPA 2E9LA 2FJKA 2PZ0A 1IXPA 1H2IA 3FA4A 1UZHA 4DEFA 3R4IA 1UD3A 1IF2A 1WCGA 3L65A 5G1TA 3TW6A 4AIEA 1FXPA 3BMXA 4LWWA 4YTRA 3B0YA 2PDQA 2X7VA 4IJRA 1SUXA 3GAYA 2X8GA 2J24A 2VDGA 3DC8A 3TTSA 1MWOA 3N4FA 5EMYA 5G2WA 4IPJA 2VUNA 3VABA 3KTCA 4PMOA 5HA7A 3T4WA 5CLTA 1XANA 4K2SA 1T8QA 1YQ2A 3FSTA 4JDYA 3O16A 4YLWA 1N60C 1HKIA 3DXIA 3WLSA 3QLDA 4MDOA 4GRSA 1J2WA 2GSHA 1EGZA 4O1BA 2G8ZA 3HPZA 3VIOA 1E51A 3A24A 1RA0A 5FIPA 3U9IA 4GVIA 5E5CA 4GJ1A 1VAHA 3AHTA 3FIGA 4LT9A 5G5GB 2J75A 3N34A 3A13A 2GQ9A 4DBDA 1H1ZA 2VC7A 2XGZA 5BWAA 2OFJA 1DWGM 3OLIA 4RX0A 5AC8A 4M6PA 4O16A 2OGJA 3VO0A 3PBGA 4P7NA 3OEXA 1JDAA 2QV4A 3N11A 3PC0A 3WQFA 4CQBA 1R9XA 1ZBWA 3TK7A 4Z2JA 1RUSA 2Z25A 4PB5A 4US6A 1VH7A 1NHRA 2DW6A 1ZZMA 1WBJA 2JIEA 2VXNA 3WQEA 3DDMA 4H9ZA 3URHA 3V18A 4LFYA 3EUB3 5D2YA 2BOFX 1HKKA 1ZBVA 4P8XA 4MSSA 5A6JA 4ZQNA 1WBHA 3VIPA 4V1XA 5FJOA 4S3JA 4B4FA 4LVBA 5AVHA 1K8YA 1UR2A 1L9WA 4OBSA 1JEHA 3BQ5A 1KBBA 4JQ1A 5BXRA 1EOMA 1WKYA 4B3LA 1JULA 3SRFA 4GY0A 1QASA 1UR8A 5I3GA 4RR4A 5E0KA 1VEPA 3UWYA 4WDTA 4LAKA 2ABBA 4J4KA 1TR9A 1DTUA 1BRLA 3NQCA 4WY0B 3WLQA 4QM1A 1QDSA 1MRQA 2VQUA 4YYFA 3TUUA 3BLFA 5BXSA 4U5IA 1VBHA 4H4XA 1UKTA 2E09A 3NO3A 4FNQA 4E6MA 1J9YA 4KGLA 4R27A 3CU2A 2BZNA 1F3EA 3DU0A 1DWFM 2WSPA 3W22A 3PBYA 3P80A 4WKAA 2VC6A 2ADAA 1EGVA 5TIMA 1DE6A 2ZTKA 4M81A 1IR2A 1CXHA 1OY0A 4R33A 3G6MA 2QVNA 3F4DA 3VCCA 2GUBA 2D1ZA 1VQTA 1JI2A 2RABA 1PKYA 1UC4A 1VBGA 1WV2A 3L0GA 3WJZA 4XZNX 5A94A 4PCNA 4FP1A 1PHWA 4QAWA 3BV4A 4K7YA 3BLDA 3NQVA 3AS2A 3QMRA 4XUYA 3MZNA 4NJGA 4LA1A 1W5MA 1DNCA 2NQZA 1JDDA 2FVKA 4HNUA 2E8YA 1TV7A 5FL1A 4LF1A 3WK0A 3W88A 3W1LA 4OFCA 3HG3A 4Q7NA 3PR2A 1XPYA 1JCMP 3PZTA 3GTNA 4GYJA 1GZ1A 1WKDA 4LUSA 2HQMA 3VKAA 1OX6A 1VENA 2J7EA 3KLLA 4C6BA 4DBUA 2RHGA 1IT0A 1H0IA 1WDSA 3APTA 5GJPA 4N4PA 3SUSA 1J01A 2QJIA 4Y9AA 3TNOA 4ADUA 4WUIA 5KVIA 4S2BA 2R1KA 1J4EA 3CHCA 5KINA 1LL4A 3VCRA 1XHGA 2Y7FA 5AOUA 3D3FA 3HPXA 1EUNA 4D8ZA 4EIVA 1ML1A 4IFKA 1GPWA 3LD5A 2X8RA 1QNSA 1ZTVA 3DH9A 2V9DA 1B9BA 1DIEA 1PJ9A 1B3YA 2XIBA 1C8QA 5FJJA 1N8WA 4G7FA 3IK2A 5A69A 2FGLA 2Y8UA 3OQEA 4JBRA 2QMKA 4AD3A 2QJNA 1G7UA 3N17A 1TX2A 3G3DA 1ONEA 2OELA 1ZJAA 2VKZG 3STGA 2V38A 3C2YA 3NZRA 3ARRA 4Q4MA 3VDHA 4CN4A 3RR1A 4JAWA 1OT1A 8CGTA 5EGRA 4ZOEA 1WAUA 1XM3A 4N7QA 3HPAA 4DZAA 4H4TA 2BGQA 5AY7A 2ACQA 4IGMA 1IEQA 3NQGA 4QFUA 1P0EA 4LVGA 4X63A 3VNYA 3COTA 1E0UA 4L4OA 4H8VA 5EB8A 4GHRA 4CN6A 5IXEA 3RITA 2YL5A 1OYAA 3UXAA 4CN1A 3ETRB 1R2TA 4GLEA 3HJEA 1BD0A 1MZRA 4IGSA 1XRSA 2FVLA 2Z1VA 1JOAA 3TCSA 3V35A 1XLLA 4LBRA 2XVKA 2R6OA 4WVXA 3EB4A 2J3NA 3PBUA 3L12A 5BOFA 1B4KA 4CD5A 4MG4A 1X7IA 1OG0A 5LNRA 4RV3A 2FDSA 3AYVA 1QNQA 2XIJA 3NVVB 1LWHA 1RPKA 3RFAA 2HISA 4K36A 4AIUA 1BTCA 2BVWA 1GPFA 4F0SA 1H62A 2J8FA 2OYMA 5IHSA 1WUEA 4GXWA 3B0VC 4JD4A 6XIAA 2GJXA 1QAPA 4HNLA 5D32A 5A6BA 4TX8A 2W63A 3VGDA 2YCJA 5IHRA 4J40A 1QK0A 1OZMA 4LCRA 3WDPP 4F79A 3M5ZA 2W66A 1JF5A 3VZXA 1E6PA 3PZIA 4IP7A 2REQA 2HBVA 1A3WA 4ORMA 2GJPA 1J0IA 3UXDA 3MMWA 1VB9A 2PU0A 4C6DA 5CZ0A 2YQUA 4GMEA 2HDJA 1NU5A 1AVAA 1M41A 4LOCA 3CXBA 4Z2HA 3O9NA 4JZ5A 3BCDA 3G1DA 4ATWA 1T0OA 5BNKA 3QZ6A 2VVSA 3SCNA 4K1WA 1W91A 5C8BB 4DYEA 1FWHC 4IG2A 3RM9A 3LHVA 1VCFA 1YHTA 3TFXA 1V77A 1SO4A 4I9JA 4KFNA 3G0UA 2OZ8A 1IIHA 3AWOA 2GJNA 2VYOA 4AYGA 3CUIA 4DX3A 1Y5XA 3GHTA 4EPKA 2DZXA 4MJ2A 1ADOA 1P1XA 4DZ5A 4PCPA 3SSZA 2MNRA 3KOXA 4J2PA 1W3HA 3TC3A 2ZXDA 3NFUA 2RJGA 3WNPA 3SQLA 2EQDA 2VEMA 2X8HA 1TSIA 4PMRA 2OB3A 3E2QA 4JR5A 3A5VA 3GW3A 1UWRA 1YNQA 2ZRVA 4RCXA 5D9NA 1E9ZB 2OCZA 2ZFAA 4IFRA 1UJQA 4EMWA 5ECUA 3VVGA 3UWUA 3GC5A 3WBAA 3UR7A 2YXGA 5DBTA 3B9OA 2PCEA 3AZRA 4H83A 1TFVA 3LERA 4GYFA 1J79A 3KBNA 1BYDA 3LXAA 4DJFC 4YPJA 3T2OA 2PTXA 2C7FA 3VC5A 3HURA 3ARSA 3TFCA 3SRKA 3LK6A 4Q8MA 2DT2A 4GNJA 1UD5A 2XUCA 4AHPA 3A21A 6XIMA 2BCPA 4R88A 3T0TA 2QDHA 3P6LA 3T0BA 3WLHA 2RDUA 3DGRA 4O50A 1F8WA 5A6BD 1DP0A 3ANVA 3AMGA 1EUAA 2QDDA 6TIMA 5DMNA 4A22A 3W76A 1T3QC 4NXKA 4NEVA 2NVAA 4JPGA 1YPIA 2AQWA 4PMZA 4E8DA 5EA9A 4B9YA 5BW6A 3O8AA 4B92A 1XYMA 3JRKA 1TRDA 3QOMA 1PKLA 3QYSA 3VNIA 1OJTA 3EDEA 1S1RA 2CFFA 3FA3A 4XISA 1ISVA 4PMYA 2QUUA 2FPYA 4RZ4A 4W7WA 5F7UA 1ICSA 2O4QA 2CC0A 5I0DA 3D46A 3DX5A 5DY3A 3EDJA 1JPMA 2ZC1A 3K1GA 4IP4A 4PMQA 1FWJC 3LCWA 4XO6A 2LLEA 4O4WA 4DO4A 3GHUA 1ECEA 2J7FA 4U4MA 3GXNA 2YDRA 1RK6A 3DFHA 5BOOA 3OZPA 3EXSA 3P14A 3SIZA 3GG0A 1WYGA 2PU1A 3IJ6A 3PTKA 1KRCC 3MS8A 2EQ9A 4HA3A 3A3XA 2VP8A 1AMKA 1XL9A 2ZX8A 1PXGA 3KHDA 1LQ0A 3U57A 3T4CA 2I9UA 2D73A 1BGAA 4WIWA 5HQEA 1WQ5A 2NVDA 3K4AA 2KAUC 1Q45A 3G1HA 3TSBA 4H4YA 4P7LA 1XRFA 2EEXA 4H7ZA 1J93A 5FEWA 5IM51 4H01A 2CFYA 2A3HA 2IXUA 4DYKA 2YXOA 1E4MM 2W3ZA 4NY2A 3WF0A 3NEHA 3BTNA 5FF2A 3IARA 1LUCA 1KV5A 2UY2A 1UBSA 1GNXA 2AQVA 3ZVHB 1SFTA 1LZOA 2V69A 2GQ8A 4GG9A 1HT6A 1IZJA 1H5VA 6TAAA 4WHBA 5A8MA 4M7TA 3HA1A 2XIQA 3N29A 4TX6A 5ABFB 4GXPA 1X98A 1QU4A 2NX9A 3QHNA 3ARVA 3H53A 1P6WA 1QPNA 1BRLB 1F4AA 1F3TA 4ZQRA 4GFSA 1A5MC 3VOIA 5E0CA 1DQUA 3BLLA 3C0SA 4FR1A 1VYRA 3IIOA 1TWZA 1Q8JA 3VGGA 9RUBA 1FWNA 2GZXA 2OYLA 2Y24A 4MZ1A 3UVAA 2DUAA 3GXPA 3KOFA 1DL3A 2P0IA 2DIJA 4QTGA 4LVFA 2BC0A 1E71M 4L1WA 1VC4A 1TIWA 1I2RA 3ZT7A 3HV9A 3THUA 4A6GA 4RDVA 1YADA 3AUOA 5CZTA 3QC0A 1Z44A 2BP1A 1VFTA 3KBJA 4PN2A 1FEBA 4DNHA 3I6RA 1R3VA 4NL1A 1KR0A 4HK7A 4AISA 5AC4A 2NVKX 3I3EA 1IV8A 1LLZA 4D1JA 2YCKX 4UNLA 3B9EA 5KETA 1GW1A 2HV5A 3OYZA 1B5TA 1E1FA 3UCCA 3TQ0A 3GKAA 1TWIA 2JE8A 2VGFA 3HZ3A 1ZMCA 2W67A 2HE8A 4HTBA 1EJ7L 3WQ6A 3LHYA 3OPSA 1XLCA 1UMLA 1V6UA 3M5XA 4XSMA 1GREA 5DRIA 1Q7MA 3H2NA 3KE0A 4AIOA 2ZC8A 3CQHA 1ZENA 3WBYA 3CV7A 4J3TA 1OGGA 3VIJA 3B4UA 4MADA 1W54A 4IFOA 4GIAA 5H2ZA 3MP3A 3DYMA 3W1RA 4JKLA 4Y9MA 2V5CA 4JTEA 2E3ZA 3DK9A 3DGBA 3C6CA 3M0ZA 2VUYA 1TRIA 1XYLA 1SO5A 3CLMA 1RR2A 1CXKA 2QAPA 2FH8A 4FR6A 2SFPA 3TQPA 1I2QA 4JTFA 2QR6A 3WYZA 3KOWA 2VGBA 5CC7A 2NX3A 3IRDA 1US0A 3GDTA 3K8MA 3BJFA 3BV7A 1HTIA 2X30A 1PIIA 1SU5A 2D0GA 5JBDA 1C8XA 2Y7GA 3C86A 2HNEA 4EKJA 2OSWA 2RAGA 1TMLA 2CHOA 4APNA 4PTNA 3UR5A 1J96A 3O0KA 4UTJA 1GVYA 3PUDA 4U10A 1E0WA 3WUFA 1KLYA 4A3YA 3BAWA 2VRJA 1P4CA 1H50A 4Q4SA 2F6XA 4UQEA 3F5LA 4DZIA 2OOFA 1UWIA 1G01A 5HR6A 3ZVHA 2CNCA 1CIUA 4ZOCA 3ARZA 3AU2A 3S47A 2J7HA 2JKAA 1J8VA 1FFRA 4PC8A 4H8HA 4CQDA 2ISFA 2PEVA 3URAA 4JYFA 1OADA 2OEKA 3E96A 2FQIA 4AEFA 3E2RA 5U1OA 1E3ZA 2QT3A 3NTYA 4UFIA 2A3BA 1XLHA 1EC9A 5EFFA 3EEGA 4QDMA 2CKSA 1TKKA 3WEZA 2YBVA 2BS9A 3GR7A 4H9TA 2Y7EA 3F2DA 3EX6A 1LPFA 3UCDA 1NH6A 2WOWA 4U3AA 5LNVA 4JKKA 3QPZA 1KM5A 1S2TA 4PUWA 3FOKA 1ZAJA 5A2BA 3DFOA 4DLFA 1S2AA 2XN1A 4MKSA 4UOZA 4QXIA 4LV4A 2WP5A 3OW1A 3RMJA 5F4XA 2P50A 1CXIA 1HL8A 1EPXA 4J1OA 2VDIA 3OVGA 1G4PA 1OCBA 3DN5A 1KGUA 1F5ZA 2QDGA 1GQIA 1JGMA 3SEPA 4PR4A 3B9DA 2YCIX 2DT3A 4R7OA 3F5JA 2AKZA 4ZTYA 3R0DA 2DIEA 1DKWA 2BFGA 3FYOA 4CU8A 2CLFA 1XLDA 2PTZA 2QIIA 4X0NA 4CU7A 4WOQA 1GQKA 4OQVA 1YNYA 3HGJA 4BK9A 3TR9A 3EKGA 3G1YA 1BVNP 1ELSA 3G3MA 3U5UA 4DYJA 2ON3A 3H23A 1EJWC 2IQDA 4CNUA 3PHAA 4WJEA 1CGYA 4NAFA 3T42A 4L1XA 3KVMA 2QEZA 5LXEA 3SCWA 4LVDA 2GSEA 4PCTA 3C0LA 3DAQA 4QSFA 5KZEA 2PDBA 3AYRA 1PO9A 1REQA 1ZJHA 1CGUA 4DAIA 4R9OA 5GRTA 2NUYA 4GYPA 3ZM8A 4JFSA 4ADTA 3LV6A 3PUEA 5ECVA 3EMQA 2DJLA 1JCJA 3ABRA 3NL2A 1F3WA 3DBPA 3CAKA 1K9DA 3EOUA 4L6HA 1JUKA 5BYWA 4XVEA 5I3FA 1MW2A 4EWJA 5DELA 3W7LA 3IGXA 5CXPA 3QQ1A 1HP4A 1C8YA 1UBPC 1WDQA 3KOZA 1ICPA 4Q8PA 3U6WA 3SGUA 4FNTA 4KFOA 1GK8A 1R8LA 3B8SA 3VNDA 3H2EA 3P5YA 4AG0A 1Z9AA 2J7CA 2XVGA 2CBIA 4QQ3A 4J2MA 1POKA 3EGJA 2Y2WA 2INEA 2YL6A 3GDBA 3T05A 2BLEA 5K9XA 3UJSA 2WZHA