1KD1R

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2001-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1kd1R00
1KD1R 1VQ5Q 3CC7Q 1VQNQ 1VQ8Q 1VQOQ 1K73R 1YI2Q 3G71Q 3CCSQ 1JJ2P 1KC8R 1VQ4Q 1VQMQ 3CMEQ 3CCJQ 3CC2Q 1VQ7Q 3CD6Q 3CMAQ 3CPWP 1Q7YR 3CCMQ 2QEXQ 1QVGP 2OTLQ 3CCEQ 1Q86R 1N8RR 1Q81R 2OTJQ 3CXCP 3CCLQ 3CCRQ 1M1KR 1K8AR 1S72Q 1KQSP 1Q82R 1VQLQ 1M90R 3G6EQ 1NJIR 3CC4Q 3CCVQ 3OW2P 2QA4Q 1YIJQ 1VQ9Q 3I55Q 1VQ6Q 1K9MR 3I56Q 1YITQ 1YJWQ 1YJ9Q 1YHQQ 1QVFP 3G4SQ 1VQKQ 1VQPQ 1YJNQ 1W2BP 3CCQQ 3CCUQ
chains in the Genus database with same CATH superfamily
3OYBA 1WXUA 1K73R 2DD4A 1RAIB 2LP5A 1K8AU 2ZPGB 4LDWA 4C8QA 5EC7A 3HFNA 1KQ2A 2DYIA 1E6HA 4UC4A 2F2WA 2GFAA 4BB7A 3OYHA 4OB3B 3TREA 4FT4A 1KHCA 4C8QC 1MMAA 4KRTA 4JUVA 1GCQA 3R6NA 2BZ8A 4BACA 1G3YA 3E1SA 2ZPHB 1JJ2P 1NEBA 4OMMA 2DM1A 1KQSS 2CS7A 2QQRA 3REBB 3V7RA 1G3TA 2KT8A 2AK5A 4HCBA 3JCMX 4J9BA 1ZQ1A 2V26A 2RNAA 4O6JA 3QIIA 3FIFA 3DLLA 2RJCA 3CXCA 1I8FA 3FJPA 1UG1A 4ZTFA 4ME7A 5LJ3j 3HL8A 1CKBA 1LJOA 2YDLA 3I5SA 4QKUA 4J6WA 3CCVA 2K9GA 2O88A 3VRZA 4JRPA 3GF5A 4EMKC 1G83A 4J6YA 3LGFA 1BYMA 4JRKA 1PD1A 4M7DE 3R6OA 5CAIA 1Q81R 1VOMA 2EWNA 3OYYA 1AWJA 8ATCB 3CCJT 1EFNA 3CC2T 4E7KA 1K0XA 2VGMA 1WXTA 2ZCFB 1HJDA 4Q5WA 1VYVA 3QZ5B 4RTWA 2HEQA 1GL5A 1ZSZA 2DYBA 3GIBA 2W0ZA 1Q7YR 2LC4A 5GAN5 2HZYA 4MDXA 3V8JA 2JM9A 4NL3A 4ELYC 4M7DB 4IKFA 1VYUA 2YUOA 2X4YA 3E9FA 5GAN2 2X9HA 2VVKA 4ZN1A 1Y07A 2D6FA 4LUDA 2DEUA 2JMAA 2CP6A 5FU7B 1JBMA 2JTMA 3QG1A 1QCFA 1NYFA 3HFOA 4PNOA 1WQ7A 2DL7A 4WTOB 4HA8A 1U8RA 1UFFA 2KNBB 3CCQT 2OI3A 4XTVA 2V8KA 1Y96B 2I2LA 1OPKA 2RK1A 2QQBA 3UDCA 1FMVA 3A98A 1KQ1A 3PE0A 1IREB 4C92A 1X2QA 3GP8A 3FJ5A 2EKOA 4CC4B 2CDTA 2RI2A 3CPFA 1VQ9A 4RTYA 2RK2A 3ZEHA 3CCJQ 3CC2Q 4BE0A 1YNZA 4JJCA 2B86A 1YIJT 3CXCS 1OYXA 2DZ9A 4X9CA 1W4SA 5KH6A 4A54A 3SD4A 4MMKA 1KC8R 4EIKA 1MV0B 3J80E 3RKWA 1C0MA 2QQ9A 4PJLA 1H641 1FMWA 3JCMd 3PNWC 4OMOA 1R8OB 1YJ9A 4V2SA 4F14A 2DTIA 2E3HA 1N9SA 5GAOl 3DLMA 3I35A 4PJMA 4M7AG 5A0LA 1M90R 2RA2A 3A8LB 4F17A 1IHVA 2RJDA 2L3QA 1SKUB 3CCQQ 4JPBW 4M78E 1YCSB 1VQ5Q 2E10A 2K5IA 2M9UA 2QG9B 4OF1A 2FPFA 1XJWB 4C0GA 3JB9D 5KCHA 3C4SA 3UPUA 2CUBA 2EW3A 1WYXA 4Z8AA 3LGLA 1GCPA 4M78C 5I2MA 5L8RE 4M7DF 1KG1A 3TSZA 1WGSA 4M77C 1KD1R 5GMKj 3HSBA 1D0XA 1VQOT 1KSWA 3EG2A 3NGPA 3Q1JA 2NLUA 4HCZA 3D7SB 4JRIA 2D0NA 3T9NA 1TWBA 1G8XA 2CH4A 4OMPA 2LZ6B 1IB8A 4FYXB 1FWZA 1D1CA 1B07A 1JXOA 1IHWA 4M77E 1GRIA 4JJDA 4BI3A 4PJOD 2L3RA 2Y4XA 4WCIA 2P0PA 5KYUB 5GAMg 3OBYA 1DJ7B 3OYJA 1MHNA 5IHNA 1WIEA 2F1LA 3X20B 5KYYA 2VWFA 1VQ9Q 2CYZB 2VKNA 1D3BB 2XIDA 3OW2A 3CMAA 2PTKA 2DFUA 1I4K1 5GAMe 4KT0E 4GLKA 1KC8C 2YUNA 3VU3C 4A4GA 5ECAA 2DKGA 3H0IA 4A4KA 2RPNA 4HT9A 1Y0MA 3DB4A 4O5VA 3X28B 1H92A 5L23A 1M90U 2KYMA 3RNJA 2KK4A 3EFSA 4NOYA 1PRLC 1WZOA 1B3QA 3M56A 5FROA 2YLCA 2FB7A 5GAN4 2Z0WA 2K5LA 4X9DA 4AT1B 2RQWA 1TSFA 2QGFB 4X34A 1JO8A 2EJFA 1WHHA 3VUZA 3A5ZB 4BDZA 2DRMA 4J6XA 4C8QG 2AZVA 3G6EQ 5GANf 4XU1A 1TG0A 2LTOA 2RB6A 4XTXA 4LDXA 1UB4A 3M53A 3MP6A 3OSSC 1QVGS 5DLOA 4PJOF 1NPRA 1M8MA 2H8HA 1YITA 2J6KA 4XU0A 1M2VA 3OS0A 2KEAA 2YRVA 4L6V5 2FRYA 4QT7A 4IUTA 1RLQC 4FW2A 3LH0A 2ZPFB 5CKDA 1VQLT 3INZA 2JW4A 1PSEA 2O2OA 3EG9B 3CCMA 1TS9A 1RABB 3G4SQ 1AT1B 3SWNA 4QQ6A 3FC3A 2FVUA 3KUFA 3QZ9B 2DK3A 2LQNA 3GNGA 4FCYA 4JZ4A 2RI3A 2ROLA 2HL3A 3CCLT 2QYZA 3QJ6A 2XDPA 2RJFA 7AT1B 1QKWA 4XTYA 3WVEB 2RQVA 1K73C 5EG2A 1W6XA 2EYWA 2K2MA 4J9EA 5IT9E 4BI8B 3HPWA 3JSCA 2EQUA 2OAUA 3ME9A 2CREA 2DAQA 3RKYA 1QLYA 3MJXA 3KXTA 1H3ZA 3JCMP 2FHDA 1I07A 4KBMB 1YJWQ 5GJWB 2E64A 3ZBDA 2YWWA 3RBBB 2RI5A 4Y28E 1RAGB 2DPPB 3OYCA 1X27A 5GANj 2LCLA 3PIPA 1M1GA 3QYGB 3ZFJA 2IG0A 1YI2A 1NBEB 1TUGB 3CC4T 1NJIR 3QPHA 3L2QA 2KQWA 2L3PA 2NUTA 2F5TX 2RHYA 4J9IA 4PJNA 3VV0A 2R58A 2LCCA 2YRDA 1RUWA 2CZ1B 1IZ6A 4IUVA 3TQ7P 1K4US 4IUQA 2CZ6B 4A4FA 3GBQA 1OZ2A 1SSHA 5CQXA 3VRYA 4XU2A 3I56T 2DERA 2KE9A 1YITQ 2YUPA 1M3CA 2MWOA 3META 1ZHIA 3HRUA 5AYFA 1AWWA 1NZ9A 2FEIA 3RERA 3M58A 1NE8A 4PJOG 4XK8E 4M77A 4HVWA 3CBPA 1PM3A 2KVQG 5KYWA 2CGHA 5LJ3g 1YJWT 4Z88A 3CCMQ 2OTLQ 3OY9A 1SHFA 1UECA 1VQ8T 1ZSZB 1PSFA 3G71A 1VIFA 5KYXA 1X01A 1NYGA 4Y91A 1K9MU 2QTXA 1WPYA 3QXEB 4OGEA 4IIMA 2DTHA 1RAFB 3CPWA 5LJ5d 3QJYA 1VQLA 5FWBA 4ANJA 3V8KA 3QDRB 4FSXA 4QW2A 4KGZB 5FU6B 1W70A 3OB9A 4M75B 1SF9A 2VYTA 4XTUA 3CCVQ 1OQKA 2P0QA 4OMLA 4CI0C 1Q95G 2DTOA 3O5ZA 3M0UA 1RAEB 5FRNA 1YITT 2P4RA 1LNXA 2V1QA 2X3WD 2DIQA 2XHCA 4M75E 1UHFA 5LJ5j 4EDUA 1CKAA 3L2ZA 3CCMT 1YFNA 4BY6B 1VQ8Q 4ZGJB 1QKXA 2EYZA 2QI2A 4Z02A 5M9OA 3UA7A 3NTKA 2DXTA 1MNEA 1WHLA 3I5RA 2SEMA 4LXCA 5GAN3 1Q82R 5GMKm 3OQ5A 4QVDA 4M7AD 1AHJB 2AHJB 2LDMA 1MUZA 2DXUA 1WA7A 4B6MA 4JRQA 3X24B 3CCVT 4NL2A 2F2XA 1WFWA 2ENMA 1SPKA 3H9NA 2FZKB 2XI9A 4OB0B 3LWIA 2NYSA 2QAZA 3HHTB 1X6OA 3BY7A 4E7JA 5I2SA 4ZNXA 1UTIA 3E19A 2LRQA 3DB3A 1C1AA 2PU9B 1ZLMA 2LT4A 4M78G 8AT1B 1I5LA 2MYSA 4BDYA 2HQEA 2RM4A 2QEXQ 3TCJA 1MMGA 2RF0A 1KD1U 4A63B 4FW1A 1UDLA 2F5KA 1YIJQ 1TH7A 3OYIA 1VQ6Q 3AT1B 3JRZA 4KH1B 2EQJA 3C12A 2L3SA 4J8OA 1QVFA 2X4JA 1UGSB 4JDSA 1M8VA 2VGNA 5I11A 4P5NA 1GBQA 3EAEA 5C0MA 2KY9A 3CCUA 2HBWA 4M75G 1UJYA 2L5QA 5IN1A 3QDFA 2DILA 4RG8A 4AG1C 3QYHB 4B9XA 3JCMb 3GPLA 3CCRA 5KYYB 1NLOC 1VQ5T 2COYA 4PFZA 6AT1B 2JNGA 2ED1A 2R5AA 4FYYB 2RD1A 1BCMA 2EFIA 3THKA 3EH2A 2QASA 1U3OA 3VKIA 3EHRA 3L42A 1UE9A 3F70A 3A8HB 2DVEA 1TTHB 5GAN6 3MP8A 1B7TA 4FL6A 4E47A 3VS5A 1VQ6T 4J7FA 2PVGB 3SFMA 4M7DD 4ELZC 2NUTB 3FLGA 4M78A 2QK0A 2LJ3A 3O8VA 4E6RA 1KHIA 3PVQA 4J83A 3PTAA 3RR6A 3OYAA 1W2BS 1Y71A 3ER0A 2JTFA 4PJJA 2SRCA 1QQJA 5GAOr 3LX7A 2KYBA 2QA4A 5GANh 3VS7A 5KE2A 2IVWA 3H6ZA 4IIOA 2LQWA 4F04B 3SDZA 1TUCA 2H3JA 3URGA 2GTJA 5HK0A 4RTVA 2DF6A 4JS5A 2BZYA 2H3EB 4KH0B 4DEYA 2B8AA 3FDRA 1Q86U 2EKHA 4PK4A 3RMQA 2YXYA 4M7AC 2KRSA 1TU0B 5LJ3d 1Z9QA 5FRMA 1JJ2A 1PKTA 1QP2A 2FRWA 3H0HA 2AZSA 3QBYA 4OB1B 1SG5A 3J7AF 2DL5A 4LD9K 3U23A 2XK0A 4DQ2A 3BFMA 2DJZA 2BE7D 4WF2A 1X6GA 1D0YA 3HTRA 3CCUQ 2DEQA 4F7UA 3GLXA 3IQLA 3G71Q 4M75A 4XAXB 5A0DA 1IGQA 1QVPA 2LVMA 1ZUYA 1FXXA 5IXFA 3OMGA 2YLBA 4LNPA 2KR3A 5D6XA 2JXBA 1VQMA 4C8QF 4M75C 2KMTA 3G6ET 2MOXA 4OVAA 2CT4A 1ZA2B 4J9HA 3OYKA 5GAMj 1YJNQ 3QWYA 4IUPA 5KCOA 2BIVA 3M5AA 1U1SA 3UWNA 1Q81U 2QQSA 1A0NB 2AIRB 1HXDA 1VQKT 2GBQA 3G4SA 3MEVA 5GAMd 3CCQA 1I0CA 1VQ5A 2ABLA 1P92A 4PJOA 1OULA 3OBWA 1BKBA 1VQ7A 4J9DA 1M2VB 3CCEA 2V8IA 4EMKA 3G4ST 3FB9A 3S3NA 1KD1C 4BY6C 1Q7YU 2K5FA 1IRXA 1OV3A 1HYOA 3JCMV 3JCMg 2PVDB 1M4ZA 3RMSA 2CZ0B 4CC2A 1VQ8A 1JU5C 3UF4A 4EPCA 1Y7XA 3G71T 2DA9A 1AEYA 2V1RA 4C0DB 2DBKA 5GMKe 1JRIA 2P4TA 4TVRA 1VQNQ 3EGXA 1RL2A 2KGTA 4C0DC 2LCSA 5IHIA 1UEBA 4ZGDB 5GAMh 2ECZA 3OYNA 4BE1A 4B9WA 2MPXC 4N0AA 4F7UG 3CCSA 2K3XA 4PL6A 1R77A 4M77B 1AVZC 3S3MA 1NG2A 5KYWB 2EJ9A 2HSEB 2MMPA 4KGXB 1MGQA 5GAN7 1BB9A 3X26B 3OYEA 1VQKQ 5GAN8 2XDDA 1M1FA 3M9QA 4M77G 1WHGA 1D3BA 5GMKl 1HK9A 2D8HA 3M55A 4L59A 1X2KA 2FPEA 4PKCC 2E12A 1UJ0A 1CSKA 1XOVA 2Y90A 3CMEA 3CC4Q 1H8KA 1ZBJA 4AFSC 1M30A 3JCMf 2DLPA 1M1KU 3MEWA 2Y4YA 3JCMe 3A8OB 5J39A 2DXBA 1YIJA 4RTUA 2COZA 1VQ6A 4CRIA 1YJNA 1AOJA 3VS4A 1X43A 2BKDN 1N8RU 1N8RC 3TVTA 5IHKA 1KQSP 1VQNT 2A7YA 4M7DG 1PG5B 3I56Q 2FYKA 4Y92A 2MCNA 2OTLA 4QQGA 5CIUA 2EVRA 1WLPB 1D0ZA 3H8ZA 5HKCA 2E1HA 2A3LA 3PFSA 2IPOB 4FYVB 1LOJA 4C8QD 4FU6A 1OPLA 3RDVA 3EGUA 2OTLT 5C6SA 3DKMA 2HSPA 2EYQA 2JUFA 5IAYA 1PHTA 1HSQA 2LX9A 1ZBXA 4KGVB 2J7IA 2OJ2A 1K0SA 2HL5C 2PUOB 1NLPC 1O9SA 5HCKA 5CKFA 1PRMC 4ORZA 3HRTA 2ESWA 4E7LA 4M7AB 4A53A 3WVDB 4AG2C 4FT2A 1VQNA 1XQHA 1WI7A 2VB6A 5IXBA 4VUBA 4ZN3A 1VQPT 2ZPBB 2WACA 3L2WA 3E9GA 3HRSA 2DETA 4AFUC 1VQPA 2E70A 4J5YA 2J05A 4KULA 5LJ5g 2QXFA 1VQKA 1M90C 1S1NA 3PVLA 5FU6C 4M77D 4M7AE 1OEBA 2VASA 2M16A 5LJ3e 2C0OA 2GCXA 4LE9A 3JB9J 2ZGWA 1KC8U 3EFOB 1G2BA 3PGGA 1QWEA 1ACMB 4L5GA 1K9AA 2L8DA 2JM8A 2ZPIB 1ABQA 4E7HA 1N8RR 4Z89A 1G3SA 2NUZA 2E6ZA 3EGDB 3PMTA 4F7UB 2RHZA 4M75D 2K7AA 2ROTA 1NJIC 2YHTA 2MWPA 1RACB 2XICA 1W2BP 1NM7A 2HKQB 2RHXA 3JCMQ 4MMLA 1RAHB 4J9GA 4LDYA 2KAFA 1S72A 3OW2S 1QP3A 1VQ4Q 1E6GA 3CMET 3X25B 2ED0A 2R5MA 4F16A 4M7AF 1QVGP 1YCYA 2NWMA 4RCCA 1Q86R 1GFCA 3GNFB 1EIFA 3JCMc 2FZGB 2DZCA 5CR2A 5D6WA 2JS0A 2CP2A 1KQSA 2I0NA 1ZSZC 5LJ3h 1E7OA 2OTJT 3LYIA 2XMFA 2VUBA 2QEXT 3CC7A 3GOXA 2JTEA 2D8JA 2EIFA 3I55Q 1MNDA 1YHQQ 4BD3A 1KK7A 3NTIA 1R0BG 1YI2T 1M3AA 5KYXB 3FEOA 2CZ7B 2CUDA 2YUQA 1I1JA 1UGPB 3VS1A 3QSUA 3RKXA 1ABOA 2A08A 1M1KC 3L2UA 3NTHA 3EGXB 3SWNC 1IO6A 4M4ZA 1VQ4T 2A0FB 4E2FB 2MK5A 5AT1B 2D1XA 2R57A 1K76A 1SSFA 3EH1A 2K6DA 2EGEA 1YWPA 4C5HA 3P8DA 1OX8A 3SHWA 5GMKh 2EQMA 1FX7A 4N4IA 2E5QA 2QTVA 4E7SA 2J6FA 3C95A 5A2QE 2K57A 3I9QA 2JS2A 3UATA 3S6WA 3EG1A 5HK3A 2KXDA 4E7IA 3VS0A 3WXMB 3M0PA 5GMKi 1G5VA 4JLGA 3VS3A 3FRNA 2JVVA 4M77F 2ZPEB 1MMNA 2KXCA 3I55T 2K3YA 1YHQT 1JB0E 3BW1A 2QDYB 2RQTA 1WHKA 4JJNK 2EBPA 1JXMA 2CSIA 2L0AA 2E3IA 1VQ4A 3CBMA 2QA4Q 3OYDA 1RI0A 3JB9H 2HCKA 1AZGB 2DMOA 2PUKB 4D8DA 3M0SA 1M27C 2GNCA 3QUIA 1T3SA 4M78F 4LUEA 1EZZB 2FPDA 3LH5A 2QQAA 1QCOA 3P8HA 3RIRA 2EYYA 2JOYA 3BDUA 1VUBA 3TSWA 1ZSGA 1SRLA 1UGQB 2RO0A 2EPDA 1I5OB 2NUPA 1KIKA 1PNJA 3MEAA 5GJVB 1TXQA 1LCKA 4N4HA 5DLQE 2DBMA 1NEGA 3I56A 4IURA 4EMKB 1JEGA 3H41A 2QGGA 1FMKA 3M57A 2ZAEA 3C94A 3M4GA 1H3HA 5DM7R 2O9SA 5DY9A 1M9SA 1RADB 1BI0A 4AFQC 5GAOp 1EX4A 4M78D 2QEXA 3CC7T 1B34B 1WHMA 3CCUT 4M7AA 1X69A 2KRMA 1VQMQ 1RAAB 2QA4T 2DRKA 2MAMA 1M2OA 4QVCA 4D8KA 5GAOm 1SRMA 5FWCA 2MF2A 4C8QE 2EQKA 2O9VA 4LD6A 3OW2P 3OYGA 4DOWA 3MO8A 4N4GA 4JS4A 2HNIA 2YSQA 3EHQA 5CO7A 1YJNT 1G3WA 3SB2A 4C5EA 2KT1A 5CKBA 4J9FA 5LJ5e 2VXFA 2HQXA 1PKSA 5CVIA 1V76A 1YN8A 2CP7A 3CD6T 1HD3A 1VQ7Q 1VA7A 3CCEQ 2A36A 2KSSA 2L89A 3CCRQ 4C92G 2D0QB 1Y57A 2KROA 3EG0A 2HAXA 1D1AA 1TUDA 4C8QB 4F7UE 3CD6A 3REAB 2C0TA 1ZUKA 1WXBA 4DBRA 4PLIA 4XU3A 4MDWA 4HCKA 4PFPA 5CK9A 4PJOB 5CCAA 4RKUE 4BI4A 2X35A 1Q82U 1BIAA 2M0OA 3VYGA 1XTDA 2LQ8A 4K11A 3ASKA 4FM4B 4DBQA 2E65A 4PJOC 1T0JA 1VQMT 1PC0A 2LJ0A 2WSEE 1QWFA 3EFRA 1YJ9Q 4OGCA 3JV3A 2VC8A 2M51A 2AT1B 1WJRA 4M78B 4PLLA 4A4EA 3HP9A 2HD0A 2XG8D 3S3OA 5J3BA 1WJQA 1Q82C 1RLPC 2O4XB 5FLXE 2W10A 3M4YA 5I21A 4E7ZA 2M0YA 2DIGA 3NMZC 2GF7A 4IUUA 1QVFS 1N27A 3CCET 2LQKA 1SHGA 1BCOA 1ZUUA 2LNVA 4JZ3A 1N6AA 5GANd 4HVVA 3CPWS 2BZXA 3A8GB 1GBRA 2JT4A 2DL3A 3JCMW 5LJ5f 5KYNA 2A28A 1GXIE 1ZA1B 4XQ3A 2K3BA 2DL8A 4DBFA 3BDLA 1NJIU 1FYNA 1QVFP 4FSSA 4QQDA 2HMAA 2AKLA 2X3XD 1V1CA 5FU7C 1YBYA 2GGRA 2BUDA 3QHSA 3OMCA 2PQWA 3C0CA 2LNHB 2FZCB 3BE3A 1YJ9T 5CKEA 1AD5A 4GLMA 1VQOA 4J9CA 3OYLA 1Z9ZA 1UUEA 3JAME 2LT1A 1C6VX 2XDBA 4AMCA 3OS5A 1F1BB 2JJ9A 4RUGA 3G1JA 3PMIA 2VV5A 4MZMA 3CBOA 4C5IA 2CP0A 3MCAB 4C92C 1BIBA 2DX1A 2YRCA 1Q7YC 3PIOA 3CQTA 2XD0A 4OMQA 3HKSA 3VS2A 2GQVA 2A37A 4R0KA 1K8AR 2RHUA 1K8AC 2OAWA 3G7ZA 4OB2B 2G3RA 3E2UA 1R0CB 2OTJA 2J6OA 2GQIA 1AWOA 2LMJA 4HVUA 2FL7A 3QWXX 4F7UF 4LDUA 5A0GA 1VYTA 4HCCA 2RHIA 3V7CA 1OOTA 3CXCP 2BE9B 1MMDA 2PNIA 3CCJA 3CC2A 5IH2A 3LWHA 2BTTA 4LDVA 4R56A 1VQPQ 2M1HA 3VJPA 1PCXA 2JN0A 2DNUA 3G6EA 4GY5A 2PVOB 3CEYA 1WDXA 3A8MB 3ULRB 1BI3A 4HKEA 1IXDA 2K4YA 4MZTA 3PT9A 4RCBA 5LL6S 5LJ3f 1Y96A 2RN8A 3M0TA 1ZX6A 3CCSQ 1WJSA 1X75C 1BU1A 2OX7A 4NS5A 3EG9A 3NPFA 4KUDK 3LW5E 2JMCA 3SWNB 2C06A 2EGCA 1B34A 2FG0A 2F69A 1W2BA 1MV3A 1UGVA 4R55A 1N5ZA 4EMHA 1KJWA 1TOVA 3EFOA 3JCMJ 1U5SA 5J26A 2QDLA 3VUBA 4RMOA 1VQOQ 2HBPA 3UT1A 2HKNA 2MI6A 4CC3A 3OS2A 2LJ1A 3CMEQ 1QVGA 3CC4A 1AZEA 4M75F 1NPPA 3LLRA 5GAOn 2CKKA 1X6BA 4RTZA 2RJEA 4BE2A 2M02A 1IGUA 1GCQC 1K9MC 2DD5A 2ATCB 1K1ZA 1RI9A 1UHCA 3CCLA 2J06A 4XTWA 2P0KA 3JCMh 5D6YA 4ZGEB 4JLIA 1PD0A 1OU9A 3QO3A 3KBGA 3I55A 4PFOA 1Q81C 3MP1A 3SEMA 2K2VA 2OTJQ 1J3TA 1WX6A 2X4WA 3CCST 1VQ9T 3M0QA 2EQIA 2EJGA 4C0ZA 2O01E 1M5Q1 4JJBA 1U06A 4D6WA 3OYFA 3KFVA 2FO0A 4C5GA 1YI2Q 2EYXA 3OYMA 2VXEA 2K79A 9ATCB 4FYWB 4RG2A 1O75A 2WSCE 3CMAQ 4FIBA 4M7DC 2GTOA 2C0IA 5CKHA 2GFUA 2HQHA 1M3BA 4HT8A 5CQYA 2COWA 1I81A 3QKJA 2L2PA 1BBZA 1OX9A 1U1TA 4AFZC 1AWXA 4YTLA 2RQRA 5GAOq 4M7DA 1S72T 4X1VA 3NHNA 2DO3A 4A4HA 1K73U 3OA6A 4DBHA 3A1PA 3RESA 3CPWP 2NUPB 3MPUB 1M1KR 1QW1A 3ZL7C 2D9TA 1KFZA 1V29B 1QMCA 5I22A 4KUIA 2F2VA 3OS1A 1T0HA 2JZ2A 4N0AC 2EGAA 3L2VA 4GBQA 2LX7A 2KDSA 2DE0X 4C92B 3UA6A 5GANg 2RH2A 3L1AA 1BI1A 3MHXA 1W1FA 5D7UA 4OMFB 1VQLQ 4J7IA 4RTXA 2CH4W 3H0FA 4DEXA 2XKOC 4EMGA 3CMAT 1LVKA 2CT3A 4OMNA 2E6NA 5HY6A 2IIMA 3EGDA 5FW9A 1QCNA 3L2RA 1ARKA 2RQUA 4RTTA 3MEUA 2PZ1A 1N9RA 2WSFE 1BI2A 2E41A 1SEMA 3CCLQ 1Q86C 1JJ2S 3J81E 5GANe 4C92E 1S72Q 2DXCA 3M54A 4QVZA 1YP5A 2X51A 4C92D 3EG3A 1D09B 3VS6A 2YT6A 3JB9F 2V8JA 2DJQA 2CP3A 5LJ5h 2DVJA 2E5KA 2KI7A 3AHUA 3MKDA 4OP0A 2EAYA 1VIEA 2CP5A 2DL4A 1WHJA 1PWTA 1YWOA 3M0RA 1K9MR 4LN2A 2KRNA 2KBTA 1D1BA 3CC7Q 2ZZDA 3V7SA 1BK2A 5GAMf 1YJWA 1GFDA 4DOVA 2AKKA 1WQWA 3NFCA 4C0FA 2XU8A 4C92F 1YHQA 2HDAA 2E4HA 3TU4K 3M59A 1JQQA 2X4XA 1OU8A 3P8BB 5KE3A 1LPLA 2P84A 4PJOE 3V8LA 4HXJA 3TEEA 2MIOA 4ZTJA 3RUXA 2O4XA 3OSVA 4MZPA 4CC7A 1OI1A 1XNIA 3JB9G 4XTZA 3CD6Q 1WNLA 4BUGA 3N5BB 1VQ7T 3JB9I 4DA4A 1OZ3A 4ESRA 1UGRB 3CCRT 5KYUA 2RMOA 2G6FX 4II1A 4ATOA 2O31A 3VYHB 1T3LA 2CSQA
chains in the Genus database with same CATH topology
1KD1R 1VQ5Q 3CC7Q 1VQNQ 1VQ8Q 1VQOQ 1K73R 1YI2Q 3G71Q 3CCSQ 1JJ2P 1KC8R 1VQ4Q 1VQMQ 3CMEQ 3CCJQ 3CC2Q 1VQ7Q 3CD6Q 3CMAQ 3CPWP 1Q7YR 3CCMQ 2QEXQ 1QVGP 2OTLQ 3CCEQ 1Q86R 1N8RR 1Q81R 2OTJQ 3CXCP 3CCLQ 3CCRQ 1M1KR 1K8AR 1S72Q 1KQSP 1Q82R 1VQLQ 1M90R 3G6EQ 1NJIR 3CC4Q 3CCVQ 3OW2P 2QA4Q 1YIJQ 1VQ9Q 3I55Q 1VQ6Q 1K9MR 3I56Q 1YITQ 1YJWQ 1YJ9Q 1YHQQ 1QVFP 3G4SQ 1VQKQ 1VQPQ 1YJNQ 1W2BP 3CCQQ 3CCUQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 R;  1VQ5 Q;  3CC7 Q;  1VQN Q;  1VQ8 Q;  1VQO Q;  1K73 R;  1YI2 Q;  3G71 Q;  3CCS Q;  1JJ2 P;  1KC8 R;  1VQ4 Q;  1VQM Q;  3CME Q;  3CCJ Q;  3CC2 Q;  1VQ7 Q;  3CD6 Q;  3CMA Q;  3CPW P;  1Q7Y R;  3CCM Q;  2QEX Q;  1QVG P;  2OTL Q;  3CCE Q;  1Q86 R;  1N8R R;  1Q81 R;  2OTJ Q;  3CXC P;  3CCL Q;  3CCR Q;  1M1K R;  1K8A R;  1S72 Q;  1KQS P;  1Q82 R;  1VQL Q;  1M90 R;  3G6E Q;  1NJI R;  3CC4 Q;  3CCV Q;  3OW2 P;  2QA4 Q;  1YIJ Q;  1VQ9 Q;  3I55 Q;  1VQ6 Q;  1K9M R;  3I56 Q;  1YIT Q;  1YJW Q;  1YJ9 Q;  1YHQ Q;  1QVF P;  3G4S Q;  1VQK Q;  1VQP Q;  1YJN Q;  1W2B P;  3CCQ Q;  3CCU Q; 
#chains in the Genus database with same CATH topology
 3OYB A;  1WXU A;  1K73 R;  2DD4 A;  1RAI B;  2LP5 A;  1K8A U;  2ZPG B;  4LDW A;  4C8Q A;  5EC7 A;  3HFN A;  1KQ2 A;  2DYI A;  1E6H A;  4UC4 A;  2F2W A;  2GFA A;  4BB7 A;  3OYH A;  4OB3 B;  3TRE A;  4FT4 A;  1KHC A;  4C8Q C;  1MMA A;  4KRT A;  4JUV A;  1GCQ A;  3R6N A;  2BZ8 A;  4BAC A;  1G3Y A;  3E1S A;  2ZPH B;  1JJ2 P;  1NEB A;  4OMM A;  2DM1 A;  1KQS S;  2CS7 A;  2QQR A;  3REB B;  3V7R A;  1G3T A;  2KT8 A;  2AK5 A;  4HCB A;  3JCM X;  4J9B A;  1ZQ1 A;  2V26 A;  2RNA A;  4O6J A;  3QII A;  3FIF A;  3DLL A;  2RJC A;  3CXC A;  1I8F A;  3FJP A;  1UG1 A;  4ZTF A;  4ME7 A;  5LJ3 j;  3HL8 A;  1CKB A;  1LJO A;  2YDL A;  3I5S A;  4QKU A;  4J6W A;  3CCV A;  2K9G A;  2O88 A;  3VRZ A;  4JRP A;  3GF5 A;  4EMK C;  1G83 A;  4J6Y A;  3LGF A;  1BYM A;  4JRK A;  1PD1 A;  4M7D E;  3R6O A;  5CAI A;  1Q81 R;  1VOM A;  2EWN A;  3OYY A;  1AWJ A;  8ATC B;  3CCJ T;  1EFN A;  3CC2 T;  4E7K A;  1K0X A;  2VGM A;  1WXT A;  2ZCF B;  1HJD A;  4Q5W A;  1VYV A;  3QZ5 B;  4RTW A;  2HEQ A;  1GL5 A;  1ZSZ A;  2DYB A;  3GIB A;  2W0Z A;  1Q7Y R;  2LC4 A;  5GAN 5;  2HZY A;  4MDX A;  3V8J A;  2JM9 A;  4NL3 A;  4ELY C;  4M7D B;  4IKF A;  1VYU A;  2YUO A;  2X4Y A;  3E9F A;  5GAN 2;  2X9H A;  2VVK A;  4ZN1 A;  1Y07 A;  2D6F A;  4LUD A;  2DEU A;  2JMA A;  2CP6 A;  5FU7 B;  1JBM A;  2JTM A;  3QG1 A;  1QCF A;  1NYF A;  3HFO A;  4PNO A;  1WQ7 A;  2DL7 A;  4WTO B;  4HA8 A;  1U8R A;  1UFF A;  2KNB B;  3CCQ T;  2OI3 A;  4XTV A;  2V8K A;  1Y96 B;  2I2L A;  1OPK A;  2RK1 A;  2QQB A;  3UDC A;  1FMV A;  3A98 A;  1KQ1 A;  3PE0 A;  1IRE B;  4C92 A;  1X2Q A;  3GP8 A;  3FJ5 A;  2EKO A;  4CC4 B;  2CDT A;  2RI2 A;  3CPF A;  1VQ9 A;  4RTY A;  2RK2 A;  3ZEH A;  3CCJ Q;  3CC2 Q;  4BE0 A;  1YNZ A;  4JJC A;  2B86 A;  1YIJ T;  3CXC S;  1OYX A;  2DZ9 A;  4X9C A;  1W4S A;  5KH6 A;  4A54 A;  3SD4 A;  4MMK A;  1KC8 R;  4EIK A;  1MV0 B;  3J80 E;  3RKW A;  1C0M A;  2QQ9 A;  4PJL A;  1H64 1;  1FMW A;  3JCM d;  3PNW C;  4OMO A;  1R8O B;  1YJ9 A;  4V2S A;  4F14 A;  2DTI A;  2E3H A;  1N9S A;  5GAO l;  3DLM A;  3I35 A;  4PJM A;  4M7A G;  5A0L A;  1M90 R;  2RA2 A;  3A8L B;  4F17 A;  1IHV A;  2RJD A;  2L3Q A;  1SKU B;  3CCQ Q;  4JPB W;  4M78 E;  1YCS B;  1VQ5 Q;  2E10 A;  2K5I A;  2M9U A;  2QG9 B;  4OF1 A;  2FPF A;  1XJW B;  4C0G A;  3JB9 D;  5KCH A;  3C4S A;  3UPU A;  2CUB A;  2EW3 A;  1WYX A;  4Z8A A;  3LGL A;  1GCP A;  4M78 C;  5I2M A;  5L8R E;  4M7D F;  1KG1 A;  3TSZ A;  1WGS A;  4M77 C;  1KD1 R;  5GMK j;  3HSB A;  1D0X A;  1VQO T;  1KSW A;  3EG2 A;  3NGP A;  3Q1J A;  2NLU A;  4HCZ A;  3D7S B;  4JRI A;  2D0N A;  3T9N A;  1TWB A;  1G8X A;  2CH4 A;  4OMP A;  2LZ6 B;  1IB8 A;  4FYX B;  1FWZ A;  1D1C A;  1B07 A;  1JXO A;  1IHW A;  4M77 E;  1GRI A;  4JJD A;  4BI3 A;  4PJO D;  2L3R A;  2Y4X A;  4WCI A;  2P0P A;  5KYU B;  5GAM g;  3OBY A;  1DJ7 B;  3OYJ A;  1MHN A;  5IHN A;  1WIE A;  2F1L A;  3X20 B;  5KYY A;  2VWF A;  1VQ9 Q;  2CYZ B;  2VKN A;  1D3B B;  2XID A;  3OW2 A;  3CMA A;  2PTK A;  2DFU A;  1I4K 1;  5GAM e;  4KT0 E;  4GLK A;  1KC8 C;  2YUN A;  3VU3 C;  4A4G A;  5ECA A;  2DKG A;  3H0I A;  4A4K A;  2RPN A;  4HT9 A;  1Y0M A;  3DB4 A;  4O5V A;  3X28 B;  1H92 A;  5L23 A;  1M90 U;  2KYM A;  3RNJ A;  2KK4 A;  3EFS A;  4NOY A;  1PRL C;  1WZO A;  1B3Q A;  3M56 A;  5FRO A;  2YLC A;  2FB7 A;  5GAN 4;  2Z0W A;  2K5L A;  4X9D A;  4AT1 B;  2RQW A;  1TSF A;  2QGF B;  4X34 A;  1JO8 A;  2EJF A;  1WHH A;  3VUZ A;  3A5Z B;  4BDZ A;  2DRM A;  4J6X A;  4C8Q G;  2AZV A;  3G6E Q;  5GAN f;  4XU1 A;  1TG0 A;  2LTO A;  2RB6 A;  4XTX A;  4LDX A;  1UB4 A;  3M53 A;  3MP6 A;  3OSS C;  1QVG S;  5DLO A;  4PJO F;  1NPR A;  1M8M A;  2H8H A;  1YIT A;  2J6K A;  4XU0 A;  1M2V A;  3OS0 A;  2KEA A;  2YRV A;  4L6V 5;  2FRY A;  4QT7 A;  4IUT A;  1RLQ C;  4FW2 A;  3LH0 A;  2ZPF B;  5CKD A;  1VQL T;  3INZ A;  2JW4 A;  1PSE A;  2O2O A;  3EG9 B;  3CCM A;  1TS9 A;  1RAB B;  3G4S Q;  1AT1 B;  3SWN A;  4QQ6 A;  3FC3 A;  2FVU A;  3KUF A;  3QZ9 B;  2DK3 A;  2LQN A;  3GNG A;  4FCY A;  4JZ4 A;  2RI3 A;  2ROL A;  2HL3 A;  3CCL T;  2QYZ A;  3QJ6 A;  2XDP A;  2RJF A;  7AT1 B;  1QKW A;  4XTY A;  3WVE B;  2RQV A;  1K73 C;  5EG2 A;  1W6X A;  2EYW A;  2K2M A;  4J9E A;  5IT9 E;  4BI8 B;  3HPW A;  3JSC A;  2EQU A;  2OAU A;  3ME9 A;  2CRE A;  2DAQ A;  3RKY A;  1QLY A;  3MJX A;  3KXT A;  1H3Z A;  3JCM P;  2FHD A;  1I07 A;  4KBM B;  1YJW Q;  5GJW B;  2E64 A;  3ZBD A;  2YWW A;  3RBB B;  2RI5 A;  4Y28 E;  1RAG B;  2DPP B;  3OYC A;  1X27 A;  5GAN j;  2LCL A;  3PIP A;  1M1G A;  3QYG B;  3ZFJ A;  2IG0 A;  1YI2 A;  1NBE B;  1TUG B;  3CC4 T;  1NJI R;  3QPH A;  3L2Q A;  2KQW A;  2L3P A;  2NUT A;  2F5T X;  2RHY A;  4J9I A;  4PJN A;  3VV0 A;  2R58 A;  2LCC A;  2YRD A;  1RUW A;  2CZ1 B;  1IZ6 A;  4IUV A;  3TQ7 P;  1K4U S;  4IUQ A;  2CZ6 B;  4A4F A;  3GBQ A;  1OZ2 A;  1SSH A;  5CQX A;  3VRY A;  4XU2 A;  3I56 T;  2DER A;  2KE9 A;  1YIT Q;  2YUP A;  1M3C A;  2MWO A;  3MET A;  1ZHI A;  3HRU A;  5AYF A;  1AWW A;  1NZ9 A;  2FEI A;  3RER A;  3M58 A;  1NE8 A;  4PJO G;  4XK8 E;  4M77 A;  4HVW A;  3CBP A;  1PM3 A;  2KVQ G;  5KYW A;  2CGH A;  5LJ3 g;  1YJW T;  4Z88 A;  3CCM Q;  2OTL Q;  3OY9 A;  1SHF A;  1UEC A;  1VQ8 T;  1ZSZ B;  1PSF A;  3G71 A;  1VIF A;  5KYX A;  1X01 A;  1NYG A;  4Y91 A;  1K9M U;  2QTX A;  1WPY A;  3QXE B;  4OGE A;  4IIM A;  2DTH A;  1RAF B;  3CPW A;  5LJ5 d;  3QJY A;  1VQL A;  5FWB A;  4ANJ A;  3V8K A;  3QDR B;  4FSX A;  4QW2 A;  4KGZ B;  5FU6 B;  1W70 A;  3OB9 A;  4M75 B;  1SF9 A;  2VYT A;  4XTU A;  3CCV Q;  1OQK A;  2P0Q A;  4OML A;  4CI0 C;  1Q95 G;  2DTO A;  3O5Z A;  3M0U A;  1RAE B;  5FRN A;  1YIT T;  2P4R A;  1LNX A;  2V1Q A;  2X3W D;  2DIQ A;  2XHC A;  4M75 E;  1UHF A;  5LJ5 j;  4EDU A;  1CKA A;  3L2Z A;  3CCM T;  1YFN A;  4BY6 B;  1VQ8 Q;  4ZGJ B;  1QKX A;  2EYZ A;  2QI2 A;  4Z02 A;  5M9O A;  3UA7 A;  3NTK A;  2DXT A;  1MNE A;  1WHL A;  3I5R A;  2SEM A;  4LXC A;  5GAN 3;  1Q82 R;  5GMK m;  3OQ5 A;  4QVD A;  4M7A D;  1AHJ B;  2AHJ B;  2LDM A;  1MUZ A;  2DXU A;  1WA7 A;  4B6M A;  4JRQ A;  3X24 B;  3CCV T;  4NL2 A;  2F2X A;  1WFW A;  2ENM A;  1SPK A;  3H9N A;  2FZK B;  2XI9 A;  4OB0 B;  3LWI A;  2NYS A;  2QAZ A;  3HHT B;  1X6O A;  3BY7 A;  4E7J A;  5I2S A;  4ZNX A;  1UTI A;  3E19 A;  2LRQ A;  3DB3 A;  1C1A A;  2PU9 B;  1ZLM A;  2LT4 A;  4M78 G;  8AT1 B;  1I5L A;  2MYS A;  4BDY A;  2HQE A;  2RM4 A;  2QEX Q;  3TCJ A;  1MMG A;  2RF0 A;  1KD1 U;  4A63 B;  4FW1 A;  1UDL A;  2F5K A;  1YIJ Q;  1TH7 A;  3OYI A;  1VQ6 Q;  3AT1 B;  3JRZ A;  4KH1 B;  2EQJ A;  3C12 A;  2L3S A;  4J8O A;  1QVF A;  2X4J A;  1UGS B;  4JDS A;  1M8V A;  2VGN A;  5I11 A;  4P5N A;  1GBQ A;  3EAE A;  5C0M A;  2KY9 A;  3CCU A;  2HBW A;  4M75 G;  1UJY A;  2L5Q A;  5IN1 A;  3QDF A;  2DIL A;  4RG8 A;  4AG1 C;  3QYH B;  4B9X A;  3JCM b;  3GPL A;  3CCR A;  5KYY B;  1NLO C;  1VQ5 T;  2COY A;  4PFZ A;  6AT1 B;  2JNG A;  2ED1 A;  2R5A A;  4FYY B;  2RD1 A;  1BCM A;  2EFI A;  3THK A;  3EH2 A;  2QAS A;  1U3O A;  3VKI A;  3EHR A;  3L42 A;  1UE9 A;  3F70 A;  3A8H B;  2DVE A;  1TTH B;  5GAN 6;  3MP8 A;  1B7T A;  4FL6 A;  4E47 A;  3VS5 A;  1VQ6 T;  4J7F A;  2PVG B;  3SFM A;  4M7D D;  4ELZ C;  2NUT B;  3FLG A;  4M78 A;  2QK0 A;  2LJ3 A;  3O8V A;  4E6R A;  1KHI A;  3PVQ A;  4J83 A;  3PTA A;  3RR6 A;  3OYA A;  1W2B S;  1Y71 A;  3ER0 A;  2JTF A;  4PJJ A;  2SRC A;  1QQJ A;  5GAO r;  3LX7 A;  2KYB A;  2QA4 A;  5GAN h;  3VS7 A;  5KE2 A;  2IVW A;  3H6Z A;  4IIO A;  2LQW A;  4F04 B;  3SDZ A;  1TUC A;  2H3J A;  3URG A;  2GTJ A;  5HK0 A;  4RTV A;  2DF6 A;  4JS5 A;  2BZY A;  2H3E B;  4KH0 B;  4DEY A;  2B8A A;  3FDR A;  1Q86 U;  2EKH A;  4PK4 A;  3RMQ A;  2YXY A;  4M7A C;  2KRS A;  1TU0 B;  5LJ3 d;  1Z9Q A;  5FRM A;  1JJ2 A;  1PKT A;  1QP2 A;  2FRW A;  3H0H A;  2AZS A;  3QBY A;  4OB1 B;  1SG5 A;  3J7A F;  2DL5 A;  4LD9 K;  3U23 A;  2XK0 A;  4DQ2 A;  3BFM A;  2DJZ A;  2BE7 D;  4WF2 A;  1X6G A;  1D0Y A;  3HTR A;  3CCU Q;  2DEQ A;  4F7U A;  3GLX A;  3IQL A;  3G71 Q;  4M75 A;  4XAX B;  5A0D A;  1IGQ A;  1QVP A;  2LVM A;  1ZUY A;  1FXX A;  5IXF A;  3OMG A;  2YLB A;  4LNP A;  2KR3 A;  5D6X A;  2JXB A;  1VQM A;  4C8Q F;  4M75 C;  2KMT A;  3G6E T;  2MOX A;  4OVA A;  2CT4 A;  1ZA2 B;  4J9H A;  3OYK A;  5GAM j;  1YJN Q;  3QWY A;  4IUP A;  5KCO A;  2BIV A;  3M5A A;  1U1S A;  3UWN A;  1Q81 U;  2QQS A;  1A0N B;  2AIR B;  1HXD A;  1VQK T;  2GBQ A;  3G4S A;  3MEV A;  5GAM d;  3CCQ A;  1I0C A;  1VQ5 A;  2ABL A;  1P92 A;  4PJO A;  1OUL A;  3OBW A;  1BKB A;  1VQ7 A;  4J9D A;  1M2V B;  3CCE A;  2V8I A;  4EMK A;  3G4S T;  3FB9 A;  3S3N A;  1KD1 C;  4BY6 C;  1Q7Y U;  2K5F A;  1IRX A;  1OV3 A;  1HYO A;  3JCM V;  3JCM g;  2PVD B;  1M4Z A;  3RMS A;  2CZ0 B;  4CC2 A;  1VQ8 A;  1JU5 C;  3UF4 A;  4EPC A;  1Y7X A;  3G71 T;  2DA9 A;  1AEY A;  2V1R A;  4C0D B;  2DBK A;  5GMK e;  1JRI A;  2P4T A;  4TVR A;  1VQN Q;  3EGX A;  1RL2 A;  2KGT A;  4C0D C;  2LCS A;  5IHI A;  1UEB A;  4ZGD B;  5GAM h;  2ECZ A;  3OYN A;  4BE1 A;  4B9W A;  2MPX C;  4N0A A;  4F7U G;  3CCS A;  2K3X A;  4PL6 A;  1R77 A;  4M77 B;  1AVZ C;  3S3M A;  1NG2 A;  5KYW B;  2EJ9 A;  2HSE B;  2MMP A;  4KGX B;  1MGQ A;  5GAN 7;  1BB9 A;  3X26 B;  3OYE A;  1VQK Q;  5GAN 8;  2XDD A;  1M1F A;  3M9Q A;  4M77 G;  1WHG A;  1D3B A;  5GMK l;  1HK9 A;  2D8H A;  3M55 A;  4L59 A;  1X2K A;  2FPE A;  4PKC C;  2E12 A;  1UJ0 A;  1CSK A;  1XOV A;  2Y90 A;  3CME A;  3CC4 Q;  1H8K A;  1ZBJ A;  4AFS C;  1M30 A;  3JCM f;  2DLP A;  1M1K U;  3MEW A;  2Y4Y A;  3JCM e;  3A8O B;  5J39 A;  2DXB A;  1YIJ A;  4RTU A;  2COZ A;  1VQ6 A;  4CRI A;  1YJN A;  1AOJ A;  3VS4 A;  1X43 A;  2BKD N;  1N8R U;  1N8R C;  3TVT A;  5IHK A;  1KQS P;  1VQN T;  2A7Y A;  4M7D G;  1PG5 B;  3I56 Q;  2FYK A;  4Y92 A;  2MCN A;  2OTL A;  4QQG A;  5CIU A;  2EVR A;  1WLP B;  1D0Z A;  3H8Z A;  5HKC A;  2E1H A;  2A3L A;  3PFS A;  2IPO B;  4FYV B;  1LOJ A;  4C8Q D;  4FU6 A;  1OPL A;  3RDV A;  3EGU A;  2OTL T;  5C6S A;  3DKM A;  2HSP A;  2EYQ A;  2JUF A;  5IAY A;  1PHT A;  1HSQ A;  2LX9 A;  1ZBX A;  4KGV B;  2J7I A;  2OJ2 A;  1K0S A;  2HL5 C;  2PUO B;  1NLP C;  1O9S A;  5HCK A;  5CKF A;  1PRM C;  4ORZ A;  3HRT A;  2ESW A;  4E7L A;  4M7A B;  4A53 A;  3WVD B;  4AG2 C;  4FT2 A;  1VQN A;  1XQH A;  1WI7 A;  2VB6 A;  5IXB A;  4VUB A;  4ZN3 A;  1VQP T;  2ZPB B;  2WAC A;  3L2W A;  3E9G A;  3HRS A;  2DET A;  4AFU C;  1VQP A;  2E70 A;  4J5Y A;  2J05 A;  4KUL A;  5LJ5 g;  2QXF A;  1VQK A;  1M90 C;  1S1N A;  3PVL A;  5FU6 C;  4M77 D;  4M7A E;  1OEB A;  2VAS A;  2M16 A;  5LJ3 e;  2C0O A;  2GCX A;  4LE9 A;  3JB9 J;  2ZGW A;  1KC8 U;  3EFO B;  1G2B A;  3PGG A;  1QWE A;  1ACM B;  4L5G A;  1K9A A;  2L8D A;  2JM8 A;  2ZPI B;  1ABQ A;  4E7H A;  1N8R R;  4Z89 A;  1G3S A;  2NUZ A;  2E6Z A;  3EGD B;  3PMT A;  4F7U B;  2RHZ A;  4M75 D;  2K7A A;  2ROT A;  1NJI C;  2YHT A;  2MWP A;  1RAC B;  2XIC A;  1W2B P;  1NM7 A;  2HKQ B;  2RHX A;  3JCM Q;  4MML A;  1RAH B;  4J9G A;  4LDY A;  2KAF A;  1S72 A;  3OW2 S;  1QP3 A;  1VQ4 Q;  1E6G A;  3CME T;  3X25 B;  2ED0 A;  2R5M A;  4F16 A;  4M7A F;  1QVG P;  1YCY A;  2NWM A;  4RCC A;  1Q86 R;  1GFC A;  3GNF B;  1EIF A;  3JCM c;  2FZG B;  2DZC A;  5CR2 A;  5D6W A;  2JS0 A;  2CP2 A;  1KQS A;  2I0N A;  1ZSZ C;  5LJ3 h;  1E7O A;  2OTJ T;  3LYI A;  2XMF A;  2VUB A;  2QEX T;  3CC7 A;  3GOX A;  2JTE A;  2D8J A;  2EIF A;  3I55 Q;  1MND A;  1YHQ Q;  4BD3 A;  1KK7 A;  3NTI A;  1R0B G;  1YI2 T;  1M3A A;  5KYX B;  3FEO A;  2CZ7 B;  2CUD A;  2YUQ A;  1I1J A;  1UGP B;  3VS1 A;  3QSU A;  3RKX A;  1ABO A;  2A08 A;  1M1K C;  3L2U A;  3NTH A;  3EGX B;  3SWN C;  1IO6 A;  4M4Z A;  1VQ4 T;  2A0F B;  4E2F B;  2MK5 A;  5AT1 B;  2D1X A;  2R57 A;  1K76 A;  1SSF A;  3EH1 A;  2K6D A;  2EGE A;  1YWP A;  4C5H A;  3P8D A;  1OX8 A;  3SHW A;  5GMK h;  2EQM A;  1FX7 A;  4N4I A;  2E5Q A;  2QTV A;  4E7S A;  2J6F A;  3C95 A;  5A2Q E;  2K57 A;  3I9Q A;  2JS2 A;  3UAT A;  3S6W A;  3EG1 A;  5HK3 A;  2KXD A;  4E7I A;  3VS0 A;  3WXM B;  3M0P A;  5GMK i;  1G5V A;  4JLG A;  3VS3 A;  3FRN A;  2JVV A;  4M77 F;  2ZPE B;  1MMN A;  2KXC A;  3I55 T;  2K3Y A;  1YHQ T;  1JB0 E;  3BW1 A;  2QDY B;  2RQT A;  1WHK A;  4JJN K;  2EBP A;  1JXM A;  2CSI A;  2L0A A;  2E3I A;  1VQ4 A;  3CBM A;  2QA4 Q;  3OYD A;  1RI0 A;  3JB9 H;  2HCK A;  1AZG B;  2DMO A;  2PUK B;  4D8D A;  3M0S A;  1M27 C;  2GNC A;  3QUI A;  1T3S A;  4M78 F;  4LUE A;  1EZZ B;  2FPD A;  3LH5 A;  2QQA A;  1QCO A;  3P8H A;  3RIR A;  2EYY A;  2JOY A;  3BDU A;  1VUB A;  3TSW A;  1ZSG A;  1SRL A;  1UGQ B;  2RO0 A;  2EPD A;  1I5O B;  2NUP A;  1KIK A;  1PNJ A;  3MEA A;  5GJV B;  1TXQ A;  1LCK A;  4N4H A;  5DLQ E;  2DBM A;  1NEG A;  3I56 A;  4IUR A;  4EMK B;  1JEG A;  3H41 A;  2QGG A;  1FMK A;  3M57 A;  2ZAE A;  3C94 A;  3M4G A;  1H3H A;  5DM7 R;  2O9S A;  5DY9 A;  1M9S A;  1RAD B;  1BI0 A;  4AFQ C;  5GAO p;  1EX4 A;  4M78 D;  2QEX A;  3CC7 T;  1B34 B;  1WHM A;  3CCU T;  4M7A A;  1X69 A;  2KRM A;  1VQM Q;  1RAA B;  2QA4 T;  2DRK A;  2MAM A;  1M2O A;  4QVC A;  4D8K A;  5GAO m;  1SRM A;  5FWC A;  2MF2 A;  4C8Q E;  2EQK A;  2O9V A;  4LD6 A;  3OW2 P;  3OYG A;  4DOW A;  3MO8 A;  4N4G A;  4JS4 A;  2HNI A;  2YSQ A;  3EHQ A;  5CO7 A;  1YJN T;  1G3W A;  3SB2 A;  4C5E A;  2KT1 A;  5CKB A;  4J9F A;  5LJ5 e;  2VXF A;  2HQX A;  1PKS A;  5CVI A;  1V76 A;  1YN8 A;  2CP7 A;  3CD6 T;  1HD3 A;  1VQ7 Q;  1VA7 A;  3CCE Q;  2A36 A;  2KSS A;  2L89 A;  3CCR Q;  4C92 G;  2D0Q B;  1Y57 A;  2KRO A;  3EG0 A;  2HAX A;  1D1A A;  1TUD A;  4C8Q B;  4F7U E;  3CD6 A;  3REA B;  2C0T A;  1ZUK A;  1WXB A;  4DBR A;  4PLI A;  4XU3 A;  4MDW A;  4HCK A;  4PFP A;  5CK9 A;  4PJO B;  5CCA A;  4RKU E;  4BI4 A;  2X35 A;  1Q82 U;  1BIA A;  2M0O A;  3VYG A;  1XTD A;  2LQ8 A;  4K11 A;  3ASK A;  4FM4 B;  4DBQ A;  2E65 A;  4PJO C;  1T0J A;  1VQM T;  1PC0 A;  2LJ0 A;  2WSE E;  1QWF A;  3EFR A;  1YJ9 Q;  4OGC A;  3JV3 A;  2VC8 A;  2M51 A;  2AT1 B;  1WJR A;  4M78 B;  4PLL A;  4A4E A;  3HP9 A;  2HD0 A;  2XG8 D;  3S3O A;  5J3B A;  1WJQ A;  1Q82 C;  1RLP C;  2O4X B;  5FLX E;  2W10 A;  3M4Y A;  5I21 A;  4E7Z A;  2M0Y A;  2DIG A;  3NMZ C;  2GF7 A;  4IUU A;  1QVF S;  1N27 A;  3CCE T;  2LQK A;  1SHG A;  1BCO A;  1ZUU A;  2LNV A;  4JZ3 A;  1N6A A;  5GAN d;  4HVV A;  3CPW S;  2BZX A;  3A8G B;  1GBR A;  2JT4 A;  2DL3 A;  3JCM W;  5LJ5 f;  5KYN A;  2A28 A;  1GXI E;  1ZA1 B;  4XQ3 A;  2K3B A;  2DL8 A;  4DBF A;  3BDL A;  1NJI U;  1FYN A;  1QVF P;  4FSS A;  4QQD A;  2HMA A;  2AKL A;  2X3X D;  1V1C A;  5FU7 C;  1YBY A;  2GGR A;  2BUD A;  3QHS A;  3OMC A;  2PQW A;  3C0C A;  2LNH B;  2FZC B;  3BE3 A;  1YJ9 T;  5CKE A;  1AD5 A;  4GLM A;  1VQO A;  4J9C A;  3OYL A;  1Z9Z A;  1UUE A;  3JAM E;  2LT1 A;  1C6V X;  2XDB A;  4AMC A;  3OS5 A;  1F1B B;  2JJ9 A;  4RUG A;  3G1J A;  3PMI A;  2VV5 A;  4MZM A;  3CBO A;  4C5I A;  2CP0 A;  3MCA B;  4C92 C;  1BIB A;  2DX1 A;  2YRC A;  1Q7Y C;  3PIO A;  3CQT A;  2XD0 A;  4OMQ A;  3HKS A;  3VS2 A;  2GQV A;  2A37 A;  4R0K A;  1K8A R;  2RHU A;  1K8A C;  2OAW A;  3G7Z A;  4OB2 B;  2G3R A;  3E2U A;  1R0C B;  2OTJ A;  2J6O A;  2GQI A;  1AWO A;  2LMJ A;  4HVU A;  2FL7 A;  3QWX X;  4F7U F;  4LDU A;  5A0G A;  1VYT A;  4HCC A;  2RHI A;  3V7C A;  1OOT A;  3CXC P;  2BE9 B;  1MMD A;  2PNI A;  3CCJ A;  3CC2 A;  5IH2 A;  3LWH A;  2BTT A;  4LDV A;  4R56 A;  1VQP Q;  2M1H A;  3VJP A;  1PCX A;  2JN0 A;  2DNU A;  3G6E A;  4GY5 A;  2PVO B;  3CEY A;  1WDX A;  3A8M B;  3ULR B;  1BI3 A;  4HKE A;  1IXD A;  2K4Y A;  4MZT A;  3PT9 A;  4RCB A;  5LL6 S;  5LJ3 f;  1Y96 A;  2RN8 A;  3M0T A;  1ZX6 A;  3CCS Q;  1WJS A;  1X75 C;  1BU1 A;  2OX7 A;  4NS5 A;  3EG9 A;  3NPF A;  4KUD K;  3LW5 E;  2JMC A;  3SWN B;  2C06 A;  2EGC A;  1B34 A;  2FG0 A;  2F69 A;  1W2B A;  1MV3 A;  1UGV A;  4R55 A;  1N5Z A;  4EMH A;  1KJW A;  1TOV A;  3EFO A;  3JCM J;  1U5S A;  5J26 A;  2QDL A;  3VUB A;  4RMO A;  1VQO Q;  2HBP A;  3UT1 A;  2HKN A;  2MI6 A;  4CC3 A;  3OS2 A;  2LJ1 A;  3CME Q;  1QVG A;  3CC4 A;  1AZE A;  4M75 F;  1NPP A;  3LLR A;  5GAO n;  2CKK A;  1X6B A;  4RTZ A;  2RJE A;  4BE2 A;  2M02 A;  1IGU A;  1GCQ C;  1K9M C;  2DD5 A;  2ATC B;  1K1Z A;  1RI9 A;  1UHC A;  3CCL A;  2J06 A;  4XTW A;  2P0K A;  3JCM h;  5D6Y A;  4ZGE B;  4JLI A;  1PD0 A;  1OU9 A;  3QO3 A;  3KBG A;  3I55 A;  4PFO A;  1Q81 C;  3MP1 A;  3SEM A;  2K2V A;  2OTJ Q;  1J3T A;  1WX6 A;  2X4W A;  3CCS T;  1VQ9 T;  3M0Q A;  2EQI A;  2EJG A;  4C0Z A;  2O01 E;  1M5Q 1;  4JJB A;  1U06 A;  4D6W A;  3OYF A;  3KFV A;  2FO0 A;  4C5G A;  1YI2 Q;  2EYX A;  3OYM A;  2VXE A;  2K79 A;  9ATC B;  4FYW B;  4RG2 A;  1O75 A;  2WSC E;  3CMA Q;  4FIB A;  4M7D C;  2GTO A;  2C0I A;  5CKH A;  2GFU A;  2HQH A;  1M3B A;  4HT8 A;  5CQY A;  2COW A;  1I81 A;  3QKJ A;  2L2P A;  1BBZ A;  1OX9 A;  1U1T A;  4AFZ C;  1AWX A;  4YTL A;  2RQR A;  5GAO q;  4M7D A;  1S72 T;  4X1V A;  3NHN A;  2DO3 A;  4A4H A;  1K73 U;  3OA6 A;  4DBH A;  3A1P A;  3RES A;  3CPW P;  2NUP B;  3MPU B;  1M1K R;  1QW1 A;  3ZL7 C;  2D9T A;  1KFZ A;  1V29 B;  1QMC A;  5I22 A;  4KUI A;  2F2V A;  3OS1 A;  1T0H A;  2JZ2 A;  4N0A C;  2EGA A;  3L2V A;  4GBQ A;  2LX7 A;  2KDS A;  2DE0 X;  4C92 B;  3UA6 A;  5GAN g;  2RH2 A;  3L1A A;  1BI1 A;  3MHX A;  1W1F A;  5D7U A;  4OMF B;  1VQL Q;  4J7I A;  4RTX A;  2CH4 W;  3H0F A;  4DEX A;  2XKO C;  4EMG A;  3CMA T;  1LVK A;  2CT3 A;  4OMN A;  2E6N A;  5HY6 A;  2IIM A;  3EGD A;  5FW9 A;  1QCN A;  3L2R A;  1ARK A;  2RQU A;  4RTT A;  3MEU A;  2PZ1 A;  1N9R A;  2WSF E;  1BI2 A;  2E41 A;  1SEM A;  3CCL Q;  1Q86 C;  1JJ2 S;  3J81 E;  5GAN e;  4C92 E;  1S72 Q;  2DXC A;  3M54 A;  4QVZ A;  1YP5 A;  2X51 A;  4C92 D;  3EG3 A;  1D09 B;  3VS6 A;  2YT6 A;  3JB9 F;  2V8J A;  2DJQ A;  2CP3 A;  5LJ5 h;  2DVJ A;  2E5K A;  2KI7 A;  3AHU A;  3MKD A;  4OP0 A;  2EAY A;  1VIE A;  2CP5 A;  2DL4 A;  1WHJ A;  1PWT A;  1YWO A;  3M0R A;  1K9M R;  4LN2 A;  2KRN A;  2KBT A;  1D1B A;  3CC7 Q;  2ZZD A;  3V7S A;  1BK2 A;  5GAM f;  1YJW A;  1GFD A;  4DOV A;  2AKK A;  1WQW A;  3NFC A;  4C0F A;  2XU8 A;  4C92 F;  1YHQ A;  2HDA A;  2E4H A;  3TU4 K;  3M59 A;  1JQQ A;  2X4X A;  1OU8 A;  3P8B B;  5KE3 A;  1LPL A;  2P84 A;  4PJO E;  3V8L A;  4HXJ A;  3TEE A;  2MIO A;  4ZTJ A;  3RUX A;  2O4X A;  3OSV A;  4MZP A;  4CC7 A;  1OI1 A;  1XNI A;  3JB9 G;  4XTZ A;  3CD6 Q;  1WNL A;  4BUG A;  3N5B B;  1VQ7 T;  3JB9 I;  4DA4 A;  1OZ3 A;  4ESR A;  1UGR B;  3CCR T;  5KYU A;  2RMO A;  2G6F X;  4II1 A;  4ATO A;  2O31 A;  3VYH B;  1T3L A;  2CSQ A; 
#chains in the Genus database with same CATH homology
 1KD1 R;  1VQ5 Q;  3CC7 Q;  1VQN Q;  1VQ8 Q;  1VQO Q;  1K73 R;  1YI2 Q;  3G71 Q;  3CCS Q;  1JJ2 P;  1KC8 R;  1VQ4 Q;  1VQM Q;  3CME Q;  3CCJ Q;  3CC2 Q;  1VQ7 Q;  3CD6 Q;  3CMA Q;  3CPW P;  1Q7Y R;  3CCM Q;  2QEX Q;  1QVG P;  2OTL Q;  3CCE Q;  1Q86 R;  1N8R R;  1Q81 R;  2OTJ Q;  3CXC P;  3CCL Q;  3CCR Q;  1M1K R;  1K8A R;  1S72 Q;  1KQS P;  1Q82 R;  1VQL Q;  1M90 R;  3G6E Q;  1NJI R;  3CC4 Q;  3CCV Q;  3OW2 P;  2QA4 Q;  1YIJ Q;  1VQ9 Q;  3I55 Q;  1VQ6 Q;  1K9M R;  3I56 Q;  1YIT Q;  1YJW Q;  1YJ9 Q;  1YHQ Q;  1QVF P;  3G4S Q;  1VQK Q;  1VQP Q;  1YJN Q;  1W2B P;  3CCQ Q;  3CCU Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...