1KD1R

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2001-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1kd1R00
1Q81R 1VQ9Q 3CC2Q 3G6EQ 3CCQQ 1Q82R 3CC4Q 1VQ6Q 1VQ7Q 3CCLQ 1JJ2P 3CC7Q 2OTJQ 3CCRQ 1QVFP 1YHQQ 3CD6Q 1VQOQ 3I56Q 3CCJQ 1YITQ 2QEXQ 1KQSP 3CCEQ 2OTLQ 1YJWQ 2QA4Q 1VQ5Q 3CXCP 1NJIR 3CPWP 3CCUQ 1YJNQ 1VQLQ 1VQNQ 1K9MR 1Q7YR 1QVGP 1YI2Q 3OW2P 1VQMQ 1KC8R 1Q86R 3CCSQ 3G4SQ 1VQKQ 3CMAQ 1K73R 1M90R 3CCVQ 3I55Q 1YIJQ 1S72Q 1W2BP 3CMEQ 3CCMQ 1VQPQ 1N8RR 3G71Q 1M1KR 1VQ8Q 1YJ9Q 1KD1R 1VQ4Q 1K8AR
chains in the Genus database with same CATH superfamily
1P92A 4M7DE 3VS5A 1RAHB 1YI2A 4C0GA 2J6FA 4E7ZA 2YRDA 3QKJA 1YI2T 3TEEA 4BE2A 2B8AA 4EPCA 4PJOA 2ZPFB 5D6WA 3BDLA 5KYWA 5FU7B 3JCMQ 2AKKA 2HMAA 2RJDA 3MJXA 3TSZA 1K76A 5KYXB 1N5ZA 2ATCB 2OTJQ 2BE9B 2L8DA 2HD0A 2QEXQ 1YJNQ 2LQ8A 2WSFE 1Q7YR 4BUGA 2RJFA 4M77F 2DXUA 3DB4A 1IREB 2G3RA 3PTAA 2DTHA 2FYKA 2DD4A 4E7SA 3MEUA 2VUBA 4C8QG 2KK4A 2JTEA 1WI7A 2PTKA 1AWXA 3M0SA 2RI5A 1IGQA 1Z9ZA 2CP3A 3TREA 1KSWA 2EAYA 1U8RA 2YWWA 2COYA 1VQ7A 2W0ZA 5GAOn 3EG9A 3FRNA 3REBB 3EFOA 3GF5A 1VQ7T 4IUUA 5LJ3e 1JQQA 3QWXX 1RAAB 1H3ZA 2BIVA 1YCSB 3D7SB 3EGUA 4O5VA 5IHNA 3EGDA 5A2QE 5GAOr 1RADB 2PU9B 4M78E 2L0AA 2LCCA 2Y4YA 2RJEA 2LCLA 4M7DA 5CCAA 2L89A 4DOVA 4EDUA 4A4GA 2P0PA 2RHIA 2RJCA 1RAIB 4PJOG 4QQ6A 1M30A 2ESWA 2DVJA 1SF9A 1UGSB 1BCMA 2CZ1B 4EMKA 2F69A 3QUIA 4RTXA 4QQGA 4XTWA 3V8LA 3QZ9B 4DBFA 1T0JA 1VQMQ 1JJ2A 2P0KA 1VQKQ 1KJWA 2NUZA 4HCZA 2EJFA 5FLXE 1JB0E 2D8JA 2EGAA 1K73C 4C8QB 1Q82R 3TQ7P 4QVZA 3EFSA 1R8OB 1KD1C 5HKCA 3REAB 5KE2A 3A8HB 1NYGA 2RQUA 2DL5A 1VUBA 3RR6A 1G3SA 2HZYA 4Z88A 4JPBW 2NYSA 2LT1A 3JB9J 3MEVA 2XMFA 1UG1A 4Z8AA 2KGTA 4AFQC 5CAIA 3I55A 1UGPB 3CCUQ 1WJRA 5GAMg 2O9VA 3I55T 1WJSA 4CC3A 1QVGP 1K9MU 2E4HA 2H3EB 1RLQC 3OB9A 2O4XA 4CC7A 3BY7A 1TTHB 1E6HA 4M7DG 1BYMA 4M78A 2C0TA 4PJMA 3G6EQ 3WVEB 1JRIA 4KUDK 2GFAA 3Q1JA 4C92E 5CKHA 5GAOp 3JCMd 1YITQ 2NUTB 2GF7A 2PZ1A 1YBYA 2DAQA 3MP1A 4OB3B 3RBBB 4AMCA 1XJWB 1QLYA 1QCFA 1ABOA 3QPHA 1DJ7B 2PQWA 2RM4A 1D3BA 3RNJA 1Q81R 1UB4A 2PNIA 3OW2S 3EHRA 3M59A 3LYIA 3JAME 3CBMA 2KVQG 2QYZA 4C8QD 5FROA 1WHGA 1SEMA 1G8XA 1UDLA 4FYXB 2LC4A 1GRIA 5A0DA 1OZ3A 2JJ9A 4IIMA 4HVWA 1KQSA 5LL6S 2EYZA 4PKCC 2ABLA 3EG9B 3LH0A 1RI0A 4QKUA 3THKA 4BACA 1W2BS 2DO3A 1N27A 2DRMA 4PFPA 5KYYA 4PJOC 1U06A 4OMNA 3CCSQ 1MV0B 4OMLA 1SPKA 2EFIA 2KMTA 4CC4B 3NFCA 1NE8A 1M90C 4OVAA 3N5BB 2YHTA 1N8RC 4M78G 4X34A 3QO3A 3ZL7C 3X25B 4PJOD 3UPUA 4J8OA 2L3PA 3VS4A 1ZBXA 2JZ2A 1QP3A 3X26B 2DM1A 2AIRB 1PG5B 2YUOA 4E6RA 3CCLA 4DBHA 2VV5A 4OMQA 3A8OB 4ELYC 3FEOA 3CCLT 5KYUB 5CR2A 3OBWA 3VS2A 3NTHA 4M75G 3M0RA 4A53A 2VXEA 2M0YA 1X6GA 1ZSGA 3S3OA 1N9RA 5IHKA 5GJWB 4EMHA 5GAN5 3H0IA 2FL7A 2CGHA 2RQRA 3QWYA 5FW9A 3IQLA 8ATCB 3M55A 3DKMA 5LJ5h 3G7ZA 4RCBA 1AWOA 3G71Q 1Q86C 5GMKh 1VQ9Q 2K3YA 1LJOA 4X1VA 1UEBA 1D1BA 3G4SA 2EYWA 1YJWQ 4M7DC 2MOXA 3G4ST 4R56A 2V1QA 1JJ2S 2EGEA 3A8GB 2CUBA 4JRKA 2E1HA 3J80E 3JB9G 2VWFA 3E1SA 2MK5A 3JB9H 1KHIA 2O4XB 1W4SA 4KGVB 5CO7A 4J6WA 2QA4A 3LW5E 4EMKC 2XICA 1I5LA 2E65A 2QA4T 1X43A 1WX6A 3EHQA 2FRYA 4LXCA 4IUVA 2F5KA 4HCKA 1YHQQ 4PLIA 1MUZA 4IUPA 2ZPIB 2E10A 2EPDA 2PVGB 1M5Q1 3JRZA 2CH4A 1KC8U 3M4GA 4J9IA 3ZBDA 3OYIA 4M75B 2V8JA 4C92G 2L3SA 1NLPC 1QKWA 1M2OA 2FZCB 3OA6A 1WZOA 3CCJQ 1A0NB 1OV3A 2DXBA 3NGPA 1K4US 4AT1B 5GANj 1XTDA 1QMCA 1H8KA 2KSSA 1VQ6A 3CMAQ 1VQ6T 1NEBA 5LJ3g 1VQ8Q 4BE0A 5DLQE 4R0KA 4KGZB 4XU0A 3EG3A 3MO8A 2KBTA 4E7KA 1VQLQ 2RNAA 2ZPBB 2NWMA 4XTVA 1PWTA 1OU8A 2DJZA 2EKOA 1VQ4A 5CKFA 2K6DA 2COWA 2E5QA 2OJ2A 2LDMA 1VQ4T 2DEUA 1QKXA 4M78C 1MNDA 1UHFA 3EG1A 3LWHA 1FXXA 5KYXA 2XK0A 2QG9B 1IXDA 2GGRA 4LUDA 5CK9A 4X9CA 3RERA 1K8AU 2HL5C 4F14A 2H3JA 1VQOQ 2AT1B 4M7AE 1G3YA 3SHWA 3L1AA 4BE1A 1V29B 2X3WD 3JCMe 4PJLA 1RABB 5GAOm 2MWPA 3QDFA 3QHSA 3CMEQ 4FYWB 1M90U 1BBZA 4C92B 3CC2Q 2D8HA 3KUFA 2LT4A 2K57A 2CSQA 3OYGA 4ME7A 1WHMA 4C5GA 3CC7Q 1YP5A 1BI0A 4XQ3A 3HFOA 4M75D 3OYYA 2A28A 2L3QA 2YUPA 4RUGA 3HRUA 4KT0E 2KXCA 1GFCA 1U1TA 1MHNA 4OMOA 1TU0B 3I56A 4P5NA 4L5GA 1I8FA 2EGCA 4RTTA 3I56T 5LJ3j 2HL3A 1TOVA 4F7UF 2LQKA 4AFUC 5CKDA 4Z89A 2K9GA 3M53A 9ATCB 1VQ5Q 1NJIR 4FT4A 2CUDA 1R0CB 5GAMh 3UF4A 1QVPA 2HNIA 2SEMA 1ZUYA 2FPDA 2FB7A 2VC8A 1FWZA 2KRNA 3CC4Q 3V8KA 3E9FA 4DQ2A 1G3TA 2D6FA 1ZBJA 3G1JA 3H0FA 2EQJA 4WF2A 4FU6A 2V8IA 4QVDA 1YJ9A 1KQ1A 1QP2A 2A7YA 3VYHB 1YJ9T 3OYEA 1GBQA 2EYQA 2J05A 1CKAA 2QEXA 4LD9K 2XDDA 1NZ9A 2LP5A 4UC4A 3CD6Q 1YJNA 2P4TA 3OQ5A 2QEXT 3BW1A 4HT9A 1YJNT 1BIBA 4C8QF 1QVFP 4DEYA 1D0ZA 4C92D 5AT1B 1TXQA 5GANe 2P84A 2DBMA 5J26A 3PIOA 4CI0C 1B07A 4IUTA 2K5IA 3WXMB 1X2QA 1H92A 2GQIA 1K9MC 1U3OA 1IHVA 1KQ2A 3I5SA 1OPKA 2CP2A 3QG1A 4AFZC 2FZKB 4LD6A 2XD0A 4MDXA 3PIPA 3OW2A 2C0IA 5LJ5d 2DJQA 2VB6A 1NEGA 3CXCP 3CPWP 2E41A 3NTIA 1C0MA 2KRSA 1WXTA 2JNGA 2HKQB 4BY6B 4B6MA 1PD0A 2IVWA 2DIGA 3M54A 2XIDA 4ANJA 4J6YA 3QXEB 2YDLA 1LOJA 2NUTA 4PJOF 1ZQ1A 3UWNA 4DA4A 1PKTA 3VV0A 3CQTA 1W2BA 1FMVA 5IH2A 1BCOA 2O2OA 2ZGWA 4RMOA 3R6OA 3R6NA 4IIOA 2LTOA 3LX7A 1NBEB 1U5SA 1X27A 2WSEE 2DL7A 3E2UA 1IB8A 2QGFB 5I2MA 2VKNA 4M7AG 2HBWA 3HL8A 1F1BB 1ZUUA 2LX7A 4DEXA 4RTYA 1T0HA 3BFMA 3SWNB 1HD3A 5KYNA 3L2WA 4BI4A 4RTUA 1UUEA 1X6BA 2ZCFB 1YWOA 5DM7R 1S72Q 3C4SA 1C6VX 5L23A 2GTJA 3LGFA 3HKSA 5KH6A 2FO0A 2NUPA 4J9EA 4FT2A 2EJ9A 4IKFA 2DFUA 3M0PA 4HVUA 1X69A 1WXUA 2DD5A 1Y96B 2KXDA 1AT1B 5FU7C 2CS7A 3ME9A 1UJYA 2V26A 3LH5A 1WJQA 3OYHA 1YI2Q 3QYGB 2RQTA 1Q7YU 3C12A 4OP0A 2EVRA 2WACA 5HCKA 3L2VA 2IG0A 1N9SA 4Q5WA 1VYUA 2CP5A 3CCUA 4M7DF 2YUNA 3CCUT 1JO8A 1R77A 1TUDA 3FC3A 2IPOB 5I21A 4M75E 3LWIA 1B34B 4DBRA 4KH0B 1WLPB 3PMIA 3G6EA 1RL2A 5KYUA 3G6ET 8AT1B 4MZTA 1TUCA 2OX7A 1M1GA 2P4RA 3RKYA 1M1KR 2V1RA 3HP9A 2EWNA 2D1XA 5GAN6 4M7AB 2YUQA 1OX8A 2MMPA 3VRZA 4NL3A 2CT4A 4XTZA 4C0DB 1EX4A 2F2WA 1K9AA 5J3BA 2JN0A 3E9GA 3CCVQ 2DEQA 4OB2B 2DZ9A 1E6GA 1WQ7A 1TG0A 4JJBA 3OY9A 2YLBA 1VQ7Q 1M3BA 1ZHIA 1SSFA 2M51A 4MDWA 1J3TA 2ZPEB 1G83A 2DLPA 4F04B 4HCBA 2HAXA 2AZSA 5CVIA 4MZPA 2K7AA 2X4JA 4PFOA 5ECAA 1HYOA 1M3CA 2DTOA 1KC8C 1I5OB 1EFNA 1FYNA 4PL6A 1Q82U 1QCOA 3CCSA 4IURA 3X24B 5C0MA 1OI1A 1ZX6A 4MZMA 3CCST 4FW1A 4M78F 1G3WA 2QK0A 1GCQC 2D0NA 2IIMA 3LLRA 4C8QC 2HBPA 3OYAA 1JEGA 4FIBA 5GAN8 3JCMg 4M75A 1N6AA 3L42A 2PUOB 2E6ZA 3QZ5B 2XKOC 3VS3A 2KNBB 4HVVA 3GNGA 3DLMA 1PC0A 3KBGA 1WPYA 3PVLA 2ROLA 3I35A 4WTOB 4M77B 3BE3A 4M7AD 1AZGB 4BI8B 2BTTA 1WHKA 4HA8A 1WHJA 2V8KA 3OYMA 1QVGS 2X4YA 4N4HA 3C95A 3P8BB 2CZ6B 1PKSA 1QCNA 2MPXC 7AT1B 1NPRA 4XU1A 1K8AC 2NUPB 4BDYA 4O6JA 4OF1A 5LJ5f 3A1PA 4PK4A 4FSXA 2DYIA 2QTVA 1XNIA 3V8JA 3JB9F 1VYTA 5D6YA 5KCOA 2K5LA 1Q81U 1B3QA 2K3XA 1YN8A 3OMGA 3EGXA 3JV3A 2CSIA 3UDCA 2FPEA 4D6WA 4E2FB 4OMFB 4FL6A 1V1CA 4CC2A 1AD5A 1JU5C 4LDUA 4C92A 1YIJQ 4FCYA 2JS2A 2KRMA 5CQXA 1KD1R 2JUFA 1WHLA 1AHJB 1OYXA 2J7IA 4KUIA 4NL2A 1K0XA 1NM7A 3MEWA 1UGRB 2FG0A 1XOVA 5GMKm 1SKUB 3MPUB 2BZ8A 3FDRA 5GANg 2SRCA 4KGXB 4M77D 4RG2A 3JCMb 4XAXB 2DK3A 4J6XA 1OX9A 2RHZA 2I2LA 2R5AA 4MMLA 4J5YA 2M9UA 2GTOA 3OS0A 2QXFA 1PRLC 5FWCA 2YRCA 1RI9A 5GAN2 1BU1A 5FU6B 1IRXA 1AWJA 4LUEA 3OYDA 4JS4A 2E64A 2HKNA 5GAOq 1VQLA 5GAOl 1IZ6A 2XG8D 4WCIA 1VQNA 2HDAA 2VGMA 4IUQA 1VQLT 3AHUA 4N0AA 5GJVB 4ESRA 1VQNT 4VUBA 2MWOA 4JJDA 2CP0A 2JS0A 3MEAA 1X2KA 1SHFA 1T3SA 3CCMA 1ZSZB 3CPFA 3CCMT 2RMOA 1ABQA 2K4YA 2COZA 3OYJA 3OS2A 2JMCA 2GFUA 1R0BG 1OOTA 4QT7A 1KFZA 1AVZC 2ECZA 3CCLQ 4RKUE 4JUVA 2J6OA 2AHJB 1D0XA 2CZ7B 5HY6A 2JM9A 3CC2A 2VGNA 3VRYA 3H6ZA 3H9NA 1HK9A 3CC2T 3SD4A 2DYBA 2CYZB 2K79A 1FX7A 4Y92A 2LZ6B 2LQWA 5GAN7 4F7UE 3EG0A 3OYFA 1UTIA 3RDVA 1KQSP 1MMAA 2Z0WA 4A63B 2Y4XA 2ZZDA 4LN2A 2LJ3A 2DRKA 1B7TA 1OQKA 1I1JA 3CCQA 1G2BA 2E3HA 3G4SQ 5D6XA 3CCQT 2X3XD 1N8RR 1VQ5A 2OTLA 2XDBA 3PFSA 1VQ5T 2OTLT 3JCMJ 1QW1A 1TH7A 5GAMf 1ZUKA 2MCNA 1UHCA 1AZEA 3PT9A 2X4WA 2QA4Q 3INZA 1NPPA 2D9TA 2RPNA 3EGXB 4HCCA 1KG1A 2LJ0A 4M75C 4J9HA 1Y0MA 3VS7A 3GNFB 2E3IA 2LNHB 3MP6A 4XK8E 2GCXA 2H8HA 4L59A 3OYNA 3ZFJA 4KRTA 1Y71A 3OMCA 4NS5A 2I0NA 5C6SA 2HSEB 3ULRB 2HSPA 3TSWA 3SWNA 3CCEQ 4C5EA 2MAMA 2CT3A 3CD6A 1M2VB 2RF0A 1PNJA 4OMMA 3CD6T 3V7CA 2GQVA 3META 1Q86R 2RK1A 2MYSA 4PLLA 5IXBA 1WIEA 4Z02A 3TVTA 1Q7YC 1VQPQ 3OS5A 2KEAA 2K2MA 1PSFA 1Y96A 1VQ6Q 1BB9A 1WXBA 4GLKA 4RTVA 1WFWA 3GBQA 4LDXA 4HKEA 3H8ZA 4LDYA 2HQHA 1H641 2KROA 2CH4W 2DF6A 4LDWA 3HRTA 2QQBA 1D1AA 1WNLA 1X01A 2DIQA 1K1ZA 3GOXA 1UJ0A 4OMPA 1M27C 1B34A 2CREA 1IO6A 3M5AA 1BI1A 4QQDA 1WGSA 2ED1A 3HSBA 3CCRQ 4E7LA 3VS1A 4J83A 3JCMc 4C92C 4GBQA 3H41A 4M77E 4D8KA 3QSUA 2R57A 1M8VA 3SB2A 3JCMh 2OTJA 1MMDA 5I2SA 2VVKA 1M1FA 2HCKA 4M7AA 2OTJT 2PUKB 4LNPA 1OPLA 2K3BA 1V76A 4BDZA 4JJNK 2QQAA 3DLLA 1YNZA 1Z9QA 4CRIA 2HEQA 1IHWA 1NJIU 4XTUA 2VYTA 1X6OA 2KDSA 3V7RA 1HJDA 2YT6A 3FJPA 1UGVA 3KXTA 1S1NA 2A37A 2L3RA 5A0LA 2JOYA 2O01E 1MGQA 3U23A 3JCMX 1M1KC 3QJYA 1H3HA 3ER0A 2ROTA 1IGUA 1Y57A 1Q82C 1RACB 1KIKA 1NG2A 2DBKA 4BB7A 2ZAEA 3RESA 3A8LB 4F7UG 2XHCA 2CP7A 3PMTA 1QVGA 4PFZA 1CKBA 4FW2A 1BKBA 1D1CA 2DERA 1W1FA 3PE0A 1GL5A 1M8MA 3M0TA 2WSCE 2MF2A 2QGGA 1HSQA 3MCAB 1QVFS 3OBYA 2JM8A 2XDPA 4Y91A 2FVUA 1YJ9Q 4C5HA 1WQWA 3S3NA 2D0QB 4M77A 2BKDN 1VQMA 1VQKA 3T9NA 2DA9A 1TS9A 2JTFA 2BE7D 4J9DA 4A4EA 5IAYA 1VQMT 1VQKT 4A4FA 2CKKA 2DMOA 1OEBA 5GANh 2DKGA 4ZN3A 1UECA 1BK2A 4JJCA 2RQVA 5J39A 4A54A 3CXCS 3CPWS 5CIUA 1OULA 2AZVA 3JCMW 2FHDA 4BY6C 1WA7A 1AOJA 5KCHA 1W70A 3CCVA 1Q81C 4JS5A 3FIFA 1ZLMA 3CCVT 5LJ3f 4M4ZA 5LJ5j 3ASKA 2E5KA 4F7UB 4JRPA 2LQNA 5GMKj 3AT1B 1BI2A 2EKHA 3OYLA 5KE3A 5CKEA 1NLOC 2LMJA 4J7IA 1XQHA 4TVRA 1YWPA 3SFMA 5D7UA 2Y90A 1EIFA 3LGLA 3RKXA 5IHIA 1JBMA 2ZPHB 2F5TX 4B9XA 1YITA 1BIAA 3GP8A 3JCMP 2KAFA 2XI9A 1VIFA 3SWNC 1YITT 1VOMA 4HXJA 3M4YA 2NLUA 5FWBA 2M16A 1I07A 3A98A 2QQSA 2DTIA 4C0ZA 4M77G 4DOWA 1K9MR 3EAEA 2YRVA 3VUZA 1SSHA 2ENMA 4OB1B 1HXDA 4AG2C 3RKWA 2A36A 4OGCA 2DPPB 3HFNA 4OB0B 3RMQA 3P8DA 5LJ3h 3EH2A 4FSSA 2RH2A 3EG2A 3RMSA 2F2XA 5I11A 2LNVA 1LPLA 2EYYA 2FRWA 2RK2A 3VU3C 3GLXA 2DNUA 2DXTA 2K5FA 1UE9A 1G5VA 2DVEA 2DXCA 3OW2P 4RTWA 3VUBA 3QIIA 3M58A 1AWWA 2RD1A 1LVKA 2EQUA 5L8RE 1MMNA 5GAMd 1M1KU 5CKBA 1SHGA 2XU8A 2RHUA 1ZSZA 4J9BA 1E7OA 4JZ4A 4JZ3A 4OGEA 2DL3A 3PVQA 2DE0X 4E7IA 5GMKl 3I5RA 4M7AC 2X35A 3MKDA 1W2BP 1M3AA 2HQEA 4J9GA 3S3MA 4PJOB 4FM4B 4C0DC 5KYWB 3TCJA 2RHXA 3NPFA 4M75F 4EIKA 5HK0A 3X28B 1YIJA 2JVVA 2A08A 3E19A 5A0GA 1YIJT 4HT8A 4L6V5 1OU9A 4JLIA 4ZTFA 3HPWA 2EQIA 1Y07A 3ZEHA 5IT9E 4ZGJB 3J81E 1Q95G 3MHXA 4MMKA 1SG5A 2EW3A 4F16A 3TU4K 2KE9A 2P0QA 4BI3A 2J06A 1PRMC 2QASA 2DL8A 3G71A 2MIOA 1JXMA 2EQKA 3URGA 1VQ9A 2L2PA 3G71T 4ELZC 1O9SA 5LJ5e 4FYYB 1VQ9T 3I55Q 3NMZC 2OI3A 5GMKe 4JRIA 1YJWA 1LNXA 2PVOB 4FYVB 5IXFA 3EFOB 2LRQA 1YJWT 2O31A 2YSQA 3PNWC 1AEYA 1QQJA 5EG2A 3M0UA 5GAMj 3EGDB 2RI2A 2B86A 2CZ0B 4E7HA 5M9OA 3OSSC 2QQ9A 4J7FA 2GNCA 1K73R 4M7DB 4JDSA 1RAFB 1YHQA 2X4XA 4M77C 1VA7A 1YHQT 4YTLA 4ORZA 2QDYB 1GXIE 1JJ2P 1ZA2B 1YFNA 2LJ1A 4C92F 1M2VA 4RCCA 1GCPA 4EMKB 1X75C 1ACMB 3A8MB 4ZGEB 4E47A 3L2ZA 3UT1A 3A5ZB 1RLPC 2MI6A 2HQXA 3CCJA 3OSVA 5GANd 3CEYA 3CCJT 2FZGB 1VIEA 4XTXA 3L2UA 2AKLA 4PNOA 3QDRB 1OZ2A 2JT4A 3L2QA 3CMAA 2G6FX 3VS0A 4XU3A 4V2SA 2KY9A 3CMAT 1VQ8A 1VYVA 5DLOA 4PJNA 2J6KA 1M4ZA 4ZN1A 1KC8R 4X9DA 3JB9I 1VQ8T 4ZTJA 3C94A 1UGQB 2RN8A 1K73U 1PSEA 2YXYA 4D8DA 2KQWA 4LDVA 4KULA 1KD1U 2YLCA 3O8VA 4ATOA 1BI3A 3QYHB 2OAWA 4BD3A 5I22A 2QDLA 2QQRA 2JMAA 4K11A 5FRMA 3GIBA 3JSCA 1TSFA 2RHYA 2KR3A 1GBRA 1NJIC 2EJGA 1SRMA 1PD1A 2E70A 2JW4A 1VQOA 2DZCA 4Y28E 2M0OA 2X51A 1VQOT 4E7JA 4M7DD 4M78B 3FLGA 4QW2A 2OAUA 4RG8A 3QBYA 3X20B 2RA2A 2CDTA 3CMEA 3UATA 2X9HA 4JRQA 3CMET 1PM3A 3DB3A 2BZXA 3CC7A 1QVFA 3CCEA 3UA6A 1PHTA 2O9SA 5GMKi 4DBQA 2JXBA 3CC7T 5FU6C 4J9FA 3CCET 1K8AR 2RB6A 2EIFA 1RUWA 3RIRA 1D3BB 3OYBA 1TUGB 3QJ6A 2BZYA 1VQPA 3CBOA 5EC7A 5LJ3d 2QTXA 3EH1A 2C0OA 4R55A 1VQPT 2K2VA 2F2VA 2F1LA 1GFDA 1M90R 2QI2A 3KFVA 3CXCA 3CPWA 3MP8A 1ZSZC 4A4HA 5AYFA 1I0CA 4XTYA 3O5ZA 1FMWA 1VQNQ 1UFFA 5GAMe 4GY5A 1MMGA 4JLGA 2C06A 3F70A 1KK7A 3PGGA 2E12A 2DL4A 3NHNA 1FMKA 3H0HA 3RUXA 3P8HA 5KYYB 3CC4A 4C5IA 4GLMA 3CCRA 3UA7A 3CC4T 2DX1A 1W6XA 3CCMQ 3CCRT 1QWFA 3V7SA 2FPFA 4II1A 5FRNA 4F17A 1WHHA 3VJPA 2PVDB 4C8QE 3FJ5A 3BDUA 3JCMf 3L2RA 2O88A 1KHCA 2CP6A 2KI7A 2R5MA 4M78D 1SRLA 1ZA1B 1K0SA 1MV3A 1KQSS 3FB9A 3NTKA 2BUDA 1N8RU 1LCKA 4NOYA 1U1SA 2FEIA 4EMGA 2L5QA 2AK5A 5CQYA 1RAEB 3J7AF 4PJJA 2EQMA 2KT1A 4AFSC 3EFRA 4F7UA 3S6WA 2JTMA 3VKIA 4ZGDB 2LX9A 4RTZA 3SDZA 4C0FA 2RQWA 1D0YA 1VQ4Q 5GAN3 1I81A 6AT1B 1ARKA 3OYKA 3CCQQ 5IN1A 1MNEA 4B9WA 4PJOE 2OTLQ 2M02A 2LCSA 1QWEA 2EYXA 5HK3A 2A3LA 2A0FB 2E6NA 4KH1B 2KYMA 3C0CA 5GAN4 2M1HA 2ZPGB 3M57A 3OS1A 3M0QA 1Q86U 3JCMV 4AG1C 3JB9D 3HTRA 4LE9A 4QVCA 1CSKA 2RO0A 1M9SA 3VYGA 4KBMB 4N4GA 1YCYA 4J9CA 1I4K1 4XU2A 2VXFA 4M7AF 1PCXA 1T3LA 1GCQA 1WYXA 3CBPA 4C8QA 3M9QA 2R58A 3GPLA 1NYFA 4N4IA 2VASA 3M56A 3SEMA 2LVMA 2ED0A 4ZNXA 1RAGB 2GBQA 5GANf 1TWBA 1D09B 3I56Q 2KYBA 4A4KA 1C1AA 2DETA 1S72A 1EZZB 1WDXA 3I9QA 1S72T 3OYCA 1O75A 2DILA 2W10A 3HHTB 5LJ5g 2QAZA 3VS6A 3HRSA 2KT8A 1JXOA 2RI3A 2EBPA 3WVDB 5DY9A 1Y7XA 4N0AC
chains in the Genus database with same CATH topology
1Q81R 1VQ9Q 3CC2Q 3G6EQ 3CCQQ 1Q82R 3CC4Q 1VQ6Q 1VQ7Q 3CCLQ 1JJ2P 3CC7Q 2OTJQ 3CCRQ 1QVFP 1YHQQ 3CD6Q 1VQOQ 3I56Q 3CCJQ 1YITQ 2QEXQ 1KQSP 3CCEQ 2OTLQ 1YJWQ 2QA4Q 1VQ5Q 3CXCP 1NJIR 3CPWP 3CCUQ 1YJNQ 1VQLQ 1VQNQ 1K9MR 1Q7YR 1QVGP 1YI2Q 3OW2P 1VQMQ 1KC8R 1Q86R 3CCSQ 3G4SQ 1VQKQ 3CMAQ 1K73R 1M90R 3CCVQ 3I55Q 1YIJQ 1S72Q 1W2BP 3CMEQ 3CCMQ 1VQPQ 1N8RR 3G71Q 1M1KR 1VQ8Q 1YJ9Q 1KD1R 1VQ4Q 1K8AR
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q81 R;  1VQ9 Q;  3CC2 Q;  3G6E Q;  3CCQ Q;  1Q82 R;  3CC4 Q;  1VQ6 Q;  1VQ7 Q;  3CCL Q;  1JJ2 P;  3CC7 Q;  2OTJ Q;  3CCR Q;  1QVF P;  1YHQ Q;  3CD6 Q;  1VQO Q;  3I56 Q;  3CCJ Q;  1YIT Q;  2QEX Q;  1KQS P;  3CCE Q;  2OTL Q;  1YJW Q;  2QA4 Q;  1VQ5 Q;  3CXC P;  1NJI R;  3CPW P;  3CCU Q;  1YJN Q;  1VQL Q;  1VQN Q;  1K9M R;  1Q7Y R;  1QVG P;  1YI2 Q;  3OW2 P;  1VQM Q;  1KC8 R;  1Q86 R;  3CCS Q;  3G4S Q;  1VQK Q;  3CMA Q;  1K73 R;  1M90 R;  3CCV Q;  3I55 Q;  1YIJ Q;  1S72 Q;  1W2B P;  3CME Q;  3CCM Q;  1VQP Q;  1N8R R;  3G71 Q;  1M1K R;  1VQ8 Q;  1YJ9 Q;  1KD1 R;  1VQ4 Q;  1K8A R; 
#chains in the Genus database with same CATH topology
 1P92 A;  4M7D E;  3VS5 A;  1RAH B;  1YI2 A;  4C0G A;  2J6F A;  4E7Z A;  2YRD A;  3QKJ A;  1YI2 T;  3TEE A;  4BE2 A;  2B8A A;  4EPC A;  4PJO A;  2ZPF B;  5D6W A;  3BDL A;  5KYW A;  5FU7 B;  3JCM Q;  2AKK A;  2HMA A;  2RJD A;  3MJX A;  3TSZ A;  1K76 A;  5KYX B;  1N5Z A;  2ATC B;  2OTJ Q;  2BE9 B;  2L8D A;  2HD0 A;  2QEX Q;  1YJN Q;  2LQ8 A;  2WSF E;  1Q7Y R;  4BUG A;  2RJF A;  4M77 F;  2DXU A;  3DB4 A;  1IRE B;  2G3R A;  3PTA A;  2DTH A;  2FYK A;  2DD4 A;  4E7S A;  3MEU A;  2VUB A;  4C8Q G;  2KK4 A;  2JTE A;  1WI7 A;  2PTK A;  1AWX A;  3M0S A;  2RI5 A;  1IGQ A;  1Z9Z A;  2CP3 A;  3TRE A;  1KSW A;  2EAY A;  1U8R A;  2YWW A;  2COY A;  1VQ7 A;  2W0Z A;  5GAO n;  3EG9 A;  3FRN A;  3REB B;  3EFO A;  3GF5 A;  1VQ7 T;  4IUU A;  5LJ3 e;  1JQQ A;  3QWX X;  1RAA B;  1H3Z A;  2BIV A;  1YCS B;  3D7S B;  3EGU A;  4O5V A;  5IHN A;  3EGD A;  5A2Q E;  5GAO r;  1RAD B;  2PU9 B;  4M78 E;  2L0A A;  2LCC A;  2Y4Y A;  2RJE A;  2LCL A;  4M7D A;  5CCA A;  2L89 A;  4DOV A;  4EDU A;  4A4G A;  2P0P A;  2RHI A;  2RJC A;  1RAI B;  4PJO G;  4QQ6 A;  1M30 A;  2ESW A;  2DVJ A;  1SF9 A;  1UGS B;  1BCM A;  2CZ1 B;  4EMK A;  2F69 A;  3QUI A;  4RTX A;  4QQG A;  4XTW A;  3V8L A;  3QZ9 B;  4DBF A;  1T0J A;  1VQM Q;  1JJ2 A;  2P0K A;  1VQK Q;  1KJW A;  2NUZ A;  4HCZ A;  2EJF A;  5FLX E;  1JB0 E;  2D8J A;  2EGA A;  1K73 C;  4C8Q B;  1Q82 R;  3TQ7 P;  4QVZ A;  3EFS A;  1R8O B;  1KD1 C;  5HKC A;  3REA B;  5KE2 A;  3A8H B;  1NYG A;  2RQU A;  2DL5 A;  1VUB A;  3RR6 A;  1G3S A;  2HZY A;  4Z88 A;  4JPB W;  2NYS A;  2LT1 A;  3JB9 J;  3MEV A;  2XMF A;  1UG1 A;  4Z8A A;  2KGT A;  4AFQ C;  5CAI A;  3I55 A;  1UGP B;  3CCU Q;  1WJR A;  5GAM g;  2O9V A;  3I55 T;  1WJS A;  4CC3 A;  1QVG P;  1K9M U;  2E4H A;  2H3E B;  1RLQ C;  3OB9 A;  2O4X A;  4CC7 A;  3BY7 A;  1TTH B;  1E6H A;  4M7D G;  1BYM A;  4M78 A;  2C0T A;  4PJM A;  3G6E Q;  3WVE B;  1JRI A;  4KUD K;  2GFA A;  3Q1J A;  4C92 E;  5CKH A;  5GAO p;  3JCM d;  1YIT Q;  2NUT B;  2GF7 A;  2PZ1 A;  1YBY A;  2DAQ A;  3MP1 A;  4OB3 B;  3RBB B;  4AMC A;  1XJW B;  1QLY A;  1QCF A;  1ABO A;  3QPH A;  1DJ7 B;  2PQW A;  2RM4 A;  1D3B A;  3RNJ A;  1Q81 R;  1UB4 A;  2PNI A;  3OW2 S;  3EHR A;  3M59 A;  3LYI A;  3JAM E;  3CBM A;  2KVQ G;  2QYZ A;  4C8Q D;  5FRO A;  1WHG A;  1SEM A;  1G8X A;  1UDL A;  4FYX B;  2LC4 A;  1GRI A;  5A0D A;  1OZ3 A;  2JJ9 A;  4IIM A;  4HVW A;  1KQS A;  5LL6 S;  2EYZ A;  4PKC C;  2ABL A;  3EG9 B;  3LH0 A;  1RI0 A;  4QKU A;  3THK A;  4BAC A;  1W2B S;  2DO3 A;  1N27 A;  2DRM A;  4PFP A;  5KYY A;  4PJO C;  1U06 A;  4OMN A;  3CCS Q;  1MV0 B;  4OML A;  1SPK A;  2EFI A;  2KMT A;  4CC4 B;  3NFC A;  1NE8 A;  1M90 C;  4OVA A;  3N5B B;  2YHT A;  1N8R C;  4M78 G;  4X34 A;  3QO3 A;  3ZL7 C;  3X25 B;  4PJO D;  3UPU A;  4J8O A;  2L3P A;  3VS4 A;  1ZBX A;  2JZ2 A;  1QP3 A;  3X26 B;  2DM1 A;  2AIR B;  1PG5 B;  2YUO A;  4E6R A;  3CCL A;  4DBH A;  2VV5 A;  4OMQ A;  3A8O B;  4ELY C;  3FEO A;  3CCL T;  5KYU B;  5CR2 A;  3OBW A;  3VS2 A;  3NTH A;  4M75 G;  3M0R A;  4A53 A;  2VXE A;  2M0Y A;  1X6G A;  1ZSG A;  3S3O A;  1N9R A;  5IHK A;  5GJW B;  4EMH A;  5GAN 5;  3H0I A;  2FL7 A;  2CGH A;  2RQR A;  3QWY A;  5FW9 A;  3IQL A;  8ATC B;  3M55 A;  3DKM A;  5LJ5 h;  3G7Z A;  4RCB A;  1AWO A;  3G71 Q;  1Q86 C;  5GMK h;  1VQ9 Q;  2K3Y A;  1LJO A;  4X1V A;  1UEB A;  1D1B A;  3G4S A;  2EYW A;  1YJW Q;  4M7D C;  2MOX A;  3G4S T;  4R56 A;  2V1Q A;  1JJ2 S;  2EGE A;  3A8G B;  2CUB A;  4JRK A;  2E1H A;  3J80 E;  3JB9 G;  2VWF A;  3E1S A;  2MK5 A;  3JB9 H;  1KHI A;  2O4X B;  1W4S A;  4KGV B;  5CO7 A;  4J6W A;  2QA4 A;  3LW5 E;  4EMK C;  2XIC A;  1I5L A;  2E65 A;  2QA4 T;  1X43 A;  1WX6 A;  3EHQ A;  2FRY A;  4LXC A;  4IUV A;  2F5K A;  4HCK A;  1YHQ Q;  4PLI A;  1MUZ A;  4IUP A;  2ZPI B;  2E10 A;  2EPD A;  2PVG B;  1M5Q 1;  3JRZ A;  2CH4 A;  1KC8 U;  3M4G A;  4J9I A;  3ZBD A;  3OYI A;  4M75 B;  2V8J A;  4C92 G;  2L3S A;  1NLP C;  1QKW A;  1M2O A;  2FZC B;  3OA6 A;  1WZO A;  3CCJ Q;  1A0N B;  1OV3 A;  2DXB A;  3NGP A;  1K4U S;  4AT1 B;  5GAN j;  1XTD A;  1QMC A;  1H8K A;  2KSS A;  1VQ6 A;  3CMA Q;  1VQ6 T;  1NEB A;  5LJ3 g;  1VQ8 Q;  4BE0 A;  5DLQ E;  4R0K A;  4KGZ B;  4XU0 A;  3EG3 A;  3MO8 A;  2KBT A;  4E7K A;  1VQL Q;  2RNA A;  2ZPB B;  2NWM A;  4XTV A;  1PWT A;  1OU8 A;  2DJZ A;  2EKO A;  1VQ4 A;  5CKF A;  2K6D A;  2COW A;  2E5Q A;  2OJ2 A;  2LDM A;  1VQ4 T;  2DEU A;  1QKX A;  4M78 C;  1MND A;  1UHF A;  3EG1 A;  3LWH A;  1FXX A;  5KYX A;  2XK0 A;  2QG9 B;  1IXD A;  2GGR A;  4LUD A;  5CK9 A;  4X9C A;  3RER A;  1K8A U;  2HL5 C;  4F14 A;  2H3J A;  1VQO Q;  2AT1 B;  4M7A E;  1G3Y A;  3SHW A;  3L1A A;  4BE1 A;  1V29 B;  2X3W D;  3JCM e;  4PJL A;  1RAB B;  5GAO m;  2MWP A;  3QDF A;  3QHS A;  3CME Q;  4FYW B;  1M90 U;  1BBZ A;  4C92 B;  3CC2 Q;  2D8H A;  3KUF A;  2LT4 A;  2K57 A;  2CSQ A;  3OYG A;  4ME7 A;  1WHM A;  4C5G A;  3CC7 Q;  1YP5 A;  1BI0 A;  4XQ3 A;  3HFO A;  4M75 D;  3OYY A;  2A28 A;  2L3Q A;  2YUP A;  4RUG A;  3HRU A;  4KT0 E;  2KXC A;  1GFC A;  1U1T A;  1MHN A;  4OMO A;  1TU0 B;  3I56 A;  4P5N A;  4L5G A;  1I8F A;  2EGC A;  4RTT A;  3I56 T;  5LJ3 j;  2HL3 A;  1TOV A;  4F7U F;  2LQK A;  4AFU C;  5CKD A;  4Z89 A;  2K9G A;  3M53 A;  9ATC B;  1VQ5 Q;  1NJI R;  4FT4 A;  2CUD A;  1R0C B;  5GAM h;  3UF4 A;  1QVP A;  2HNI A;  2SEM A;  1ZUY A;  2FPD A;  2FB7 A;  2VC8 A;  1FWZ A;  2KRN A;  3CC4 Q;  3V8K A;  3E9F A;  4DQ2 A;  1G3T A;  2D6F A;  1ZBJ A;  3G1J A;  3H0F A;  2EQJ A;  4WF2 A;  4FU6 A;  2V8I A;  4QVD A;  1YJ9 A;  1KQ1 A;  1QP2 A;  2A7Y A;  3VYH B;  1YJ9 T;  3OYE A;  1GBQ A;  2EYQ A;  2J05 A;  1CKA A;  2QEX A;  4LD9 K;  2XDD A;  1NZ9 A;  2LP5 A;  4UC4 A;  3CD6 Q;  1YJN A;  2P4T A;  3OQ5 A;  2QEX T;  3BW1 A;  4HT9 A;  1YJN T;  1BIB A;  4C8Q F;  1QVF P;  4DEY A;  1D0Z A;  4C92 D;  5AT1 B;  1TXQ A;  5GAN e;  2P84 A;  2DBM A;  5J26 A;  3PIO A;  4CI0 C;  1B07 A;  4IUT A;  2K5I A;  3WXM B;  1X2Q A;  1H92 A;  2GQI A;  1K9M C;  1U3O A;  1IHV A;  1KQ2 A;  3I5S A;  1OPK A;  2CP2 A;  3QG1 A;  4AFZ C;  2FZK B;  4LD6 A;  2XD0 A;  4MDX A;  3PIP A;  3OW2 A;  2C0I A;  5LJ5 d;  2DJQ A;  2VB6 A;  1NEG A;  3CXC P;  3CPW P;  2E41 A;  3NTI A;  1C0M A;  2KRS A;  1WXT A;  2JNG A;  2HKQ B;  4BY6 B;  4B6M A;  1PD0 A;  2IVW A;  2DIG A;  3M54 A;  2XID A;  4ANJ A;  4J6Y A;  3QXE B;  2YDL A;  1LOJ A;  2NUT A;  4PJO F;  1ZQ1 A;  3UWN A;  4DA4 A;  1PKT A;  3VV0 A;  3CQT A;  1W2B A;  1FMV A;  5IH2 A;  1BCO A;  2O2O A;  2ZGW A;  4RMO A;  3R6O A;  3R6N A;  4IIO A;  2LTO A;  3LX7 A;  1NBE B;  1U5S A;  1X27 A;  2WSE E;  2DL7 A;  3E2U A;  1IB8 A;  2QGF B;  5I2M A;  2VKN A;  4M7A G;  2HBW A;  3HL8 A;  1F1B B;  1ZUU A;  2LX7 A;  4DEX A;  4RTY A;  1T0H A;  3BFM A;  3SWN B;  1HD3 A;  5KYN A;  3L2W A;  4BI4 A;  4RTU A;  1UUE A;  1X6B A;  2ZCF B;  1YWO A;  5DM7 R;  1S72 Q;  3C4S A;  1C6V X;  5L23 A;  2GTJ A;  3LGF A;  3HKS A;  5KH6 A;  2FO0 A;  2NUP A;  4J9E A;  4FT2 A;  2EJ9 A;  4IKF A;  2DFU A;  3M0P A;  4HVU A;  1X69 A;  1WXU A;  2DD5 A;  1Y96 B;  2KXD A;  1AT1 B;  5FU7 C;  2CS7 A;  3ME9 A;  1UJY A;  2V26 A;  3LH5 A;  1WJQ A;  3OYH A;  1YI2 Q;  3QYG B;  2RQT A;  1Q7Y U;  3C12 A;  4OP0 A;  2EVR A;  2WAC A;  5HCK A;  3L2V A;  2IG0 A;  1N9S A;  4Q5W A;  1VYU A;  2CP5 A;  3CCU A;  4M7D F;  2YUN A;  3CCU T;  1JO8 A;  1R77 A;  1TUD A;  3FC3 A;  2IPO B;  5I21 A;  4M75 E;  3LWI A;  1B34 B;  4DBR A;  4KH0 B;  1WLP B;  3PMI A;  3G6E A;  1RL2 A;  5KYU A;  3G6E T;  8AT1 B;  4MZT A;  1TUC A;  2OX7 A;  1M1G A;  2P4R A;  3RKY A;  1M1K R;  2V1R A;  3HP9 A;  2EWN A;  2D1X A;  5GAN 6;  4M7A B;  2YUQ A;  1OX8 A;  2MMP A;  3VRZ A;  4NL3 A;  2CT4 A;  4XTZ A;  4C0D B;  1EX4 A;  2F2W A;  1K9A A;  5J3B A;  2JN0 A;  3E9G A;  3CCV Q;  2DEQ A;  4OB2 B;  2DZ9 A;  1E6G A;  1WQ7 A;  1TG0 A;  4JJB A;  3OY9 A;  2YLB A;  1VQ7 Q;  1M3B A;  1ZHI A;  1SSF A;  2M51 A;  4MDW A;  1J3T A;  2ZPE B;  1G83 A;  2DLP A;  4F04 B;  4HCB A;  2HAX A;  2AZS A;  5CVI A;  4MZP A;  2K7A A;  2X4J A;  4PFO A;  5ECA A;  1HYO A;  1M3C A;  2DTO A;  1KC8 C;  1I5O B;  1EFN A;  1FYN A;  4PL6 A;  1Q82 U;  1QCO A;  3CCS A;  4IUR A;  3X24 B;  5C0M A;  1OI1 A;  1ZX6 A;  4MZM A;  3CCS T;  4FW1 A;  4M78 F;  1G3W A;  2QK0 A;  1GCQ C;  2D0N A;  2IIM A;  3LLR A;  4C8Q C;  2HBP A;  3OYA A;  1JEG A;  4FIB A;  5GAN 8;  3JCM g;  4M75 A;  1N6A A;  3L42 A;  2PUO B;  2E6Z A;  3QZ5 B;  2XKO C;  3VS3 A;  2KNB B;  4HVV A;  3GNG A;  3DLM A;  1PC0 A;  3KBG A;  1WPY A;  3PVL A;  2ROL A;  3I35 A;  4WTO B;  4M77 B;  3BE3 A;  4M7A D;  1AZG B;  4BI8 B;  2BTT A;  1WHK A;  4HA8 A;  1WHJ A;  2V8K A;  3OYM A;  1QVG S;  2X4Y A;  4N4H A;  3C95 A;  3P8B B;  2CZ6 B;  1PKS A;  1QCN A;  2MPX C;  7AT1 B;  1NPR A;  4XU1 A;  1K8A C;  2NUP B;  4BDY A;  4O6J A;  4OF1 A;  5LJ5 f;  3A1P A;  4PK4 A;  4FSX A;  2DYI A;  2QTV A;  1XNI A;  3V8J A;  3JB9 F;  1VYT A;  5D6Y A;  5KCO A;  2K5L A;  1Q81 U;  1B3Q A;  2K3X A;  1YN8 A;  3OMG A;  3EGX A;  3JV3 A;  2CSI A;  3UDC A;  2FPE A;  4D6W A;  4E2F B;  4OMF B;  4FL6 A;  1V1C A;  4CC2 A;  1AD5 A;  1JU5 C;  4LDU A;  4C92 A;  1YIJ Q;  4FCY A;  2JS2 A;  2KRM A;  5CQX A;  1KD1 R;  2JUF A;  1WHL A;  1AHJ B;  1OYX A;  2J7I A;  4KUI A;  4NL2 A;  1K0X A;  1NM7 A;  3MEW A;  1UGR B;  2FG0 A;  1XOV A;  5GMK m;  1SKU B;  3MPU B;  2BZ8 A;  3FDR A;  5GAN g;  2SRC A;  4KGX B;  4M77 D;  4RG2 A;  3JCM b;  4XAX B;  2DK3 A;  4J6X A;  1OX9 A;  2RHZ A;  2I2L A;  2R5A A;  4MML A;  4J5Y A;  2M9U A;  2GTO A;  3OS0 A;  2QXF A;  1PRL C;  5FWC A;  2YRC A;  1RI9 A;  5GAN 2;  1BU1 A;  5FU6 B;  1IRX A;  1AWJ A;  4LUE A;  3OYD A;  4JS4 A;  2E64 A;  2HKN A;  5GAO q;  1VQL A;  5GAO l;  1IZ6 A;  2XG8 D;  4WCI A;  1VQN A;  2HDA A;  2VGM A;  4IUQ A;  1VQL T;  3AHU A;  4N0A A;  5GJV B;  4ESR A;  1VQN T;  4VUB A;  2MWO A;  4JJD A;  2CP0 A;  2JS0 A;  3MEA A;  1X2K A;  1SHF A;  1T3S A;  3CCM A;  1ZSZ B;  3CPF A;  3CCM T;  2RMO A;  1ABQ A;  2K4Y A;  2COZ A;  3OYJ A;  3OS2 A;  2JMC A;  2GFU A;  1R0B G;  1OOT A;  4QT7 A;  1KFZ A;  1AVZ C;  2ECZ A;  3CCL Q;  4RKU E;  4JUV A;  2J6O A;  2AHJ B;  1D0X A;  2CZ7 B;  5HY6 A;  2JM9 A;  3CC2 A;  2VGN A;  3VRY A;  3H6Z A;  3H9N A;  1HK9 A;  3CC2 T;  3SD4 A;  2DYB A;  2CYZ B;  2K79 A;  1FX7 A;  4Y92 A;  2LZ6 B;  2LQW A;  5GAN 7;  4F7U E;  3EG0 A;  3OYF A;  1UTI A;  3RDV A;  1KQS P;  1MMA A;  2Z0W A;  4A63 B;  2Y4X A;  2ZZD A;  4LN2 A;  2LJ3 A;  2DRK A;  1B7T A;  1OQK A;  1I1J A;  3CCQ A;  1G2B A;  2E3H A;  3G4S Q;  5D6X A;  3CCQ T;  2X3X D;  1N8R R;  1VQ5 A;  2OTL A;  2XDB A;  3PFS A;  1VQ5 T;  2OTL T;  3JCM J;  1QW1 A;  1TH7 A;  5GAM f;  1ZUK A;  2MCN A;  1UHC A;  1AZE A;  3PT9 A;  2X4W A;  2QA4 Q;  3INZ A;  1NPP A;  2D9T A;  2RPN A;  3EGX B;  4HCC A;  1KG1 A;  2LJ0 A;  4M75 C;  4J9H A;  1Y0M A;  3VS7 A;  3GNF B;  2E3I A;  2LNH B;  3MP6 A;  4XK8 E;  2GCX A;  2H8H A;  4L59 A;  3OYN A;  3ZFJ A;  4KRT A;  1Y71 A;  3OMC A;  4NS5 A;  2I0N A;  5C6S A;  2HSE B;  3ULR B;  2HSP A;  3TSW A;  3SWN A;  3CCE Q;  4C5E A;  2MAM A;  2CT3 A;  3CD6 A;  1M2V B;  2RF0 A;  1PNJ A;  4OMM A;  3CD6 T;  3V7C A;  2GQV A;  3MET A;  1Q86 R;  2RK1 A;  2MYS A;  4PLL A;  5IXB A;  1WIE A;  4Z02 A;  3TVT A;  1Q7Y C;  1VQP Q;  3OS5 A;  2KEA A;  2K2M A;  1PSF A;  1Y96 A;  1VQ6 Q;  1BB9 A;  1WXB A;  4GLK A;  4RTV A;  1WFW A;  3GBQ A;  4LDX A;  4HKE A;  3H8Z A;  4LDY A;  2HQH A;  1H64 1;  2KRO A;  2CH4 W;  2DF6 A;  4LDW A;  3HRT A;  2QQB A;  1D1A A;  1WNL A;  1X01 A;  2DIQ A;  1K1Z A;  3GOX A;  1UJ0 A;  4OMP A;  1M27 C;  1B34 A;  2CRE A;  1IO6 A;  3M5A A;  1BI1 A;  4QQD A;  1WGS A;  2ED1 A;  3HSB A;  3CCR Q;  4E7L A;  3VS1 A;  4J83 A;  3JCM c;  4C92 C;  4GBQ A;  3H41 A;  4M77 E;  4D8K A;  3QSU A;  2R57 A;  1M8V A;  3SB2 A;  3JCM h;  2OTJ A;  1MMD A;  5I2S A;  2VVK A;  1M1F A;  2HCK A;  4M7A A;  2OTJ T;  2PUK B;  4LNP A;  1OPL A;  2K3B A;  1V76 A;  4BDZ A;  4JJN K;  2QQA A;  3DLL A;  1YNZ A;  1Z9Q A;  4CRI A;  2HEQ A;  1IHW A;  1NJI U;  4XTU A;  2VYT A;  1X6O A;  2KDS A;  3V7R A;  1HJD A;  2YT6 A;  3FJP A;  1UGV A;  3KXT A;  1S1N A;  2A37 A;  2L3R A;  5A0L A;  2JOY A;  2O01 E;  1MGQ A;  3U23 A;  3JCM X;  1M1K C;  3QJY A;  1H3H A;  3ER0 A;  2ROT A;  1IGU A;  1Y57 A;  1Q82 C;  1RAC B;  1KIK A;  1NG2 A;  2DBK A;  4BB7 A;  2ZAE A;  3RES A;  3A8L B;  4F7U G;  2XHC A;  2CP7 A;  3PMT A;  1QVG A;  4PFZ A;  1CKB A;  4FW2 A;  1BKB A;  1D1C A;  2DER A;  1W1F A;  3PE0 A;  1GL5 A;  1M8M A;  3M0T A;  2WSC E;  2MF2 A;  2QGG A;  1HSQ A;  3MCA B;  1QVF S;  3OBY A;  2JM8 A;  2XDP A;  4Y91 A;  2FVU A;  1YJ9 Q;  4C5H A;  1WQW A;  3S3N A;  2D0Q B;  4M77 A;  2BKD N;  1VQM A;  1VQK A;  3T9N A;  2DA9 A;  1TS9 A;  2JTF A;  2BE7 D;  4J9D A;  4A4E A;  5IAY A;  1VQM T;  1VQK T;  4A4F A;  2CKK A;  2DMO A;  1OEB A;  5GAN h;  2DKG A;  4ZN3 A;  1UEC A;  1BK2 A;  4JJC A;  2RQV A;  5J39 A;  4A54 A;  3CXC S;  3CPW S;  5CIU A;  1OUL A;  2AZV A;  3JCM W;  2FHD A;  4BY6 C;  1WA7 A;  1AOJ A;  5KCH A;  1W70 A;  3CCV A;  1Q81 C;  4JS5 A;  3FIF A;  1ZLM A;  3CCV T;  5LJ3 f;  4M4Z A;  5LJ5 j;  3ASK A;  2E5K A;  4F7U B;  4JRP A;  2LQN A;  5GMK j;  3AT1 B;  1BI2 A;  2EKH A;  3OYL A;  5KE3 A;  5CKE A;  1NLO C;  2LMJ A;  4J7I A;  1XQH A;  4TVR A;  1YWP A;  3SFM A;  5D7U A;  2Y90 A;  1EIF A;  3LGL A;  3RKX A;  5IHI A;  1JBM A;  2ZPH B;  2F5T X;  4B9X A;  1YIT A;  1BIA A;  3GP8 A;  3JCM P;  2KAF A;  2XI9 A;  1VIF A;  3SWN C;  1YIT T;  1VOM A;  4HXJ A;  3M4Y A;  2NLU A;  5FWB A;  2M16 A;  1I07 A;  3A98 A;  2QQS A;  2DTI A;  4C0Z A;  4M77 G;  4DOW A;  1K9M R;  3EAE A;  2YRV A;  3VUZ A;  1SSH A;  2ENM A;  4OB1 B;  1HXD A;  4AG2 C;  3RKW A;  2A36 A;  4OGC A;  2DPP B;  3HFN A;  4OB0 B;  3RMQ A;  3P8D A;  5LJ3 h;  3EH2 A;  4FSS A;  2RH2 A;  3EG2 A;  3RMS A;  2F2X A;  5I11 A;  2LNV A;  1LPL A;  2EYY A;  2FRW A;  2RK2 A;  3VU3 C;  3GLX A;  2DNU A;  2DXT A;  2K5F A;  1UE9 A;  1G5V A;  2DVE A;  2DXC A;  3OW2 P;  4RTW A;  3VUB A;  3QII A;  3M58 A;  1AWW A;  2RD1 A;  1LVK A;  2EQU A;  5L8R E;  1MMN A;  5GAM d;  1M1K U;  5CKB A;  1SHG A;  2XU8 A;  2RHU A;  1ZSZ A;  4J9B A;  1E7O A;  4JZ4 A;  4JZ3 A;  4OGE A;  2DL3 A;  3PVQ A;  2DE0 X;  4E7I A;  5GMK l;  3I5R A;  4M7A C;  2X35 A;  3MKD A;  1W2B P;  1M3A A;  2HQE A;  4J9G A;  3S3M A;  4PJO B;  4FM4 B;  4C0D C;  5KYW B;  3TCJ A;  2RHX A;  3NPF A;  4M75 F;  4EIK A;  5HK0 A;  3X28 B;  1YIJ A;  2JVV A;  2A08 A;  3E19 A;  5A0G A;  1YIJ T;  4HT8 A;  4L6V 5;  1OU9 A;  4JLI A;  4ZTF A;  3HPW A;  2EQI A;  1Y07 A;  3ZEH A;  5IT9 E;  4ZGJ B;  3J81 E;  1Q95 G;  3MHX A;  4MMK A;  1SG5 A;  2EW3 A;  4F16 A;  3TU4 K;  2KE9 A;  2P0Q A;  4BI3 A;  2J06 A;  1PRM C;  2QAS A;  2DL8 A;  3G71 A;  2MIO A;  1JXM A;  2EQK A;  3URG A;  1VQ9 A;  2L2P A;  3G71 T;  4ELZ C;  1O9S A;  5LJ5 e;  4FYY B;  1VQ9 T;  3I55 Q;  3NMZ C;  2OI3 A;  5GMK e;  4JRI A;  1YJW A;  1LNX A;  2PVO B;  4FYV B;  5IXF A;  3EFO B;  2LRQ A;  1YJW T;  2O31 A;  2YSQ A;  3PNW C;  1AEY A;  1QQJ A;  5EG2 A;  3M0U A;  5GAM j;  3EGD B;  2RI2 A;  2B86 A;  2CZ0 B;  4E7H A;  5M9O A;  3OSS C;  2QQ9 A;  4J7F A;  2GNC A;  1K73 R;  4M7D B;  4JDS A;  1RAF B;  1YHQ A;  2X4X A;  4M77 C;  1VA7 A;  1YHQ T;  4YTL A;  4ORZ A;  2QDY B;  1GXI E;  1JJ2 P;  1ZA2 B;  1YFN A;  2LJ1 A;  4C92 F;  1M2V A;  4RCC A;  1GCP A;  4EMK B;  1X75 C;  1ACM B;  3A8M B;  4ZGE B;  4E47 A;  3L2Z A;  3UT1 A;  3A5Z B;  1RLP C;  2MI6 A;  2HQX A;  3CCJ A;  3OSV A;  5GAN d;  3CEY A;  3CCJ T;  2FZG B;  1VIE A;  4XTX A;  3L2U A;  2AKL A;  4PNO A;  3QDR B;  1OZ2 A;  2JT4 A;  3L2Q A;  3CMA A;  2G6F X;  3VS0 A;  4XU3 A;  4V2S A;  2KY9 A;  3CMA T;  1VQ8 A;  1VYV A;  5DLO A;  4PJN A;  2J6K A;  1M4Z A;  4ZN1 A;  1KC8 R;  4X9D A;  3JB9 I;  1VQ8 T;  4ZTJ A;  3C94 A;  1UGQ B;  2RN8 A;  1K73 U;  1PSE A;  2YXY A;  4D8D A;  2KQW A;  4LDV A;  4KUL A;  1KD1 U;  2YLC A;  3O8V A;  4ATO A;  1BI3 A;  3QYH B;  2OAW A;  4BD3 A;  5I22 A;  2QDL A;  2QQR A;  2JMA A;  4K11 A;  5FRM A;  3GIB A;  3JSC A;  1TSF A;  2RHY A;  2KR3 A;  1GBR A;  1NJI C;  2EJG A;  1SRM A;  1PD1 A;  2E70 A;  2JW4 A;  1VQO A;  2DZC A;  4Y28 E;  2M0O A;  2X51 A;  1VQO T;  4E7J A;  4M7D D;  4M78 B;  3FLG A;  4QW2 A;  2OAU A;  4RG8 A;  3QBY A;  3X20 B;  2RA2 A;  2CDT A;  3CME A;  3UAT A;  2X9H A;  4JRQ A;  3CME T;  1PM3 A;  3DB3 A;  2BZX A;  3CC7 A;  1QVF A;  3CCE A;  3UA6 A;  1PHT A;  2O9S A;  5GMK i;  4DBQ A;  2JXB A;  3CC7 T;  5FU6 C;  4J9F A;  3CCE T;  1K8A R;  2RB6 A;  2EIF A;  1RUW A;  3RIR A;  1D3B B;  3OYB A;  1TUG B;  3QJ6 A;  2BZY A;  1VQP A;  3CBO A;  5EC7 A;  5LJ3 d;  2QTX A;  3EH1 A;  2C0O A;  4R55 A;  1VQP T;  2K2V A;  2F2V A;  2F1L A;  1GFD A;  1M90 R;  2QI2 A;  3KFV A;  3CXC A;  3CPW A;  3MP8 A;  1ZSZ C;  4A4H A;  5AYF A;  1I0C A;  4XTY A;  3O5Z A;  1FMW A;  1VQN Q;  1UFF A;  5GAM e;  4GY5 A;  1MMG A;  4JLG A;  2C06 A;  3F70 A;  1KK7 A;  3PGG A;  2E12 A;  2DL4 A;  3NHN A;  1FMK A;  3H0H A;  3RUX A;  3P8H A;  5KYY B;  3CC4 A;  4C5I A;  4GLM A;  3CCR A;  3UA7 A;  3CC4 T;  2DX1 A;  1W6X A;  3CCM Q;  3CCR T;  1QWF A;  3V7S A;  2FPF A;  4II1 A;  5FRN A;  4F17 A;  1WHH A;  3VJP A;  2PVD B;  4C8Q E;  3FJ5 A;  3BDU A;  3JCM f;  3L2R A;  2O88 A;  1KHC A;  2CP6 A;  2KI7 A;  2R5M A;  4M78 D;  1SRL A;  1ZA1 B;  1K0S A;  1MV3 A;  1KQS S;  3FB9 A;  3NTK A;  2BUD A;  1N8R U;  1LCK A;  4NOY A;  1U1S A;  2FEI A;  4EMG A;  2L5Q A;  2AK5 A;  5CQY A;  1RAE B;  3J7A F;  4PJJ A;  2EQM A;  2KT1 A;  4AFS C;  3EFR A;  4F7U A;  3S6W A;  2JTM A;  3VKI A;  4ZGD B;  2LX9 A;  4RTZ A;  3SDZ A;  4C0F A;  2RQW A;  1D0Y A;  1VQ4 Q;  5GAN 3;  1I81 A;  6AT1 B;  1ARK A;  3OYK A;  3CCQ Q;  5IN1 A;  1MNE A;  4B9W A;  4PJO E;  2OTL Q;  2M02 A;  2LCS A;  1QWE A;  2EYX A;  5HK3 A;  2A3L A;  2A0F B;  2E6N A;  4KH1 B;  2KYM A;  3C0C A;  5GAN 4;  2M1H A;  2ZPG B;  3M57 A;  3OS1 A;  3M0Q A;  1Q86 U;  3JCM V;  4AG1 C;  3JB9 D;  3HTR A;  4LE9 A;  4QVC A;  1CSK A;  2RO0 A;  1M9S A;  3VYG A;  4KBM B;  4N4G A;  1YCY A;  4J9C A;  1I4K 1;  4XU2 A;  2VXF A;  4M7A F;  1PCX A;  1T3L A;  1GCQ A;  1WYX A;  3CBP A;  4C8Q A;  3M9Q A;  2R58 A;  3GPL A;  1NYF A;  4N4I A;  2VAS A;  3M56 A;  3SEM A;  2LVM A;  2ED0 A;  4ZNX A;  1RAG B;  2GBQ A;  5GAN f;  1TWB A;  1D09 B;  3I56 Q;  2KYB A;  4A4K A;  1C1A A;  2DET A;  1S72 A;  1EZZ B;  1WDX A;  3I9Q A;  1S72 T;  3OYC A;  1O75 A;  2DIL A;  2W10 A;  3HHT B;  5LJ5 g;  2QAZ A;  3VS6 A;  3HRS A;  2KT8 A;  1JXO A;  2RI3 A;  2EBP A;  3WVD B;  5DY9 A;  1Y7X A;  4N0A C; 
#chains in the Genus database with same CATH homology
 1Q81 R;  1VQ9 Q;  3CC2 Q;  3G6E Q;  3CCQ Q;  1Q82 R;  3CC4 Q;  1VQ6 Q;  1VQ7 Q;  3CCL Q;  1JJ2 P;  3CC7 Q;  2OTJ Q;  3CCR Q;  1QVF P;  1YHQ Q;  3CD6 Q;  1VQO Q;  3I56 Q;  3CCJ Q;  1YIT Q;  2QEX Q;  1KQS P;  3CCE Q;  2OTL Q;  1YJW Q;  2QA4 Q;  1VQ5 Q;  3CXC P;  1NJI R;  3CPW P;  3CCU Q;  1YJN Q;  1VQL Q;  1VQN Q;  1K9M R;  1Q7Y R;  1QVG P;  1YI2 Q;  3OW2 P;  1VQM Q;  1KC8 R;  1Q86 R;  3CCS Q;  3G4S Q;  1VQK Q;  3CMA Q;  1K73 R;  1M90 R;  3CCV Q;  3I55 Q;  1YIJ Q;  1S72 Q;  1W2B P;  3CME Q;  3CCM Q;  1VQP Q;  1N8R R;  3G71 Q;  1M1K R;  1VQ8 Q;  1YJ9 Q;  1KD1 R;  1VQ4 Q;  1K8A R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...