1KD1R

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2001-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1kd1R00
3G6EQ 3G71Q 1VQOQ 1QVGP 1Q7YR 1VQ4Q 1VQLQ 3CCVQ 1Q86R 3CMEQ 3CPWP 1QVFP 3CC2Q 3CCQQ 2QEXQ 3CCJQ 1VQNQ 3I55Q 1YJWQ 2OTLQ 3CCUQ 3CMAQ 1VQ7Q 1VQ8Q 3CCLQ 3CCSQ 3G4SQ 3CC7Q 1VQ6Q 1Q81R 1S72Q 1YIJQ 3CCEQ 1YJ9Q 3CD6Q 1M90R 2OTJQ 1YITQ 1VQKQ 3CXCP 3CCMQ 1KC8R 3I56Q 1VQMQ 1YJNQ 3CC4Q 1KQSP 1YI2Q 1VQPQ 1N8RR 1K9MR 1K73R 1VQ5Q 1K8AR 1NJIR 1VQ9Q 1KD1R 1JJ2P 2QA4Q 1W2BP 1Q82R 1YHQQ 1M1KR 3OW2P 3CCRQ
chains in the Genus database with same CATH superfamily
1C1AA 1YN8A 1YHQT 5KE3A 3M0SA 4FYWB 4B9XA 2DJZA 2AHJB 1OX8A 1FX7A 4C8QG 4MDXA 2HL3A 1MNEA 1OU8A 2RH2A 4KRTA 4E7ZA 1S72T 1LVKA 4E2FB 3GPLA 5GANf 2K3YA 1VQPQ 2YRCA 4DQ2A 1F1BB 5GANg 1Q82U 3VJPA 1KHCA 1A0NB 3MCAB 3I55Q 2FPFA 2HL5C 1X69A 1YIJT 4AFSC 4K11A 3L1AA 1JEGA 1JB0E 1YNZA 2O4XA 3QWXX 4OVAA 1VYTA 3OB9A 3V7RA 4M75C 4JDSA 2HAXA 1S72A 2P0PA 1YCSB 4X34A 3OYBA 2RQVA 2DX1A 1I1JA 5C0MA 3QPHA 3CCET 5LJ5e 3GOXA 3CCMQ 2DRKA 2C0OA 3CCMA 4M7AD 1MV3A 2HBPA 3JRZA 4PJOF 4L59A 2PNIA 1SRMA 1SKUB 1Y7XA 1M1KR 4M75E 1YITA 5CK9A 3EHQA 5KYWB 1G3WA 1WI7A 4N0AC 2L2PA 5FWBA 1NJIC 4GBQA 3CCLQ 4BDYA 5FRNA 2PVDB 3M0RA 4FSSA 2QG9B 1YJWA 4BE0A 3M9QA 1XQHA 2CKKA 3REBB 3JCMP 1D1CA 1XNIA 1EFNA 5D6XA 4C5EA 5J3BA 3G6EQ 3HTRA 3J7AF 1GL5A 1GCQC 2RHZA 3VYHB 1JU5C 1W1FA 4FCYA 4ME7A 3OQ5A 3ULRB 5KYUB 4MZPA 2DIQA 4N0AA 2IG0A 2RJFA 3I56Q 4J9FA 3OYNA 4C5HA 4PKCC 5KYYB 1G83A 2A7YA 2KYBA 1VIEA 1M2VA 4BE2A 3ZFJA 2K5FA 3M55A 4JS5A 2VB6A 3I55A 1K8AU 3NGPA 4MDWA 1TWBA 4JRQA 4AT1B 1I07A 2CP3A 1UDLA 2YRDA 4M78A 4YTLA 4DEYA 3G71A 3VYGA 1WNLA 2OI3A 2VGMA 1OV3A 1ZLMA 3DB4A 2DBMA 2FVUA 4HXJA 1OQKA 1Q7YU 4R0KA 3FRNA 2CZ7B 3ZBDA 2I2LA 2FZKB 4XTWA 3C0CA 2RHXA 1YCYA 3CCVT 2MF2A 3UA7A 1I5OB 4ZTJA 1UGQB 4KUIA 3PTAA 3VKIA 2EWNA 2DILA 2GFUA 2E3IA 1M90R 1H641 3O8VA 1PSEA 1VQPA 2HQEA 2HEQA 2ZGWA 4X9DA 2LCSA 3SWNB 4C92A 2KQWA 3HP9A 5CQYA 4BB7A 1EZZB 2WACA 3UA6A 3JCMd 5IT9E 3VS0A 5CO7A 2RD1A 3H8ZA 3CCLA 3A8MB 2H3JA 3CMAQ 1YWOA 1H3ZA 4QQ6A 2VASA 1B34B 1YHQA 3TSZA 4AG2C 2DZCA 4FL6A 4A54A 1YITT 4M75G 3ZEHA 5GANd 3CXCS 4M7AC 1KG1A 4OB3B 4CC4B 2KNBB 2LNVA 1QVFP 4M75A 5C6SA 1PSFA 3S3OA 2NYSA 2X3XD 1D0ZA 1K9AA 1AZEA 2RB6A 3L42A 1MNDA 3CCSQ 4DBRA 2GF7A 2OAWA 3CBOA 3JCMf 4ZGJB 1UJYA 2KEAA 1K9MU 5LJ3d 4M77C 4QKUA 3OYLA 5IXFA 3EGUA 3I5RA 2PU9B 3X25B 3CEYA 1RUWA 8ATCB 3DLLA 2JMAA 5ECAA 1VQOT 4X1VA 4JJBA 4MMLA 4OGCA 4FW1A 2EYWA 5DLOA 2P0QA 1M90U 1N8RC 1SEMA 2F2XA 2R5MA 5A0GA 2KXCA 4HKEA 2FB7A 2E12A 1NYFA 2FEIA 4EMKA 1JJ2P 2GGRA 1U1TA 2RHIA 2RJCA 2KRNA 1RABB 2CP5A 5D7UA 2IPOB 2DO3A 1YJWT 3CC7Q 3VS2A 1RACB 4NOYA 5KYWA 3ER0A 3M58A 4BI3A 3HKSA 2JT4A 2KGTA 2KXDA 1WJRA 4F04B 4RMOA 1WQ7A 4XU0A 3ME9A 4ZN1A 3J81E 4M7DA 2JZ2A 3JB9H 5I2MA 2YLCA 4JRIA 3CPWA 1M1KU 3TVTA 2DL4A 4C0ZA 1KSWA 3H0IA 3QBYA 1ZA1B 3QXEB 1RAFB 1G2BA 1U5SA 1YITQ 2QTVA 2DTIA 3E9GA 1G8XA 4CRIA 4M7DF 1VQ7A 3AHUA 3OW2A 1NZ9A 5D6YA 1NYGA 3UDCA 1KJWA 1AVZC 2EBPA 4Y92A 4Q5WA 3CC2T 3OBYA 2WSFE 2RA2A 2GCXA 1Q7YC 1RAIB 3A98A 1PM3A 3H0HA 3QDFA 1X6GA 2FZGB 3SDZA 5LJ5j 1MMGA 3V7CA 1JO8A 2E65A 1ZSZC 2X51A 5GAN3 1W70A 4DOVA 1KD1U 4P5NA 1UFFA 1M9SA 4WF2A 3JCMV 1JRIA 1KQSA 2MMPA 1Y07A 1GBQA 4AFQC 1ACMB 1WJQA 1VQOQ 5GJWB 2JNGA 1VQKT 3JSCA 2LX7A 2JN0A 2MCNA 3CCST 3L2WA 4HCKA 1K0XA 2JM8A 2E4HA 2GQVA 1Y96A 1QKWA 1WX6A 4LD9K 5DLQE 3QDRB 4X9CA 3PVLA 2K9GA 4IUUA 2JS0A 4M78B 4J83A 3OMCA 3G71Q 1IREB 3OYCA 3OY9A 3CMEQ 2CT3A 1VQLA 2FHDA 4Z89A 2DZ9A 5IXBA 2VUBA 1ZA2B 3KFVA 3PGGA 2O88A 1NG2A 2K79A 4EIKA 5LJ3h 3E2UA 4HCCA 2D0NA 1I0CA 5LL6S 3BY7A 1VQ8T 3GBQA 4F7UF 3QYHB 2KY9A 1RAGB 1ARKA 1V1CA 1ZBJA 1RLQC 1KFZA 3I9QA 3A8OB 3L2RA 4XTVA 2RN8A 2RPNA 1FMWA 3DKMA 2HDAA 1M2VB 4N4GA 2HCKA 3M59A 4M7AB 3CD6T 1YP5A 5HKCA 2G6FX 2RM4A 2LRQA 4A63B 4JLGA 1K73U 1VQ8Q 5KYXB 3CCRT 2HD0A 1E6GA 1ZHIA 1U8RA 2ED1A 1BI1A 4Y28E 1YJNA 2WSEE 1VQ5Q 2J06A 1ABOA 2JM9A 2VC8A 1M5Q1 4EMGA 4LE9A 4MMKA 2ENMA 5CKHA 4GLKA 1VQ7T 4JJNK 1NPRA 1AD5A 4M77A 3VS4A 1N6AA 4BI4A 2A36A 4M7DC 3S3MA 3CPFA 3QSUA 1AZGB 1VQPT 1YFNA 5GAN2 4CC3A 2QDYB 1KHIA 4RTXA 4E47A 4JRKA 1QVFA 3OYYA 3PIOA 1AWWA 4IIOA 4IUQA 5GAN6 2L3QA 3CCMT 2X4JA 3L2ZA 4J9GA 2L5QA 1B34A 5GMKl 3PIPA 2EQMA 1WXBA 4WTOB 3OSVA 1HD3A 4IUTA 2G3RA 1PKTA 2CP0A 2GNCA 3MEAA 3UATA 3EG0A 5I22A 4RUGA 4II1A 2JMCA 2ED0A 3EG3A 4DBFA 2QA4A 2NUZA 4PJJA 2GQIA 4PJOD 2ZZDA 3EG1A 4M7AE 4LN2A 2OJ2A 1NJIU 3UPUA 2LQWA 1QCOA 1EIFA 1N8RU 2O9SA 5GANe 4ZN3A 4PJLA 2SEMA 3CMEA 4FSXA 4RTWA 4EMHA 3UF4A 2R58A 3JAME 1OPLA 4ORZA 4C0DC 1S72Q 3THKA 2BKDN 4GY5A 1VYUA 3PVQA 4C92E 1PHTA 4M78C 1RAEB 1BB9A 3R6NA 4M77D 3X20B 4A4GA 5IHKA 1WHGA 4JS4A 3M0PA 3BW1A 2LX9A 1Q86R 4E6RA 1O75A 5FWCA 1PD0A 2CS7A 1XOVA 4D8KA 5HK3A 2M16A 4PJOB 2BZXA 3CBPA 2EKOA 3J80E 2DD5A 2DFUA 3S6WA 4PJOG 1QWEA 5GAN7 2HKNA 4OMQA 3CMAA 2K3BA 2MIOA 2HQHA 1QKXA 2DL7A 2CDTA 4ZGDB 5J39A 1ZSZA 3AT1B 2E70A 1ABQA 2RQWA 1TOVA 1NE8A 5FRMA 3VUZA 4E7SA 1ZQ1A 1YJNQ 3QHSA 2E3HA 1D0YA 3TCJA 1V76A 3JCMh 5LJ3f 2DL5A 3RBBB 3OS5A 1ZBXA 2MWPA 3MP8A 2YWWA 1QCNA 4E7KA 4CC7A 1KQ1A 2ROLA 4DBQA 1ZUUA 1VQMT 4QVZA 4WCIA 1JBMA 1N9SA 2DBKA 1MMNA 4OMNA 4QW2A 4B6MA 1R0CB 3NFCA 1AWXA 1SPKA 2JXBA 2VWFA 5GAOm 2MI6A 1UGPB 2EPDA 1FMKA 5I2SA 3HPWA 4HA8A 1GFDA 2JS2A 2VYTA 1VQLQ 2EQJA 2NUPB 1TXQA 2QTXA 5KH6A 2CZ1B 2QI2A 4RTYA 3IQLA 2K6DA 2COYA 2IVWA 4PFPA 2DKGA 1M1GA 2O31A 2RQTA 1Y96B 1OOTA 1Z9QA 3OS0A 3LWIA 5A2QE 4PJOE 4A4HA 4C92D 2O2OA 4FU6A 3CCEA 2PUOB 4GLMA 4M7DD 1IZ6A 3LWHA 3S3NA 4M75D 2A28A 4NL3A 3M5AA 4FYVB 4LUDA 4KGZB 1VQLT 1PRLC 1BBZA 2KROA 4OMFB 4OGEA 3NPFA 1UHCA 2VXEA 2XHCA 2HSEB 3E9FA 3CCJT 3JB9D 1TG0A 4C5GA 1KD1R 4M77B 2DMOA 2LJ3A 4D6WA 2YSQA 1SHFA 3MO8A 2QYZA 3URGA 4XTUA 1TH7A 2K5LA 2YXYA 2LT1A 3RMSA 1VQKQ 2QQAA 4ANJA 1MV0B 2OX7A 1K0SA 3NTKA 2RJDA 4FYXB 3VS7A 2R5AA 2J6KA 4F14A 4QVDA 3MEWA 3EAEA 1KC8C 5CIUA 3X28B 3FLGA 1SHGA 3X26B 2JVVA 4OP0A 5EC7A 1GXIE 4JZ3A 2AK5A 1X2QA 5GAN8 1HXDA 1D1BA 2RMOA 2C0TA 2DL8A 3ZL7C 2DPPB 2IIMA 2AKLA 3L2QA 3META 5GAMf 3MJXA 1QCFA 4J6WA 4FM4B 4OB0B 5FROA 4HVWA 2BE7D 2CH4W 2LJ1A 1VQNQ 3V7SA 2BZ8A 1M8MA 5GAMd 3OMGA 1CKBA 3JCMe 4OMMA 3CCVA 1OZ2A 1FMVA 4R55A 2CT4A 3CC7A 4NS5A 2DIGA 1IO6A 3TQ7P 3MP6A 3NTHA 2ZPEB 4PNOA 2ZPHB 3I56A 4MZMA 2DNUA 2P0KA 4M7DE 4BE1A 2LC4A 2GTJA 2ZPFB 3A8HB 1B07A 2H8HA 4B9WA 3G4SQ 2V1RA 1X6OA 1QQJA 2DAQA 1KIKA 4OB1B 2FG0A 3VS1A 1E7OA 3GNFB 1Q86C 2SRCA 3A8GB 2EYQA 1TS9A 2ZPGB 3EH2A 3FJPA 1G3YA 2RQUA 2O01E 1M3BA 1PNJA 1VOMA 2YDLA 1VQ4Q 2E5QA 4J9BA 2M0OA 3M57A 4PJNA 1OYXA 2V1QA 2D8JA 1Q81R 3N5BB 2EGCA 3UT1A 3JCMJ 2Y90A 1NPPA 2HSPA 1VQ8A 2F5TX 2V8JA 1PCXA 1XTDA 2LT4A 1K8AC 3MEVA 1WPYA 1NM7A 2RI5A 5GANh 4AMCA 1Z9ZA 5KYNA 2QQSA 3FB9A 2VGNA 1SRLA 2CREA 4XU2A 4D8DA 1UHFA 5KYYA 1K1ZA 3E1SA 2FPEA 1JJ2A 2CH4A 5FW9A 1YHQQ 4OF1A 1VQNT 3FC3A 4IKFA 2RK2A 5GMKe 1WZOA 3SB2A 1K76A 3QZ9B 3LGLA 4XU1A 2K57A 4E7IA 3M54A 3BDLA 1I8FA 5EG2A 1M3AA 1WQWA 1VA7A 2EVRA 2KI7A 2LQ8A 3MPUB 4LDXA 5FLXE 2RI3A 1M3CA 2EIFA 4C8QC 5CVIA 3V8KA 3CCEQ 4XU3A 4J7FA 4HVUA 2YRVA 3EGDA 3WVDB 1UUEA 1KQSS 1N8RR 1UGVA 4EDUA 4A4EA 1UECA 4XAXB 4C92B 5DM7R 3OA6A 1Q82R 3C94A 4RTVA 2MWOA 1SF9A 1QVGP 4J9DA 3LH0A 3EG2A 3LX7A 2E5KA 5GAMh 5LJ5h 2EGEA 4V2SA 3OW2S 3OYKA 2DJQA 1KC8R 1M30A 3EHRA 2KDSA 2MYSA 1WYXA 4M7AG 3JB9I 4LUEA 3JV3A 2CUBA 1Y71A 5AT1B 1BI3A 4J9CA 1TUGB 1LPLA 3A5ZB 3EGXB 1J3TA 2LCCA 2QXFA 2AKKA 1G3TA 1BIAA 3SWNC 3CPWS 4A4KA 1AWJA 1Q82C 3JB9J 5J26A 2O9VA 2DL3A 3I5SA 4M78F 4XTZA 4L5GA 2ABLA 1M90C 2YT6A 5LJ5g 1T0JA 1BK2A 2D8HA 5KE2A 4QQDA 4KGVB 2DEQA 1AWOA 4O5VA 4DBHA 4O6JA 1QVGA 5KCOA 1LNXA 3OYDA 1Y0MA 2PQWA 3BDUA 1UEBA 2ZPIB 1YJ9Q 2ATCB 2MAMA 3RESA 4MZTA 4Z02A 5CKEA 2KRMA 3FIFA 4M77E 5GAN4 5CCAA 2KK4A 1W6XA 1IHVA 3SFMA 3JCMb 4OMPA 4EMKB 1W2BA 2HBWA 2AZVA 2P4TA 2M51A 3CCVQ 2E6ZA 2K4YA 3RKYA 2DERA 2F2VA 1WHKA 3JCMQ 4LNPA 2E10A 4PLLA 2LZ6B 1NEGA 1RAAB 4C0DB 2HZYA 2GFAA 1AHJB 2W10A 1AEYA 2XI9A 4HCBA 4KT0E 1RL2A 4N4HA 2DF6A 3OYMA 1QP3A 1VYVA 1U3OA 4HT9A 2EQIA 1AT1B 3EH1A 4PFOA 3WVEB 2BUDA 3CBMA 2XK0A 1OZ3A 1CSKA 4J9IA 2EGAA 3VV0A 2KMTA 3CXCA 2O4XB 1OI1A 4C8QE 2OTLT 2A37A 2J05A 2Y4YA 2CUDA 2PTKA 1PKSA 3VS5A 7AT1B 1GRIA 2RHUA 4IIMA 3CCJQ 3CMAT 1BI2A 1JJ2S 3GNGA 5GAOq 1AOJA 3Q1JA 4CI0C 1FYNA 2EJ9A 2DYBA 9ATCB 2BTTA 1OU9A 2L3PA 1GFCA 3SEMA 2MK5A 1CKAA 3CCRA 3HRUA 3OYAA 5GAOn 3CCRQ 2V8IA 1VQ9A 4E7LA 4KGXB 1N27A 4ZTFA 3L2VA 2K7AA 3RNJA 3EFOB 2FZCB 1BYMA 5DY9A 1NLOC 4JJDA 1TSFA 4AG1C 3CD6Q 3PMIA 3CXCP 3I55T 1MUZA 3V8JA 4M78D 4PJMA 1MMDA 3NHNA 4PL6A 1I81A 4DA4A 3EGDB 3RDVA 1H3HA 1HSQA 2LCLA 3CCQQ 2KBTA 3QKJA 4A53A 1VQ5T 2EJGA 4CC2A 3H9NA 1W2BS 1X27A 3LLRA 2AT1B 4BI8B 5GJVB 5CQXA 2GBQA 4F17A 2FO0A 2CSIA 4ESRA 3UWNA 1YBYA 4C8QB 3H6ZA 2A0FB 4RTZA 1YWPA 2CGHA 1QVGS 3EG9B 1YJ9A 3SD4A 1VUBA 1T0HA 3JB9F 4J9EA 3HFOA 5LJ5d 4M78E 4HVVA 2RHYA 3EFSA 1KQSP 2HMAA 4FYYB 1VQNA 1VQ6A 3LW5E 3CCLT 2XD0A 2KR3A 4M77G 2E64A 4J5YA 4E7HA 4Z8AA 2ECZA 3GLXA 4M7AA 4HCZA 3M4YA 3HL8A 1YJWQ 2XMFA 1XJWB 1UTIA 3TEEA 2DD4A 1D3BA 1KC8U 3PNWC 4LDWA 5GMKh 1BI0A 3EGXA 3JCMW 1PRMC 2OAUA 2P4RA 4RG8A 1LCKA 1UGRB 2DRMA 4C92F 1VQ9Q 3M0TA 1WA7A 5CAIA 2D1XA 1OX9A 2RJEA 1U1SA 1B3QA 2X4YA 4BACA 2J6FA 2DVEA 5GAMe 2B86A 5FU7B 2XDBA 2FRYA 1SG5A 2K3XA 2D6FA 4J6YA 5GMKi 3BFMA 1WIEA 5D6WA 4J9HA 5IHNA 4C92G 3CCUT 5GAOl 1KD1C 3GP8A 1T3LA 2GTOA 3JCMg 4JRPA 1VQ4T 2R57A 4RCBA 2DXBA 3OYEA 3QJYA 2E6NA 3H41A 1VQKA 2PZ1A 4DOWA 3I35A 1S1NA 3CCQT 3CCQA 2BZYA 3CC2Q 4AFUC 2CP6A 3OS2A 1I5LA 3VS3A 1WHHA 1Q95G 1BKBA 4M77F 1NBEB 1OULA 3BE3A 2YUOA 5GAN5 2KAFA 4XQ3A 3JB9G 2DXTA 2MPXC 2NUTB 2RQRA 4F7UA 1ZUYA 2ESWA 2JTMA 3HHTB 4XTXA 4Y91A 4F7UG 4RG2A 4ZGEB 1TUDA 1BIBA 2NLUA 3QWYA 1QWFA 2L89A 2XKOC 1KQ2A 3VS6A 3TU4K 4TVRA 1X43A 3PE0A 1W2BP 2DM1A 2BE9B 2D0QB 3VRYA 1X01A 3U23A 2LJ0A 2WSCE 5GAMj 1BCMA 3VUBA 4EMKC 3ASKA 1TU0B 1WFWA 2VXFA 4XTYA 2DXCA 2LP5A 3HRSA 2J7IA 3OYGA 3EFOA 3LYIA 1D09B 1ZX6A 3KBGA 1N9RA 3OSSC 3QG1A 5FU6C 1K8AR 1ZUKA 4M7DB 5L8RE 3M53A 2EYYA 1M27C 3C4SA 4KH0B 2A3LA 1NEBA 3GF5A 2EFIA 3QIIA 3CCUQ 1FXXA 2XDDA 1VQ4A 1M2OA 3RUXA 4OMOA 1H8KA 3VU3C 4KUDK 2DXUA 3SHWA 4PFZA 3QUIA 3OYJA 3INZA 2XG8D 1LJOA 4ATOA 2ROTA 1WHLA 1WHJA 4L6V5 2DE0X 2EYXA 2L0AA 1EX4A 1JXMA 1UB4A 3TREA 1YJ9T 3CC2A 4R56A 3CCJA 1QMCA 1ZSZB 3L2UA 3OS1A 2YHTA 2EAYA 5LJ3e 2DLPA 4M7DG 4E7JA 4C0GA 1YIJQ 1NLPC 1G3SA 1YIJA 3FJ5A 4J6XA 2F1LA 4LDUA 1Q81C 1IXDA 1NJIR 4LDVA 1MGQA 2XICA 3D7SB 2ZPBB 4LDYA 1PC0A 1QVPA 5GMKj 4C92C 2C0IA 1HK9A 1SSFA 4N4IA 3E19A 5I21A 4PK4A 1JQQA 1M1FA 3NTIA 2COWA 3G1JA 4J7IA 1I4K1 4C8QA 1RADB 4DEXA 3X24B 3EG9A 2YUQA 5IHIA 3RR6A 3GIBA 2NUPA 2DTHA 3LGFA 2EQUA 2OTLQ 1R0BG 2FRWA 2EW3A 2HNIA 2OTLA 2X3WD 3A8LB 1VQ6Q 1RAHB 2M02A 1V29B 3WXMB 1VQMQ 4OB2B 4ZNXA 1IHWA 1VQMA 2QDLA 1K73R 3NMZC 3PMTA 1D0XA 1WGSA 3MHXA 4IUVA 1D3BB 3DLMA 2KYMA 2FPDA 3A1PA 5LJ3j 1PD1A 1P92A 2J6OA 2B8AA 1U06A 1VIFA 3QJ6A 4PJOC 4UC4A 1IGQA 4FT4A 4M78G 1VQ6T 3QYGB 2QGFB 1GCQA 1OEBA 3FDRA 1QVFS 3CPWP 1MMAA 3C12A 5CKFA 1W4SA 1UGSB 4ELZC 2QK0A 5KYXA 3CC7T 5A0DA 1K4US 3P8HA 4PLIA 4LXCA 1QLYA 4M75F 4M7AF 4LD6A 3OYIA 1M8VA 2X4XA 2E1HA 3G4SA 2F69A 4QVCA 2CP2A 2BIVA 2X4WA 3OW2P 5HK0A 3CCSA 2PVOB 2PUKB 2V26A 3CCUA 2AIRB 2X9HA 1K73C 2DK3A 1UJ0A 1QW1A 2NUTA 2AZSA 2CYZB 2M1HA 4F7UB 3CMET 2CSQA 2DA9A 4JZ4A 4C8QD 1YI2Q 3R6OA 2JUFA 2QEXT 3P8DA 6AT1B 1D1AA 3DB3A 2VVKA 3F70A 2Y4XA 2A08A 2E41A 2DYIA 2DETA 2LVMA 4OMLA 1C6VX 1O9SA 1X75C 5IN1A 2LTOA 2YUNA 2L3SA 4NL2A 4QT7A 4ELYC 3QO3A 1G5VA 2L8DA 5FU6B 1GBRA 2XU8A 3REAB 3M56A 1Q81U 3OBWA 3I56T 2HKQB 3MKDA 3OYHA 3FEOA 1LOJA 2QEXQ 1HYOA 3CC4T 3RERA 2YLBA 1K9MC 1VQ9T 2EQKA 1PWTA 4Z88A 2NWMA 5KCHA 4BY6B 2OTJA 4RTTA 3MP1A 2RF0A 1MHNA 5I11A 4QQGA 2FL7A 2LQKA 2XDPA 1OPKA 4C0FA 3H0FA 2P84A 4FT2A 1Q7YR 2K2MA 3HSBA 3V8LA 3VRZA 1X6BA 5KYUA 2F2WA 2EKHA 1WXTA 1QP2A 2OTJT 1JXOA 1PG5B 2K5IA 3CQTA 1WJSA 2W0ZA 3CC4Q 4JJCA 2JOYA 4A4FA 3JCMX 1KK7A 1Y57A 4F7UE 1YJNT 3G71T 5IAYA 4PJOA 2KSSA 3M0UA 3EFRA 3T9NA 1X2KA 2RO0A 5GAMg 5AYFA 2DEUA 2V8KA 3JCMc 2HQXA 2L3RA 1M1KC 3CD6A 2KT8A 2QA4Q 2CZ6B 4IURA 3KXTA 4J8OA 4F16A 2QQBA 3RIRA 4C5IA 4JPBW 2CP7A 3TSWA 1WLPB 4IUPA 1Q86U 3M4GA 2EJFA 4BD3A 1WXUA 5M9OA 1YI2T 2XIDA 3OYFA 3RMQA 3HFNA 2QEXA 1B7TA 2QQ9A 2DVJA 3C95A 5IH2A 1SSHA 1RI9A 2RI2A 3G4ST 4RKUE 5CKBA 5GMKm 3RKWA 4VUBA 5GAOp 3G7ZA 1DJ7B 4HT8A 2H3EB 1YI2A 4JLIA 2ZCFB 1IRXA 4C8QF 2RK1A 1K9MR 4RCCA 4KBMB 2QAZA 3MEUA 2JJ9A 2M0YA 5GAOr 2KVQG 5A0LA 3RKXA 2RNAA 1BCOA 4KULA 1VQ7Q 2K2VA 2LNHB 1HJDA 3CC4A 1M4ZA 4M4ZA 1UG1A 1FWZA 1R8OB 3KUFA 2YUPA 4BY6C 5GANj 1IB8A 1N5ZA 1RI0A 1C0MA 4JUVA 5LJ5f 3P8BB 5FU7C 2ZAEA 2JW4A 2PVGB 3O5ZA 3G6EA 3LH5A 3M0QA 5CR2A 2DTOA 2JTFA 5L23A 3QZ5B 2LQNA 1WDXA 1VQ5A 2LMJA 1R77A 2COZA 2F5KA 1RLPC 1VQOA 4EPCA 2KT1A 2VV5A 2I0NA 2OTJQ 2X35A 1E6HA 2EYZA 1IGUA 2CZ0B 2QGGA 2KE9A 4XK8E 4FW2A 8AT1B 2QA4T 1T3SA 2JTEA 2MOXA 5HY6A 2LDMA 3PFSA 3PT9A 2QQRA 3G6ET 2M9UA 2QASA 1TTHB 2D9TA 2KRSA 4AFZC 2VKNA 2C06A 1BU1A 3SWNA 2FYKA 1H92A 4BDZA 4M75B 2Z0WA 4BUGA 5LJ3g 5HCKA 1GCPA 1ZSGA 3HRTA 4KH1B 1UE9A 4FIBA 1TUCA 5CKDA 4RTUA 1WHMA
chains in the Genus database with same CATH topology
3G6EQ 3G71Q 1VQOQ 1QVGP 1Q7YR 1VQ4Q 1VQLQ 3CCVQ 1Q86R 3CMEQ 3CPWP 1QVFP 3CC2Q 3CCQQ 2QEXQ 3CCJQ 1VQNQ 3I55Q 1YJWQ 2OTLQ 3CCUQ 3CMAQ 1VQ7Q 1VQ8Q 3CCLQ 3CCSQ 3G4SQ 3CC7Q 1VQ6Q 1Q81R 1S72Q 1YIJQ 3CCEQ 1YJ9Q 3CD6Q 1M90R 2OTJQ 1YITQ 1VQKQ 3CXCP 3CCMQ 1KC8R 3I56Q 1VQMQ 1YJNQ 3CC4Q 1KQSP 1YI2Q 1VQPQ 1N8RR 1K9MR 1K73R 1VQ5Q 1K8AR 1NJIR 1VQ9Q 1KD1R 1JJ2P 2QA4Q 1W2BP 1Q82R 1YHQQ 1M1KR 3OW2P 3CCRQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E Q;  3G71 Q;  1VQO Q;  1QVG P;  1Q7Y R;  1VQ4 Q;  1VQL Q;  3CCV Q;  1Q86 R;  3CME Q;  3CPW P;  1QVF P;  3CC2 Q;  3CCQ Q;  2QEX Q;  3CCJ Q;  1VQN Q;  3I55 Q;  1YJW Q;  2OTL Q;  3CCU Q;  3CMA Q;  1VQ7 Q;  1VQ8 Q;  3CCL Q;  3CCS Q;  3G4S Q;  3CC7 Q;  1VQ6 Q;  1Q81 R;  1S72 Q;  1YIJ Q;  3CCE Q;  1YJ9 Q;  3CD6 Q;  1M90 R;  2OTJ Q;  1YIT Q;  1VQK Q;  3CXC P;  3CCM Q;  1KC8 R;  3I56 Q;  1VQM Q;  1YJN Q;  3CC4 Q;  1KQS P;  1YI2 Q;  1VQP Q;  1N8R R;  1K9M R;  1K73 R;  1VQ5 Q;  1K8A R;  1NJI R;  1VQ9 Q;  1KD1 R;  1JJ2 P;  2QA4 Q;  1W2B P;  1Q82 R;  1YHQ Q;  1M1K R;  3OW2 P;  3CCR Q; 
#chains in the Genus database with same CATH topology
 1C1A A;  1YN8 A;  1YHQ T;  5KE3 A;  3M0S A;  4FYW B;  4B9X A;  2DJZ A;  2AHJ B;  1OX8 A;  1FX7 A;  4C8Q G;  4MDX A;  2HL3 A;  1MNE A;  1OU8 A;  2RH2 A;  4KRT A;  4E7Z A;  1S72 T;  1LVK A;  4E2F B;  3GPL A;  5GAN f;  2K3Y A;  1VQP Q;  2YRC A;  4DQ2 A;  1F1B B;  5GAN g;  1Q82 U;  3VJP A;  1KHC A;  1A0N B;  3MCA B;  3I55 Q;  2FPF A;  2HL5 C;  1X69 A;  1YIJ T;  4AFS C;  4K11 A;  3L1A A;  1JEG A;  1JB0 E;  1YNZ A;  2O4X A;  3QWX X;  4OVA A;  1VYT A;  3OB9 A;  3V7R A;  4M75 C;  4JDS A;  2HAX A;  1S72 A;  2P0P A;  1YCS B;  4X34 A;  3OYB A;  2RQV A;  2DX1 A;  1I1J A;  5C0M A;  3QPH A;  3CCE T;  5LJ5 e;  3GOX A;  3CCM Q;  2DRK A;  2C0O A;  3CCM A;  4M7A D;  1MV3 A;  2HBP A;  3JRZ A;  4PJO F;  4L59 A;  2PNI A;  1SRM A;  1SKU B;  1Y7X A;  1M1K R;  4M75 E;  1YIT A;  5CK9 A;  3EHQ A;  5KYW B;  1G3W A;  1WI7 A;  4N0A C;  2L2P A;  5FWB A;  1NJI C;  4GBQ A;  3CCL Q;  4BDY A;  5FRN A;  2PVD B;  3M0R A;  4FSS A;  2QG9 B;  1YJW A;  4BE0 A;  3M9Q A;  1XQH A;  2CKK A;  3REB B;  3JCM P;  1D1C A;  1XNI A;  1EFN A;  5D6X A;  4C5E A;  5J3B A;  3G6E Q;  3HTR A;  3J7A F;  1GL5 A;  1GCQ C;  2RHZ A;  3VYH B;  1JU5 C;  1W1F A;  4FCY A;  4ME7 A;  3OQ5 A;  3ULR B;  5KYU B;  4MZP A;  2DIQ A;  4N0A A;  2IG0 A;  2RJF A;  3I56 Q;  4J9F A;  3OYN A;  4C5H A;  4PKC C;  5KYY B;  1G83 A;  2A7Y A;  2KYB A;  1VIE A;  1M2V A;  4BE2 A;  3ZFJ A;  2K5F A;  3M55 A;  4JS5 A;  2VB6 A;  3I55 A;  1K8A U;  3NGP A;  4MDW A;  1TWB A;  4JRQ A;  4AT1 B;  1I07 A;  2CP3 A;  1UDL A;  2YRD A;  4M78 A;  4YTL A;  4DEY A;  3G71 A;  3VYG A;  1WNL A;  2OI3 A;  2VGM A;  1OV3 A;  1ZLM A;  3DB4 A;  2DBM A;  2FVU A;  4HXJ A;  1OQK A;  1Q7Y U;  4R0K A;  3FRN A;  2CZ7 B;  3ZBD A;  2I2L A;  2FZK B;  4XTW A;  3C0C A;  2RHX A;  1YCY A;  3CCV T;  2MF2 A;  3UA7 A;  1I5O B;  4ZTJ A;  1UGQ B;  4KUI A;  3PTA A;  3VKI A;  2EWN A;  2DIL A;  2GFU A;  2E3I A;  1M90 R;  1H64 1;  3O8V A;  1PSE A;  1VQP A;  2HQE A;  2HEQ A;  2ZGW A;  4X9D A;  2LCS A;  3SWN B;  4C92 A;  2KQW A;  3HP9 A;  5CQY A;  4BB7 A;  1EZZ B;  2WAC A;  3UA6 A;  3JCM d;  5IT9 E;  3VS0 A;  5CO7 A;  2RD1 A;  3H8Z A;  3CCL A;  3A8M B;  2H3J A;  3CMA Q;  1YWO A;  1H3Z A;  4QQ6 A;  2VAS A;  1B34 B;  1YHQ A;  3TSZ A;  4AG2 C;  2DZC A;  4FL6 A;  4A54 A;  1YIT T;  4M75 G;  3ZEH A;  5GAN d;  3CXC S;  4M7A C;  1KG1 A;  4OB3 B;  4CC4 B;  2KNB B;  2LNV A;  1QVF P;  4M75 A;  5C6S A;  1PSF A;  3S3O A;  2NYS A;  2X3X D;  1D0Z A;  1K9A A;  1AZE A;  2RB6 A;  3L42 A;  1MND A;  3CCS Q;  4DBR A;  2GF7 A;  2OAW A;  3CBO A;  3JCM f;  4ZGJ B;  1UJY A;  2KEA A;  1K9M U;  5LJ3 d;  4M77 C;  4QKU A;  3OYL A;  5IXF A;  3EGU A;  3I5R A;  2PU9 B;  3X25 B;  3CEY A;  1RUW A;  8ATC B;  3DLL A;  2JMA A;  5ECA A;  1VQO T;  4X1V A;  4JJB A;  4MML A;  4OGC A;  4FW1 A;  2EYW A;  5DLO A;  2P0Q A;  1M90 U;  1N8R C;  1SEM A;  2F2X A;  2R5M A;  5A0G A;  2KXC A;  4HKE A;  2FB7 A;  2E12 A;  1NYF A;  2FEI A;  4EMK A;  1JJ2 P;  2GGR A;  1U1T A;  2RHI A;  2RJC A;  2KRN A;  1RAB B;  2CP5 A;  5D7U A;  2IPO B;  2DO3 A;  1YJW T;  3CC7 Q;  3VS2 A;  1RAC B;  4NOY A;  5KYW A;  3ER0 A;  3M58 A;  4BI3 A;  3HKS A;  2JT4 A;  2KGT A;  2KXD A;  1WJR A;  4F04 B;  4RMO A;  1WQ7 A;  4XU0 A;  3ME9 A;  4ZN1 A;  3J81 E;  4M7D A;  2JZ2 A;  3JB9 H;  5I2M A;  2YLC A;  4JRI A;  3CPW A;  1M1K U;  3TVT A;  2DL4 A;  4C0Z A;  1KSW A;  3H0I A;  3QBY A;  1ZA1 B;  3QXE B;  1RAF B;  1G2B A;  1U5S A;  1YIT Q;  2QTV A;  2DTI A;  3E9G A;  1G8X A;  4CRI A;  4M7D F;  1VQ7 A;  3AHU A;  3OW2 A;  1NZ9 A;  5D6Y A;  1NYG A;  3UDC A;  1KJW A;  1AVZ C;  2EBP A;  4Y92 A;  4Q5W A;  3CC2 T;  3OBY A;  2WSF E;  2RA2 A;  2GCX A;  1Q7Y C;  1RAI B;  3A98 A;  1PM3 A;  3H0H A;  3QDF A;  1X6G A;  2FZG B;  3SDZ A;  5LJ5 j;  1MMG A;  3V7C A;  1JO8 A;  2E65 A;  1ZSZ C;  2X51 A;  5GAN 3;  1W70 A;  4DOV A;  1KD1 U;  4P5N A;  1UFF A;  1M9S A;  4WF2 A;  3JCM V;  1JRI A;  1KQS A;  2MMP A;  1Y07 A;  1GBQ A;  4AFQ C;  1ACM B;  1WJQ A;  1VQO Q;  5GJW B;  2JNG A;  1VQK T;  3JSC A;  2LX7 A;  2JN0 A;  2MCN A;  3CCS T;  3L2W A;  4HCK A;  1K0X A;  2JM8 A;  2E4H A;  2GQV A;  1Y96 A;  1QKW A;  1WX6 A;  4LD9 K;  5DLQ E;  3QDR B;  4X9C A;  3PVL A;  2K9G A;  4IUU A;  2JS0 A;  4M78 B;  4J83 A;  3OMC A;  3G71 Q;  1IRE B;  3OYC A;  3OY9 A;  3CME Q;  2CT3 A;  1VQL A;  2FHD A;  4Z89 A;  2DZ9 A;  5IXB A;  2VUB A;  1ZA2 B;  3KFV A;  3PGG A;  2O88 A;  1NG2 A;  2K79 A;  4EIK A;  5LJ3 h;  3E2U A;  4HCC A;  2D0N A;  1I0C A;  5LL6 S;  3BY7 A;  1VQ8 T;  3GBQ A;  4F7U F;  3QYH B;  2KY9 A;  1RAG B;  1ARK A;  1V1C A;  1ZBJ A;  1RLQ C;  1KFZ A;  3I9Q A;  3A8O B;  3L2R A;  4XTV A;  2RN8 A;  2RPN A;  1FMW A;  3DKM A;  2HDA A;  1M2V B;  4N4G A;  2HCK A;  3M59 A;  4M7A B;  3CD6 T;  1YP5 A;  5HKC A;  2G6F X;  2RM4 A;  2LRQ A;  4A63 B;  4JLG A;  1K73 U;  1VQ8 Q;  5KYX B;  3CCR T;  2HD0 A;  1E6G A;  1ZHI A;  1U8R A;  2ED1 A;  1BI1 A;  4Y28 E;  1YJN A;  2WSE E;  1VQ5 Q;  2J06 A;  1ABO A;  2JM9 A;  2VC8 A;  1M5Q 1;  4EMG A;  4LE9 A;  4MMK A;  2ENM A;  5CKH A;  4GLK A;  1VQ7 T;  4JJN K;  1NPR A;  1AD5 A;  4M77 A;  3VS4 A;  1N6A A;  4BI4 A;  2A36 A;  4M7D C;  3S3M A;  3CPF A;  3QSU A;  1AZG B;  1VQP T;  1YFN A;  5GAN 2;  4CC3 A;  2QDY B;  1KHI A;  4RTX A;  4E47 A;  4JRK A;  1QVF A;  3OYY A;  3PIO A;  1AWW A;  4IIO A;  4IUQ A;  5GAN 6;  2L3Q A;  3CCM T;  2X4J A;  3L2Z A;  4J9G A;  2L5Q A;  1B34 A;  5GMK l;  3PIP A;  2EQM A;  1WXB A;  4WTO B;  3OSV A;  1HD3 A;  4IUT A;  2G3R A;  1PKT A;  2CP0 A;  2GNC A;  3MEA A;  3UAT A;  3EG0 A;  5I22 A;  4RUG A;  4II1 A;  2JMC A;  2ED0 A;  3EG3 A;  4DBF A;  2QA4 A;  2NUZ A;  4PJJ A;  2GQI A;  4PJO D;  2ZZD A;  3EG1 A;  4M7A E;  4LN2 A;  2OJ2 A;  1NJI U;  3UPU A;  2LQW A;  1QCO A;  1EIF A;  1N8R U;  2O9S A;  5GAN e;  4ZN3 A;  4PJL A;  2SEM A;  3CME A;  4FSX A;  4RTW A;  4EMH A;  3UF4 A;  2R58 A;  3JAM E;  1OPL A;  4ORZ A;  4C0D C;  1S72 Q;  3THK A;  2BKD N;  4GY5 A;  1VYU A;  3PVQ A;  4C92 E;  1PHT A;  4M78 C;  1RAE B;  1BB9 A;  3R6N A;  4M77 D;  3X20 B;  4A4G A;  5IHK A;  1WHG A;  4JS4 A;  3M0P A;  3BW1 A;  2LX9 A;  1Q86 R;  4E6R A;  1O75 A;  5FWC A;  1PD0 A;  2CS7 A;  1XOV A;  4D8K A;  5HK3 A;  2M16 A;  4PJO B;  2BZX A;  3CBP A;  2EKO A;  3J80 E;  2DD5 A;  2DFU A;  3S6W A;  4PJO G;  1QWE A;  5GAN 7;  2HKN A;  4OMQ A;  3CMA A;  2K3B A;  2MIO A;  2HQH A;  1QKX A;  2DL7 A;  2CDT A;  4ZGD B;  5J39 A;  1ZSZ A;  3AT1 B;  2E70 A;  1ABQ A;  2RQW A;  1TOV A;  1NE8 A;  5FRM A;  3VUZ A;  4E7S A;  1ZQ1 A;  1YJN Q;  3QHS A;  2E3H A;  1D0Y A;  3TCJ A;  1V76 A;  3JCM h;  5LJ3 f;  2DL5 A;  3RBB B;  3OS5 A;  1ZBX A;  2MWP A;  3MP8 A;  2YWW A;  1QCN A;  4E7K A;  4CC7 A;  1KQ1 A;  2ROL A;  4DBQ A;  1ZUU A;  1VQM T;  4QVZ A;  4WCI A;  1JBM A;  1N9S A;  2DBK A;  1MMN A;  4OMN A;  4QW2 A;  4B6M A;  1R0C B;  3NFC A;  1AWX A;  1SPK A;  2JXB A;  2VWF A;  5GAO m;  2MI6 A;  1UGP B;  2EPD A;  1FMK A;  5I2S A;  3HPW A;  4HA8 A;  1GFD A;  2JS2 A;  2VYT A;  1VQL Q;  2EQJ A;  2NUP B;  1TXQ A;  2QTX A;  5KH6 A;  2CZ1 B;  2QI2 A;  4RTY A;  3IQL A;  2K6D A;  2COY A;  2IVW A;  4PFP A;  2DKG A;  1M1G A;  2O31 A;  2RQT A;  1Y96 B;  1OOT A;  1Z9Q A;  3OS0 A;  3LWI A;  5A2Q E;  4PJO E;  4A4H A;  4C92 D;  2O2O A;  4FU6 A;  3CCE A;  2PUO B;  4GLM A;  4M7D D;  1IZ6 A;  3LWH A;  3S3N A;  4M75 D;  2A28 A;  4NL3 A;  3M5A A;  4FYV B;  4LUD A;  4KGZ B;  1VQL T;  1PRL C;  1BBZ A;  2KRO A;  4OMF B;  4OGE A;  3NPF A;  1UHC A;  2VXE A;  2XHC A;  2HSE B;  3E9F A;  3CCJ T;  3JB9 D;  1TG0 A;  4C5G A;  1KD1 R;  4M77 B;  2DMO A;  2LJ3 A;  4D6W A;  2YSQ A;  1SHF A;  3MO8 A;  2QYZ A;  3URG A;  4XTU A;  1TH7 A;  2K5L A;  2YXY A;  2LT1 A;  3RMS A;  1VQK Q;  2QQA A;  4ANJ A;  1MV0 B;  2OX7 A;  1K0S A;  3NTK A;  2RJD A;  4FYX B;  3VS7 A;  2R5A A;  2J6K A;  4F14 A;  4QVD A;  3MEW A;  3EAE A;  1KC8 C;  5CIU A;  3X28 B;  3FLG A;  1SHG A;  3X26 B;  2JVV A;  4OP0 A;  5EC7 A;  1GXI E;  4JZ3 A;  2AK5 A;  1X2Q A;  5GAN 8;  1HXD A;  1D1B A;  2RMO A;  2C0T A;  2DL8 A;  3ZL7 C;  2DPP B;  2IIM A;  2AKL A;  3L2Q A;  3MET A;  5GAM f;  3MJX A;  1QCF A;  4J6W A;  4FM4 B;  4OB0 B;  5FRO A;  4HVW A;  2BE7 D;  2CH4 W;  2LJ1 A;  1VQN Q;  3V7S A;  2BZ8 A;  1M8M A;  5GAM d;  3OMG A;  1CKB A;  3JCM e;  4OMM A;  3CCV A;  1OZ2 A;  1FMV A;  4R55 A;  2CT4 A;  3CC7 A;  4NS5 A;  2DIG A;  1IO6 A;  3TQ7 P;  3MP6 A;  3NTH A;  2ZPE B;  4PNO A;  2ZPH B;  3I56 A;  4MZM A;  2DNU A;  2P0K A;  4M7D E;  4BE1 A;  2LC4 A;  2GTJ A;  2ZPF B;  3A8H B;  1B07 A;  2H8H A;  4B9W A;  3G4S Q;  2V1R A;  1X6O A;  1QQJ A;  2DAQ A;  1KIK A;  4OB1 B;  2FG0 A;  3VS1 A;  1E7O A;  3GNF B;  1Q86 C;  2SRC A;  3A8G B;  2EYQ A;  1TS9 A;  2ZPG B;  3EH2 A;  3FJP A;  1G3Y A;  2RQU A;  2O01 E;  1M3B A;  1PNJ A;  1VOM A;  2YDL A;  1VQ4 Q;  2E5Q A;  4J9B A;  2M0O A;  3M57 A;  4PJN A;  1OYX A;  2V1Q A;  2D8J A;  1Q81 R;  3N5B B;  2EGC A;  3UT1 A;  3JCM J;  2Y90 A;  1NPP A;  2HSP A;  1VQ8 A;  2F5T X;  2V8J A;  1PCX A;  1XTD A;  2LT4 A;  1K8A C;  3MEV A;  1WPY A;  1NM7 A;  2RI5 A;  5GAN h;  4AMC A;  1Z9Z A;  5KYN A;  2QQS A;  3FB9 A;  2VGN A;  1SRL A;  2CRE A;  4XU2 A;  4D8D A;  1UHF A;  5KYY A;  1K1Z A;  3E1S A;  2FPE A;  1JJ2 A;  2CH4 A;  5FW9 A;  1YHQ Q;  4OF1 A;  1VQN T;  3FC3 A;  4IKF A;  2RK2 A;  5GMK e;  1WZO A;  3SB2 A;  1K76 A;  3QZ9 B;  3LGL A;  4XU1 A;  2K57 A;  4E7I A;  3M54 A;  3BDL A;  1I8F A;  5EG2 A;  1M3A A;  1WQW A;  1VA7 A;  2EVR A;  2KI7 A;  2LQ8 A;  3MPU B;  4LDX A;  5FLX E;  2RI3 A;  1M3C A;  2EIF A;  4C8Q C;  5CVI A;  3V8K A;  3CCE Q;  4XU3 A;  4J7F A;  4HVU A;  2YRV A;  3EGD A;  3WVD B;  1UUE A;  1KQS S;  1N8R R;  1UGV A;  4EDU A;  4A4E A;  1UEC A;  4XAX B;  4C92 B;  5DM7 R;  3OA6 A;  1Q82 R;  3C94 A;  4RTV A;  2MWO A;  1SF9 A;  1QVG P;  4J9D A;  3LH0 A;  3EG2 A;  3LX7 A;  2E5K A;  5GAM h;  5LJ5 h;  2EGE A;  4V2S A;  3OW2 S;  3OYK A;  2DJQ A;  1KC8 R;  1M30 A;  3EHR A;  2KDS A;  2MYS A;  1WYX A;  4M7A G;  3JB9 I;  4LUE A;  3JV3 A;  2CUB A;  1Y71 A;  5AT1 B;  1BI3 A;  4J9C A;  1TUG B;  1LPL A;  3A5Z B;  3EGX B;  1J3T A;  2LCC A;  2QXF A;  2AKK A;  1G3T A;  1BIA A;  3SWN C;  3CPW S;  4A4K A;  1AWJ A;  1Q82 C;  3JB9 J;  5J26 A;  2O9V A;  2DL3 A;  3I5S A;  4M78 F;  4XTZ A;  4L5G A;  2ABL A;  1M90 C;  2YT6 A;  5LJ5 g;  1T0J A;  1BK2 A;  2D8H A;  5KE2 A;  4QQD A;  4KGV B;  2DEQ A;  1AWO A;  4O5V A;  4DBH A;  4O6J A;  1QVG A;  5KCO A;  1LNX A;  3OYD A;  1Y0M A;  2PQW A;  3BDU A;  1UEB A;  2ZPI B;  1YJ9 Q;  2ATC B;  2MAM A;  3RES A;  4MZT A;  4Z02 A;  5CKE A;  2KRM A;  3FIF A;  4M77 E;  5GAN 4;  5CCA A;  2KK4 A;  1W6X A;  1IHV A;  3SFM A;  3JCM b;  4OMP A;  4EMK B;  1W2B A;  2HBW A;  2AZV A;  2P4T A;  2M51 A;  3CCV Q;  2E6Z A;  2K4Y A;  3RKY A;  2DER A;  2F2V A;  1WHK A;  3JCM Q;  4LNP A;  2E10 A;  4PLL A;  2LZ6 B;  1NEG A;  1RAA B;  4C0D B;  2HZY A;  2GFA A;  1AHJ B;  2W10 A;  1AEY A;  2XI9 A;  4HCB A;  4KT0 E;  1RL2 A;  4N4H A;  2DF6 A;  3OYM A;  1QP3 A;  1VYV A;  1U3O A;  4HT9 A;  2EQI A;  1AT1 B;  3EH1 A;  4PFO A;  3WVE B;  2BUD A;  3CBM A;  2XK0 A;  1OZ3 A;  1CSK A;  4J9I A;  2EGA A;  3VV0 A;  2KMT A;  3CXC A;  2O4X B;  1OI1 A;  4C8Q E;  2OTL T;  2A37 A;  2J05 A;  2Y4Y A;  2CUD A;  2PTK A;  1PKS A;  3VS5 A;  7AT1 B;  1GRI A;  2RHU A;  4IIM A;  3CCJ Q;  3CMA T;  1BI2 A;  1JJ2 S;  3GNG A;  5GAO q;  1AOJ A;  3Q1J A;  4CI0 C;  1FYN A;  2EJ9 A;  2DYB A;  9ATC B;  2BTT A;  1OU9 A;  2L3P A;  1GFC A;  3SEM A;  2MK5 A;  1CKA A;  3CCR A;  3HRU A;  3OYA A;  5GAO n;  3CCR Q;  2V8I A;  1VQ9 A;  4E7L A;  4KGX B;  1N27 A;  4ZTF A;  3L2V A;  2K7A A;  3RNJ A;  3EFO B;  2FZC B;  1BYM A;  5DY9 A;  1NLO C;  4JJD A;  1TSF A;  4AG1 C;  3CD6 Q;  3PMI A;  3CXC P;  3I55 T;  1MUZ A;  3V8J A;  4M78 D;  4PJM A;  1MMD A;  3NHN A;  4PL6 A;  1I81 A;  4DA4 A;  3EGD B;  3RDV A;  1H3H A;  1HSQ A;  2LCL A;  3CCQ Q;  2KBT A;  3QKJ A;  4A53 A;  1VQ5 T;  2EJG A;  4CC2 A;  3H9N A;  1W2B S;  1X27 A;  3LLR A;  2AT1 B;  4BI8 B;  5GJV B;  5CQX A;  2GBQ A;  4F17 A;  2FO0 A;  2CSI A;  4ESR A;  3UWN A;  1YBY A;  4C8Q B;  3H6Z A;  2A0F B;  4RTZ A;  1YWP A;  2CGH A;  1QVG S;  3EG9 B;  1YJ9 A;  3SD4 A;  1VUB A;  1T0H A;  3JB9 F;  4J9E A;  3HFO A;  5LJ5 d;  4M78 E;  4HVV A;  2RHY A;  3EFS A;  1KQS P;  2HMA A;  4FYY B;  1VQN A;  1VQ6 A;  3LW5 E;  3CCL T;  2XD0 A;  2KR3 A;  4M77 G;  2E64 A;  4J5Y A;  4E7H A;  4Z8A A;  2ECZ A;  3GLX A;  4M7A A;  4HCZ A;  3M4Y A;  3HL8 A;  1YJW Q;  2XMF A;  1XJW B;  1UTI A;  3TEE A;  2DD4 A;  1D3B A;  1KC8 U;  3PNW C;  4LDW A;  5GMK h;  1BI0 A;  3EGX A;  3JCM W;  1PRM C;  2OAU A;  2P4R A;  4RG8 A;  1LCK A;  1UGR B;  2DRM A;  4C92 F;  1VQ9 Q;  3M0T A;  1WA7 A;  5CAI A;  2D1X A;  1OX9 A;  2RJE A;  1U1S A;  1B3Q A;  2X4Y A;  4BAC A;  2J6F A;  2DVE A;  5GAM e;  2B86 A;  5FU7 B;  2XDB A;  2FRY A;  1SG5 A;  2K3X A;  2D6F A;  4J6Y A;  5GMK i;  3BFM A;  1WIE A;  5D6W A;  4J9H A;  5IHN A;  4C92 G;  3CCU T;  5GAO l;  1KD1 C;  3GP8 A;  1T3L A;  2GTO A;  3JCM g;  4JRP A;  1VQ4 T;  2R57 A;  4RCB A;  2DXB A;  3OYE A;  3QJY A;  2E6N A;  3H41 A;  1VQK A;  2PZ1 A;  4DOW A;  3I35 A;  1S1N A;  3CCQ T;  3CCQ A;  2BZY A;  3CC2 Q;  4AFU C;  2CP6 A;  3OS2 A;  1I5L A;  3VS3 A;  1WHH A;  1Q95 G;  1BKB A;  4M77 F;  1NBE B;  1OUL A;  3BE3 A;  2YUO A;  5GAN 5;  2KAF A;  4XQ3 A;  3JB9 G;  2DXT A;  2MPX C;  2NUT B;  2RQR A;  4F7U A;  1ZUY A;  2ESW A;  2JTM A;  3HHT B;  4XTX A;  4Y91 A;  4F7U G;  4RG2 A;  4ZGE B;  1TUD A;  1BIB A;  2NLU A;  3QWY A;  1QWF A;  2L89 A;  2XKO C;  1KQ2 A;  3VS6 A;  3TU4 K;  4TVR A;  1X43 A;  3PE0 A;  1W2B P;  2DM1 A;  2BE9 B;  2D0Q B;  3VRY A;  1X01 A;  3U23 A;  2LJ0 A;  2WSC E;  5GAM j;  1BCM A;  3VUB A;  4EMK C;  3ASK A;  1TU0 B;  1WFW A;  2VXF A;  4XTY A;  2DXC A;  2LP5 A;  3HRS A;  2J7I A;  3OYG A;  3EFO A;  3LYI A;  1D09 B;  1ZX6 A;  3KBG A;  1N9R A;  3OSS C;  3QG1 A;  5FU6 C;  1K8A R;  1ZUK A;  4M7D B;  5L8R E;  3M53 A;  2EYY A;  1M27 C;  3C4S A;  4KH0 B;  2A3L A;  1NEB A;  3GF5 A;  2EFI A;  3QII A;  3CCU Q;  1FXX A;  2XDD A;  1VQ4 A;  1M2O A;  3RUX A;  4OMO A;  1H8K A;  3VU3 C;  4KUD K;  2DXU A;  3SHW A;  4PFZ A;  3QUI A;  3OYJ A;  3INZ A;  2XG8 D;  1LJO A;  4ATO A;  2ROT A;  1WHL A;  1WHJ A;  4L6V 5;  2DE0 X;  2EYX A;  2L0A A;  1EX4 A;  1JXM A;  1UB4 A;  3TRE A;  1YJ9 T;  3CC2 A;  4R56 A;  3CCJ A;  1QMC A;  1ZSZ B;  3L2U A;  3OS1 A;  2YHT A;  2EAY A;  5LJ3 e;  2DLP A;  4M7D G;  4E7J A;  4C0G A;  1YIJ Q;  1NLP C;  1G3S A;  1YIJ A;  3FJ5 A;  4J6X A;  2F1L A;  4LDU A;  1Q81 C;  1IXD A;  1NJI R;  4LDV A;  1MGQ A;  2XIC A;  3D7S B;  2ZPB B;  4LDY A;  1PC0 A;  1QVP A;  5GMK j;  4C92 C;  2C0I A;  1HK9 A;  1SSF A;  4N4I A;  3E19 A;  5I21 A;  4PK4 A;  1JQQ A;  1M1F A;  3NTI A;  2COW A;  3G1J A;  4J7I A;  1I4K 1;  4C8Q A;  1RAD B;  4DEX A;  3X24 B;  3EG9 A;  2YUQ A;  5IHI A;  3RR6 A;  3GIB A;  2NUP A;  2DTH A;  3LGF A;  2EQU A;  2OTL Q;  1R0B G;  2FRW A;  2EW3 A;  2HNI A;  2OTL A;  2X3W D;  3A8L B;  1VQ6 Q;  1RAH B;  2M02 A;  1V29 B;  3WXM B;  1VQM Q;  4OB2 B;  4ZNX A;  1IHW A;  1VQM A;  2QDL A;  1K73 R;  3NMZ C;  3PMT A;  1D0X A;  1WGS A;  3MHX A;  4IUV A;  1D3B B;  3DLM A;  2KYM A;  2FPD A;  3A1P A;  5LJ3 j;  1PD1 A;  1P92 A;  2J6O A;  2B8A A;  1U06 A;  1VIF A;  3QJ6 A;  4PJO C;  4UC4 A;  1IGQ A;  4FT4 A;  4M78 G;  1VQ6 T;  3QYG B;  2QGF B;  1GCQ A;  1OEB A;  3FDR A;  1QVF S;  3CPW P;  1MMA A;  3C12 A;  5CKF A;  1W4S A;  1UGS B;  4ELZ C;  2QK0 A;  5KYX A;  3CC7 T;  5A0D A;  1K4U S;  3P8H A;  4PLI A;  4LXC A;  1QLY A;  4M75 F;  4M7A F;  4LD6 A;  3OYI A;  1M8V A;  2X4X A;  2E1H A;  3G4S A;  2F69 A;  4QVC A;  2CP2 A;  2BIV A;  2X4W A;  3OW2 P;  5HK0 A;  3CCS A;  2PVO B;  2PUK B;  2V26 A;  3CCU A;  2AIR B;  2X9H A;  1K73 C;  2DK3 A;  1UJ0 A;  1QW1 A;  2NUT A;  2AZS A;  2CYZ B;  2M1H A;  4F7U B;  3CME T;  2CSQ A;  2DA9 A;  4JZ4 A;  4C8Q D;  1YI2 Q;  3R6O A;  2JUF A;  2QEX T;  3P8D A;  6AT1 B;  1D1A A;  3DB3 A;  2VVK A;  3F70 A;  2Y4X A;  2A08 A;  2E41 A;  2DYI A;  2DET A;  2LVM A;  4OML A;  1C6V X;  1O9S A;  1X75 C;  5IN1 A;  2LTO A;  2YUN A;  2L3S A;  4NL2 A;  4QT7 A;  4ELY C;  3QO3 A;  1G5V A;  2L8D A;  5FU6 B;  1GBR A;  2XU8 A;  3REA B;  3M56 A;  1Q81 U;  3OBW A;  3I56 T;  2HKQ B;  3MKD A;  3OYH A;  3FEO A;  1LOJ A;  2QEX Q;  1HYO A;  3CC4 T;  3RER A;  2YLB A;  1K9M C;  1VQ9 T;  2EQK A;  1PWT A;  4Z88 A;  2NWM A;  5KCH A;  4BY6 B;  2OTJ A;  4RTT A;  3MP1 A;  2RF0 A;  1MHN A;  5I11 A;  4QQG A;  2FL7 A;  2LQK A;  2XDP A;  1OPK A;  4C0F A;  3H0F A;  2P84 A;  4FT2 A;  1Q7Y R;  2K2M A;  3HSB A;  3V8L A;  3VRZ A;  1X6B A;  5KYU A;  2F2W A;  2EKH A;  1WXT A;  1QP2 A;  2OTJ T;  1JXO A;  1PG5 B;  2K5I A;  3CQT A;  1WJS A;  2W0Z A;  3CC4 Q;  4JJC A;  2JOY A;  4A4F A;  3JCM X;  1KK7 A;  1Y57 A;  4F7U E;  1YJN T;  3G71 T;  5IAY A;  4PJO A;  2KSS A;  3M0U A;  3EFR A;  3T9N A;  1X2K A;  2RO0 A;  5GAM g;  5AYF A;  2DEU A;  2V8K A;  3JCM c;  2HQX A;  2L3R A;  1M1K C;  3CD6 A;  2KT8 A;  2QA4 Q;  2CZ6 B;  4IUR A;  3KXT A;  4J8O A;  4F16 A;  2QQB A;  3RIR A;  4C5I A;  4JPB W;  2CP7 A;  3TSW A;  1WLP B;  4IUP A;  1Q86 U;  3M4G A;  2EJF A;  4BD3 A;  1WXU A;  5M9O A;  1YI2 T;  2XID A;  3OYF A;  3RMQ A;  3HFN A;  2QEX A;  1B7T A;  2QQ9 A;  2DVJ A;  3C95 A;  5IH2 A;  1SSH A;  1RI9 A;  2RI2 A;  3G4S T;  4RKU E;  5CKB A;  5GMK m;  3RKW A;  4VUB A;  5GAO p;  3G7Z A;  1DJ7 B;  4HT8 A;  2H3E B;  1YI2 A;  4JLI A;  2ZCF B;  1IRX A;  4C8Q F;  2RK1 A;  1K9M R;  4RCC A;  4KBM B;  2QAZ A;  3MEU A;  2JJ9 A;  2M0Y A;  5GAO r;  2KVQ G;  5A0L A;  3RKX A;  2RNA A;  1BCO A;  4KUL A;  1VQ7 Q;  2K2V A;  2LNH B;  1HJD A;  3CC4 A;  1M4Z A;  4M4Z A;  1UG1 A;  1FWZ A;  1R8O B;  3KUF A;  2YUP A;  4BY6 C;  5GAN j;  1IB8 A;  1N5Z A;  1RI0 A;  1C0M A;  4JUV A;  5LJ5 f;  3P8B B;  5FU7 C;  2ZAE A;  2JW4 A;  2PVG B;  3O5Z A;  3G6E A;  3LH5 A;  3M0Q A;  5CR2 A;  2DTO A;  2JTF A;  5L23 A;  3QZ5 B;  2LQN A;  1WDX A;  1VQ5 A;  2LMJ A;  1R77 A;  2COZ A;  2F5K A;  1RLP C;  1VQO A;  4EPC A;  2KT1 A;  2VV5 A;  2I0N A;  2OTJ Q;  2X35 A;  1E6H A;  2EYZ A;  1IGU A;  2CZ0 B;  2QGG A;  2KE9 A;  4XK8 E;  4FW2 A;  8AT1 B;  2QA4 T;  1T3S A;  2JTE A;  2MOX A;  5HY6 A;  2LDM A;  3PFS A;  3PT9 A;  2QQR A;  3G6E T;  2M9U A;  2QAS A;  1TTH B;  2D9T A;  2KRS A;  4AFZ C;  2VKN A;  2C06 A;  1BU1 A;  3SWN A;  2FYK A;  1H92 A;  4BDZ A;  4M75 B;  2Z0W A;  4BUG A;  5LJ3 g;  5HCK A;  1GCP A;  1ZSG A;  3HRT A;  4KH1 B;  1UE9 A;  4FIB A;  1TUC A;  5CKD A;  4RTU A;  1WHM A; 
#chains in the Genus database with same CATH homology
 3G6E Q;  3G71 Q;  1VQO Q;  1QVG P;  1Q7Y R;  1VQ4 Q;  1VQL Q;  3CCV Q;  1Q86 R;  3CME Q;  3CPW P;  1QVF P;  3CC2 Q;  3CCQ Q;  2QEX Q;  3CCJ Q;  1VQN Q;  3I55 Q;  1YJW Q;  2OTL Q;  3CCU Q;  3CMA Q;  1VQ7 Q;  1VQ8 Q;  3CCL Q;  3CCS Q;  3G4S Q;  3CC7 Q;  1VQ6 Q;  1Q81 R;  1S72 Q;  1YIJ Q;  3CCE Q;  1YJ9 Q;  3CD6 Q;  1M90 R;  2OTJ Q;  1YIT Q;  1VQK Q;  3CXC P;  3CCM Q;  1KC8 R;  3I56 Q;  1VQM Q;  1YJN Q;  3CC4 Q;  1KQS P;  1YI2 Q;  1VQP Q;  1N8R R;  1K9M R;  1K73 R;  1VQ5 Q;  1K8A R;  1NJI R;  1VQ9 Q;  1KD1 R;  1JJ2 P;  2QA4 Q;  1W2B P;  1Q82 R;  1YHQ Q;  1M1K R;  3OW2 P;  3CCR Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...