1KD1R

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2001-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1kd1R00
3OW2P 1QVFP 1YJNQ 3CC4Q 3CCSQ 1KD1R 3G6EQ 1JJ2P 1VQPQ 3G4SQ 1VQ8Q 1VQOQ 2QA4Q 1VQ5Q 1K8AR 1M90R 1S72Q 1Q81R 3CPWP 3CCQQ 3CCUQ 1N8RR 3CC2Q 2OTLQ 1YI2Q 1M1KR 3CC7Q 1VQLQ 3CMEQ 1VQMQ 1VQ4Q 1VQ9Q 1Q82R 3CD6Q 1YJ9Q 3CCRQ 3CCJQ 1NJIR 3CXCP 3CCVQ 1Q7YR 1VQNQ 1Q86R 1K9MR 1KQSP 1VQ6Q 1K73R 2QEXQ 3CCEQ 3CMAQ 3CCLQ 1W2BP 1VQ7Q 3I55Q 1QVGP 1YITQ 1YJWQ 1VQKQ 2OTJQ 3I56Q 3CCMQ 1YIJQ 1YHQQ 3G71Q 1KC8R
chains in the Genus database with same CATH superfamily
1UDLA 3PT9A 2LC4A 4LN2A 2M9UA 2QI2A 3J7AF 4XU2A 2DFUA 3H9NA 1K73C 4IUTA 1IHVA 2QQRA 4C8QA 3CXCP 1JJ2S 2KEAA 3CCVA 1U3OA 4OB3B 4F7UB 3CPWS 1M90U 4M7AF 1IRXA 3GOXA 4J9DA 4LUEA 2KXCA 1VQ6T 2K2MA 3R6NA 5CKEA 4C8QD 3NMZC 1JBMA 3JCMh 4F7UG 2EYZA 3M0TA 3TREA 4RTWA 1WIEA 2GCXA 1B07A 4J9FA 3EGXA 2QEXA 1NG2A 4EDUA 1SG5A 2MF2A 2RQVA 3EH2A 4M4ZA 2JT4A 3JCMf 2L3SA 2K5IA 1LOJA 1UECA 3X20B 4KUDK 1JRIA 2EIFA 3OYCA 3CXCA 3HFNA 2R57A 4NOYA 4N4GA 2VV5A 4Z88A 4FYVB 1FMVA 3X24B 1VQ4Q 2JXBA 3MJXA 2AKLA 5A0DA 5GAOm 2K4YA 4RTXA 3IQLA 1VQNT 1WQ7A 2DTIA 3TU4K 1H92A 2F69A 1P92A 1T3SA 4BI8B 1NBEB 2KYMA 2CYZB 2EYWA 1AEYA 1OI1A 3FJPA 2ZPGB 4J9BA 2LP5A 2E5KA 3VYGA 2JUFA 2JTFA 1UE9A 3ZBDA 1MMNA 2OX7A 2FPEA 1LNXA 2X4YA 3ER0A 4FL6A 3OS2A 1BBZA 4AFZC 1X6OA 1KSWA 1N5ZA 4HCBA 1Y96B 4PK4A 3OYMA 3CXCS 2X4XA 4DBQA 4ZGDB 3QBYA 2RPNA 1M8MA 4QW2A 5FU7B 1Q82C 1HD3A 1VYTA 2FVUA 5GAMj 4D8KA 1H3HA 4M75E 3OYAA 2K6DA 4L59A 1PHTA 2FHDA 2BKDN 2QG9B 2DBKA 3VYHB 2HDAA 3VV0A 4E7KA 4F16A 4WF2A 2VYTA 3VS2A 2PU9B 3OA6A 3NHNA 1UHCA 3MP8A 3L42A 2CP7A 1NEBA 2JW4A 3OS1A 3CC2Q 4LDXA 1H8KA 5D6XA 3PVQA 5KE2A 4ZTJA 5LJ5h 1K76A 4FW2A 4ZGJB 3OBYA 3EFSA 4AT1B 2C0IA 1TUDA 1BKBA 3KBGA 3OYHA 1ZA1B 4BD3A 2KQWA 4M77E 3EFRA 1M5Q1 1N9SA 1PKTA 1IREB 1RAFB 1BK2A 1Z9ZA 5GAN7 2EKHA 4ELZC 5LJ5f 2M51A 4DQ2A 1NYGA 2IG0A 1QCOA 2LX7A 2HQHA 2F5TX 2L8DA 3PMIA 3EG2A 2CH4W 3TCJA 1WHKA 3CCVT 2O01E 5FWBA 2XK0A 4KH1B 1YIJQ 3FDRA 2JM8A 1H641 4M75F 1RADB 3L2QA 3NGPA 2EQMA 3G6EA 2YXYA 4OMQA 5CR2A 2FZCB 2HNIA 4ZGEB 1R77A 2CZ6B 2DRMA 4IUUA 4KGXB 3RKYA 1GBQA 2H3JA 3NTKA 1PD0A 2AKKA 3QYGB 1OQKA 1GCQC 2K3BA 2QAZA 2XICA 3LWHA 2I0NA 4FT2A 3CCMQ 3KFVA 2CDTA 2L89A 2QEXT 1B34A 5FW9A 2E64A 2DETA 2PTKA 1KG1A 1QKXA 3HTRA 3CC7Q 2F1LA 1PC0A 2E4HA 4RTTA 2FRYA 2DL4A 3JRZA 4M77F 4P5NA 1YJ9A 2DEQA 1XNIA 2L0AA 4NL2A 1EZZB 3P8DA 4C8QC 2RO0A 4OGCA 1TOVA 2FYKA 4PFPA 2D8JA 1SRLA 5FWCA 3G71A 1VQ5Q 2QGFB 1S72Q 5FU6B 2NUPB 1YI2Q 4FM4B 4LXCA 4M7DE 1OYXA 1UTIA 2P4TA 2KGTA 1WA7A 1TWBA 2DE0X 1SHFA 1BI3A 1VQKA 4OP0A 9ATCB 3I55T 1TU0B 3A8GB 2KROA 1M1KC 1PRLC 3I35A 3VKIA 5A0GA 4MDXA 4J9GA 4KBMB 1VYUA 1Q7YC 4DA4A 2EVRA 5IXBA 2KI7A 2O31A 2O9SA 5GANh 4KT0E 1MHNA 3PVLA 1KQSP 3H8ZA 3QJ6A 2RF0A 1ARKA 4D8DA 3JB9D 2XKOC 3M56A 5GJVB 2HKQB 4UC4A 1MV3A 1K8AR 3EHRA 1J3TA 2O4XA 2QDYB 1ABOA 1MMAA 4CRIA 3VRZA 1ZSZA 5GANf 3QZ9B 1VQMA 2RHXA 1K73R 2E70A 2KT1A 1XQHA 2DIQA 4J6XA 1VA7A 1KJWA 4JZ4A 2EYYA 2QQ9A 1RAEB 2LNVA 1ABQA 2CGHA 4M7DF 3S3OA 1KQSA 3SFMA 1VQLQ 3LH0A 4EMKA 5GAN4 4CC3A 3JCMc 1RACB 5I22A 3EFOA 4KRTA 3F70A 4JRPA 4AFQC 2CT3A 2M1HA 1NPPA 3G6ET 2GQVA 2LNHB 1V29B 5CCAA 3V7CA 3KUFA 4C0FA 2HKNA 2C0TA 2RJCA 2X3XD 3ME9A 2J6KA 4MZMA 4XU1A 4AG2C 2PVGB 4E47A 1KQSS 4A4HA 2W0ZA 3M9QA 4XTXA 1VQ5A 4PFZA 2LDMA 1ZSGA 2QK0A 4OMMA 1QQJA 2CUDA 2HQXA 1XOVA 2DA9A 2KRSA 2F2VA 1K8AU 2OAWA 3OS5A 4C92A 3HHTB 4C8QE 1YJ9T 5CKDA 1SHGA 2CZ7B 2MYSA 5KYNA 4BE1A 2EKOA 3RNJA 4A4KA 4CC7A 3CPFA 4OMOA 1SPKA 4BACA 1K73U 4RG2A 3OS0A 3G71T 4B6MA 1X2KA 1Z9QA 3L2UA 4DEYA 1Q82R 3CCRQ 1TSFA 2MWOA 2FZGB 3DKMA 1I0CA 1YFNA 1M3AA 1WXBA 2SEMA 2KYBA 2LCSA 3OBWA 5LJ5g 3E2UA 2RQRA 4XTWA 2H3EB 5ECAA 3E9FA 5KYUA 4VUBA 2DXUA 1VQKT 1WZOA 3UF4A 1PCXA 1BI1A 5D6WA 1KQ2A 4EMHA 4EMGA 1AZGB 2FPDA 5D6YA 3HPWA 4FSXA 1JB0E 4Y91A 3MP6A 3P8HA 3H41A 4GY5A 2XHCA 1YJNQ 1M4ZA 3URGA 2H8HA 4E7SA 4RG8A 3ZFJA 1FMWA 1UJYA 1OULA 3LWIA 1WHMA 3TVTA 2AIRB 4J8OA 1ZLMA 3PGGA 1EFNA 1VQMT 2LJ3A 5GAOr 1ZUUA 3RIRA 3REBB 1S1NA 2EW3A 4F7UE 1E6GA 3OB9A 2QQAA 3OY9A 3R6OA 2JNGA 2XMFA 1YCYA 3CMEQ 3CCQA 5L8RE 3HL8A 4C8QB 2QASA 3CCJA 1C0MA 1KC8C 2V8KA 3M54A 1OX9A 2DJZA 4OGEA 2VXFA 1Q82U 2G3RA 2ED1A 1N8RC 2R5AA 3CD6A 2IIMA 2KSSA 4C8QG 3HRUA 1KHIA 2QA4Q 1VQ8Q 2BIVA 3WXMB 4ZTFA 4E7IA 3CCUQ 1YWPA 1ZBJA 2B8AA 3A1PA 2DKGA 1UGVA 2QQSA 2DL3A 5GMKm 1ZQ1A 2E5QA 3QIIA 1ZA2B 5GAOl 2YUPA 4N4IA 1ZSZC 3I9QA 2GFUA 2PVOB 3CMAA 4QVDA 4HT8A 2EPDA 2DIGA 1YHQQ 3JB9I 1C1AA 2QTXA 2COYA 2KE9A 2EGAA 4JS5A 3VS1A 2BE9B 4PJLA 4QQGA 1VQ5T 5LJ5d 3EGDA 1SRMA 1Q86R 4F7UF 1VQ9A 3RMQA 2WACA 4IKFA 1YBYA 4EMKC 2DZ9A 3RBBB 3LW5E 4O6JA 1WQWA 1A0NB 3SDZA 3VJPA 1BU1A 2ZPHB 5GANg 1NEGA 4KH0B 3FC3A 2EJFA 3CC4A 3MO8A 3QDRB 2HQEA 1I5LA 1Q7YR 3A98A 3JV3A 2GQIA 5DY9A 3QO3A 3CEYA 3VS7A 3JAME 2LT1A 4M78A 2CP5A 3FRNA 1UG1A 1VQ7A 1MGQA 2R5MA 3A8MB 2HCKA 2Y4XA 3M4YA 3O5ZA 4A4GA 1YJNA 3G4SA 4BI3A 1Y7XA 3OMGA 1AD5A 1M30A 1WGSA 2CUBA 3RKWA 1G8XA 2FG0A 4OB0B 3CQTA 3QKJA 3CCLQ 1W2BP 1LVKA 4RTZA 3JCMe 1WJQA 2DYIA 1VIFA 2XD0A 1K1ZA 2MWPA 1IHWA 2FRWA 5M9OA 3C95A 4XTVA 1UEBA 4C92C 3CBMA 1TS9A 4XU3A 4F17A 4BY6C 3S6WA 2LCLA 1GFDA 4OF1A 2ZPEB 2M0OA 4TVRA 5GMKh 1WHLA 2HL3A 1D3BB 4DOVA 1QVGP 1VUBA 3CCEA 3HSBA 2JTMA 2WSCE 3QJYA 3JCMV 2MCNA 3RESA 3HRTA 1Q86U 4RCCA 1ZUYA 3GLXA 2QA4A 1NJIC 2OTLQ 3AT1B 3CCUA 2DZCA 3J81E 1W2BA 1I1JA 4PJOA 1CKAA 3PIPA 3CCQT 5KCOA 3CBPA 2ROLA 5IHNA 3C0CA 1FXXA 5IAYA 3MPUB 3QWYA 4ZNXA 3CCJT 4HXJA 3I55A 2X51A 4KGZB 4PJOD 1Q7YU 2LJ1A 3GNGA 2DAQA 4MZPA 2WSEE 1NLOC 3EH1A 3CD6T 1M2VB 1N9RA 1SF9A 3MEWA 1X75C 1AWJA 4JJDA 1QVGA 1G5VA 1I4K1 4BDYA 2HAXA 5GANd 1W70A 2E6ZA 3C94A 2MK5A 1FWZA 3LH5A 1AVZC 1BCMA 1LPLA 5KYYA 1V1CA 2OTJA 1ZBXA 1XTDA 1M1FA 3CMAT 2P4RA 4LE9A 2YLBA 1YJWA 3M55A 4HVWA 4JRQA 1W2BS 2X35A 2DXCA 1QVPA 2RQTA 4IURA 2L3PA 4AFSC 1K9MC 3JB9H 1FYNA 3VS3A 4IIOA 5AYFA 4C0DB 1BIBA 4PJMA 4C5EA 1I5OB 2ZCFB 1VQ9T 5CKFA 4M7AA 5LJ5e 2X4JA 1UFFA 4PLIA 1VQOQ 3VUBA 2BZ8A 3SD4A 1QVGS 1GRIA 2RM4A 3CC4T 2M02A 4M7AD 3OYJA 4FW1A 4J83A 1RL2A 3FIFA 1VQ7T 2LQKA 2RK1A 2Y4YA 4PFOA 5LL6S 1U8RA 3CBOA 3QUIA 2ZAEA 4PJJA 1YJNT 2JS0A 4ESRA 4J6WA 2DL5A 3G4ST 1VQ4A 3JCMQ 2NUZA 2AZSA 2GFAA 5LJ3h 3WVEB 3SB2A 1V76A 3JB9G 1QVFP 4A4EA 3TEEA 5KCHA 4E7LA 2RH2A 1TUGB 2QDLA 2O4XB 2RK2A 4K11A 2OTLA 2E12A 1ZSZB 3OMCA 4OMNA 3GIBA 2DL7A 5GJWB 4RMOA 2X9HA 5LJ3f 4LDUA 3HRSA 5FROA 3E9GA 1IXDA 2KXDA 2YSQA 3CCET 1WXTA 4FU6A 2J7IA 1VQPQ 4E7JA 4M78C 2CP6A 4Z8AA 1N8RR 2EWNA 3P8BB 3OYDA 1QCNA 2QA4T 1QLYA 4CC2A 2P84A 3CCUT 2EQIA 4II1A 1GFCA 1MUZA 2D0QB 2FB7A 2CH4A 2HBPA 3PMTA 1D1BA 1QVFA 3SWNA 2CREA 2HSEB 4PJNA 3JCMW 2COZA 4HA8A 2J6OA 1NYFA 3TQ7P 4LNPA 2CP2A 1KIKA 2A28A 3QXEB 2FEIA 2JTEA 3CC2A 4GLMA 1WI7A 1DJ7B 3ASKA 5D7UA 2L2PA 3DB4A 2BUDA 4PNOA 5J39A 3L2VA 2JVVA 1WHHA 1R0BG 1AHJB 1OOTA 5IHIA 4Z89A 5GANe 1G3YA 4WCIA 2D9TA 2OTJT 3X25B 1MMGA 2ATCB 4XU0A 3HKSA 1YJWT 4J6YA 2QTVA 2LVMA 3A8OB 1I07A 2GF7A 1QVFS 1VQ6Q 4HCKA 2CZ1B 4PJOC 2LQWA 4E6RA 3JCMg 2FL7A 5GAOq 4OMPA 2V8IA 4KULA 4BY6B 2DLPA 5I2MA 1RAHB 5GAN8 1JU5C 1YIJA 2EQUA 2BE7D 4R0KA 1NLPC 4M75A 1WPYA 1SKUB 2JS2A 2KRNA 3EHQA 4C92G 1U1TA 4BDZA 2YRDA 2ABLA 3V7RA 4XTZA 3NTHA 5CKBA 1B3QA 1N8RU 2RA2A 4M75D 1AWOA 2A36A 4E7HA 3HP9A 1KQ1A 3MKDA 4FIBA 3CCMA 1Q81C 2NLUA 5KYUB 3OSSC 3QHSA 2NUPA 3UATA 3O8VA 3LGLA 5GAMh 1IGQA 4ANJA 2DJQA 3OYKA 2RHUA 2L3QA 3FJ5A 3CC7A 1PNJA 4JLGA 1VQNQ 1X6BA 3G7ZA 4LDWA 1XJWB 2V1RA 4M77A 3JCMb 1VQ4T 2MAMA 1PD1A 2QQBA 3QZ5B 1VIEA 4JDSA 1RAIB 3OQ5A 5GAMf 1U1SA 4M7AC 1AWWA 4FSSA 2RI3A 3EG3A 1T3LA 1X2QA 5HKCA 2BZXA 3VRYA 3HFOA 1S72A 2HBWA 1YI2A 1NJIR 2OTLT 1X69A 5GAN5 2AZVA 2EYXA 1AT1B 3JSCA 4WTOB 2RQWA 3G1JA 2G6FX 4CC4B 5A2QE 4R56A 2GBQA 1QW1A 4HT9A 1ZHIA 4Y28E 4C92D 3PIOA 4IUQA 2HZYA 4MDWA 1UGQB 3E1SA 4BI4A 3QWXX 4C0ZA 4DBFA 4PLLA 1WXUA 1WJSA 2J6FA 1ZX6A 3QDFA 1I81A 4OMLA 1QKWA 5EG2A 5EC7A 3V8LA 3QPHA 1Y57A 3CCSQ 1TXQA 1IGUA 4V2SA 2YUQA 1G3TA 3C4SA 4XK8E 3JCMd 2ROTA 2Z0WA 5FU7C 2NUTA 1W1FA 2JMAA 3CC2T 1K0XA 2HEQA 1K9MR 4ATOA 3RERA 2SRCA 3T9NA 1K0SA 2J05A 1YWOA 3GP8A 2EQJA 2FZKB 2DTOA 2F5KA 2E65A 4C0GA 2HMAA 4A54A 5DM7R 3C12A 4M7DA 4HCZA 2Y90A 4C8QF 3BDLA 3CCVQ 4L6V5 3EGDB 4YTLA 3RUXA 1VQLA 1VYVA 4PKCC 1HSQA 1AOJA 4M7DD 3U23A 2DXTA 2JZ2A 1NJIU 3SWNC 5KYYB 1NZ9A 3OYBA 1YIJT 3M0RA 1CKBA 5LJ3g 2A7YA 2PNIA 1NE8A 3EG0A 2EAYA 5LJ5j 3OYEA 4B9XA 3MEAA 2KMTA 2QEXQ 1QMCA 2YUNA 5GAN2 1OU8A 2VWFA 3OYLA 2XU8A 1OPKA 1TG0A 1OV3A 1D0XA 2CSQA 2CZ0B 4RCBA 2BTTA 1R8OB 2K79A 3CCMT 1BCOA 4L5GA 2MOXA 2P0KA 1M1GA 1G2BA 2VC8A 4M78G 2GTJA 4OB1B 5KYWA 2GGRA 2XDDA 1HYOA 4BE2A 2CKKA 1UGSB 3LX7A 2PUOB 3FLGA 3CC7T 1RAAB 3M0PA 1MNDA 1O9SA 4F04B 4ELYC 5HY6A 4X1VA 3EGXB 2R58A 5CO7A 3SHWA 2RI5A 3PFSA 3L2RA 1CSKA 1K9MU 1PG5B 2M16A 2E3IA 3V8JA 2JJ9A 4DBHA 2K5LA 2D0NA 1S72T 4M75C 3OYYA 2RJDA 1YI2T 3CCRA 1U5SA 2EJ9A 8ATCB 4D6WA 1KD1C 3D7SB 2LCCA 4QQ6A 3L2ZA 3OYGA 2RNAA 2V8JA 3V7SA 1MMDA 3PNWC 4LUDA 1M1KR 2LJ0A 4PJOB 2ED0A 5FU6C 2KDSA 4KUIA 4J7IA 1M3CA 2FO0A 3RDVA 2DYBA 3GF5A 4J5YA 4M77C 4PJOG 2DD5A 2D1XA 4J7FA 2X4WA 3EAEA 1X43A 4Y92A 5GAOp 4M78D 2KR3A 4JPBW 4RTYA 2KAFA 2KBTA 1BB9A 4JLIA 1GXIE 1YNZA 2A0FB 3VU3C 2VVKA 2V1QA 5LJ3d 2DK3A 3EG9A 3JCMJ 4QVZA 1T0HA 1R0CB 4IIMA 2OJ2A 2WSFE 2EFIA 2YDLA 4NL3A 1UB4A 2EQKA 1JXOA 1M9SA 4OB2B 3M58A 3CMEA 1X6GA 3NPFA 2J06A 5GANj 1VQLT 5GAMg 3M53A 2CT4A 2DD4A 4M7AB 5GMKe 5KYXA 2COWA 4PL6A 1BIAA 4BB7A 3G6EQ 1PKSA 2DM1A 1Q81R 1VQ8A 5I11A 2MPXC 3M4GA 3S3NA 4M7AG 1E7OA 2VASA 1WHJA 2AK5A 2KT8A 2DMOA 3M0SA 1D1CA 2RN8A 5KE3A 1M1KU 3I56Q 2YHTA 2K3XA 2O88A 4J9EA 4FYWB 4A4FA 2K57A 3EGUA 1YHQA 3PTAA 4J9IA 1K4US 1YP5A 2E41A 2JN0A 2K5FA 2YT6A 2X3WD 1WJRA 2F2WA 1YJ9Q 1OZ2A 3L2WA 2AT1B 1AZEA 4F7UA 4M7DC 5IT9E 4MMLA 2EYQA 5AT1B 2LZ6B 3VS6A 1FMKA 3G71Q 1YCSB 2LMJA 4EIKA 3H6ZA 1RUWA 1B34B 3VS5A 1RLPC 2DEUA 1RI0A 2C06A 3BY7A 4RUGA 4OVAA 2K9GA 5IH2A 4XTUA 5FRMA 2QYZA 5CIUA 3N5BB 3GPLA 1EIFA 1TUCA 3TSWA 1PWTA 3CCRT 1VQKQ 2XDPA 5C0MA 2XI9A 2LQNA 1BI2A 4JS4A 2ESWA 2RQUA 4XTYA 3BFMA 3NFCA 3DB3A 2KK4A 2BZYA 1UGRB 1OEBA 4X9CA 2DPPB 3Q1JA 1O75A 3CCST 4ME7A 3JB9F 5GAOn 3GBQA 3VUZA 1X27A 4BE0A 3M0QA 3PE0A 1D3BA 5I21A 2E6NA 2MMPA 5GAN6 1RLQC 1F1BB 1Q81U 2ENMA 2RD1A 3SWNB 3CCLA 1JXMA 2JOYA 4JJBA 2K7AA 4ZN3A 1E6HA 2ZGWA 1KHCA 2DO3A 1VOMA 3M59A 3S3MA 1VQMQ 4GBQA 2CS7A 5GAMd 1G3SA 2E1HA 1Y0MA 1QWFA 1UHFA 2YLCA 4FT4A 4HVUA 5CK9A 1PRMC 2LRQA 1Y96A 1M90C 1HXDA 4C92E 3ZEHA 1TH7A 4A53A 2VGNA 2QXFA 3TSZA 3ULRB 1M2VA 4N0AA 7AT1B 2DXBA 1C6VX 2L3RA 2IPOB 5LJ3e 2FPFA 2YRVA 2KRMA 2VB6A 3QYHB 3X26B 4IUPA 1RAGB 1M8VA 3CMET 3MEVA 1YITQ 4HVVA 4B9WA 4JJNK 3LLRA 3I56A 1LJOA 3BW1A 1I8FA 1KC8R 3UA7A 4AMCA 1WX6A 3VS0A 2DERA 5J26A 4M75B 2ZPIB 3A5ZB 5DLQE 2DX1A 1VQ8T 5IN1A 1JQQA 4EMKB 4JRKA 6AT1B 1D09B 2DRKA 2VUBA 3MHXA 3H0FA 1M3BA 2P0QA 2RHZA 4M75G 3EFOB 2RB6A 5L23A 2PUKB 3NTIA 8AT1B 5KH6A 5HK0A 2XIDA 1Q95G 2DNUA 4QQDA 1Q86C 1YHQT 3JCMX 2YWWA 1OZ3A 3I5SA 1K9AA 4A63B 3H0HA 4C92F 1JO8A 2LX9A 4M77B 4X9DA 2LT4A 3UDCA 1IB8A 2XG8D 4J9HA 3EG1A 3OW2P 3JCMP 1KD1R 2A37A 4J9CA 1WNLA 4M77G 2KY9A 1VQOA 3SEMA 3OYFA 4JJCA 3RR6A 3FEOA 1IO6A 3META 2VKNA 2D8HA 4ORZA 2L5QA 4C92B 4JRIA 5GAN3 3THKA 4NS5A 2O9VA 1TTHB 4X34A 3UWNA 2JMCA 3MCAB 4JUVA 3LGFA 3J80E 2A3LA 2PZ1A 4N4HA 2ZPBB 3WVDB 4C5HA 4LDYA 1KC8U 1T0JA 1WFWA 1QWEA 2EJGA 2RJEA 3M5AA 3OW2A 1D0ZA 3MEUA 2GTOA 2RI2A 3CCLT 2NWMA 1G3WA 4DBRA 1ZUKA 5IXFA 2NUTB 2AHJB 1JEGA 2MI6A 1PM3A 2E3HA 3INZA 4C5GA 5GAMe 3V8KA 1YITA 1IZ6A 1BYMA 3BDUA 1Y71A 2EBPA 2RHIA 3REAB 5CAIA 2HSPA 2W10A 4C5IA 1WHGA 3CCQQ 1VQPA 4M77D 1FX7A 3DLLA 2ZPFB 2PVDB 4M7DB 3RKXA 5DLOA 3CCJQ 3OW2S 3QG1A 4JZ3A 1KD1U 1GL5A 4DOWA 1PSEA 3CD6Q 1PSFA 4M7DG 1N27A 1KFZA 2OI3A 3I56T 5FRNA 2QGGA 4M78E 3M0UA 2D6FA 1AWXA 2DL8A 1M2OA 2DVJA 4QKUA 2ECZA 3A8HB 4E2FB 2DVEA 3L1AA 5GMKj 5GMKl 1EX4A 1OU9A 1SSHA 1UJ0A 2VXEA 3CMAQ 1KK7A 3AHUA 5HCKA 2P0PA 1SEMA 1X01A 2RMOA 1M27C 2F2XA 4E7ZA 1MV0B 2YRCA 4RTUA 1HK9A 3OSVA 1H3ZA 1VQ9Q 1HJDA 5KYWB 4N0AC 4XQ3A 3H0IA 2CP0A 1UUEA 3LYIA 3OYIA 1LCKA 1VQ6A 4AFUC 4IUVA 3CC4Q 3UPUA 3UT1A 3X28B 2KVQG 2K2VA 2JM9A 1OPLA 1WYXA 2RJFA 1VQOT 2YUOA 2DF6A 3M57A 5CQYA 4PJOE 1VQ7Q 2DBMA 4M78F 1QCFA 4C0DC 1GCPA 4Q5WA 1RABB 3A8LB 1WLPB 1MNEA 5C6SA 2CSIA 2HD0A 2KNBB 5HK3A 4LD9K 5GMKi 1RI9A 4XAXB 5IHKA 5A0LA 3G4SQ 1ACMB 3MP1A 4HKEA 4F14A 2XDBA 1GBRA 1W6XA 2IVWA 2M0YA 4QVCA 3OYNA 4OMFB 1SSFA 1VQNA 2A08A 2O2OA 1OX8A 3I5RA 4M78B 2NYSA 1JJ2P 2EGEA 4QT7A 5FLXE 2VGMA 1M90R 3CPWP 4BUGA 2DILA 2RHYA 2MIOA 2ZZDA 2EGCA 2CP3A 1QP2A 3CCEQ 4HCCA 2LTOA 4ZN1A 5CKHA 4LDVA 1YITT 3EG9B 2E10A 4MMKA 4M7AE 3RMSA 2V26A 1D0YA 1YN8A 3KXTA 4PJOF 4DEXA 4CI0C 5CVIA 1VQPT 4Z02A 4MZTA 1UGPB 5J3BA 4O5VA 3E19A 2PQWA 3DLMA 4R55A 1Y07A 1BI0A 3BE3A 4KGVB 3I55Q 1JJ2A 4GLKA 4RTVA 2OAUA 1NPRA 2I2LA 3CPWA 1WDXA 2K3YA 5LJ3j 4FCYA 2C0OA 5KYXB 4LD6A 4RKUE 2GNCA 1QP3A 3CCSA 3ZL7C 2LQ8A 3GNFB 1W4SA 1GCQA 1N6AA 1D1AA 1U06A 5CQXA 1G83A 4AG1C 4FYXB 3VS4A 3JB9J 4EPCA 2HL5C 1B7TA 3FB9A 2OTJQ 2B86A 1NM7A 3QSUA 5I2SA 1K8AC 3UA6A 1YJWQ 2DTHA 4FYYB
chains in the Genus database with same CATH topology
3OW2P 1QVFP 1YJNQ 3CC4Q 3CCSQ 1KD1R 3G6EQ 1JJ2P 1VQPQ 3G4SQ 1VQ8Q 1VQOQ 2QA4Q 1VQ5Q 1K8AR 1M90R 1S72Q 1Q81R 3CPWP 3CCQQ 3CCUQ 1N8RR 3CC2Q 2OTLQ 1YI2Q 1M1KR 3CC7Q 1VQLQ 3CMEQ 1VQMQ 1VQ4Q 1VQ9Q 1Q82R 3CD6Q 1YJ9Q 3CCRQ 3CCJQ 1NJIR 3CXCP 3CCVQ 1Q7YR 1VQNQ 1Q86R 1K9MR 1KQSP 1VQ6Q 1K73R 2QEXQ 3CCEQ 3CMAQ 3CCLQ 1W2BP 1VQ7Q 3I55Q 1QVGP 1YITQ 1YJWQ 1VQKQ 2OTJQ 3I56Q 3CCMQ 1YIJQ 1YHQQ 3G71Q 1KC8R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OW2 P;  1QVF P;  1YJN Q;  3CC4 Q;  3CCS Q;  1KD1 R;  3G6E Q;  1JJ2 P;  1VQP Q;  3G4S Q;  1VQ8 Q;  1VQO Q;  2QA4 Q;  1VQ5 Q;  1K8A R;  1M90 R;  1S72 Q;  1Q81 R;  3CPW P;  3CCQ Q;  3CCU Q;  1N8R R;  3CC2 Q;  2OTL Q;  1YI2 Q;  1M1K R;  3CC7 Q;  1VQL Q;  3CME Q;  1VQM Q;  1VQ4 Q;  1VQ9 Q;  1Q82 R;  3CD6 Q;  1YJ9 Q;  3CCR Q;  3CCJ Q;  1NJI R;  3CXC P;  3CCV Q;  1Q7Y R;  1VQN Q;  1Q86 R;  1K9M R;  1KQS P;  1VQ6 Q;  1K73 R;  2QEX Q;  3CCE Q;  3CMA Q;  3CCL Q;  1W2B P;  1VQ7 Q;  3I55 Q;  1QVG P;  1YIT Q;  1YJW Q;  1VQK Q;  2OTJ Q;  3I56 Q;  3CCM Q;  1YIJ Q;  1YHQ Q;  3G71 Q;  1KC8 R; 
#chains in the Genus database with same CATH topology
 1UDL A;  3PT9 A;  2LC4 A;  4LN2 A;  2M9U A;  2QI2 A;  3J7A F;  4XU2 A;  2DFU A;  3H9N A;  1K73 C;  4IUT A;  1IHV A;  2QQR A;  4C8Q A;  3CXC P;  1JJ2 S;  2KEA A;  3CCV A;  1U3O A;  4OB3 B;  4F7U B;  3CPW S;  1M90 U;  4M7A F;  1IRX A;  3GOX A;  4J9D A;  4LUE A;  2KXC A;  1VQ6 T;  2K2M A;  3R6N A;  5CKE A;  4C8Q D;  3NMZ C;  1JBM A;  3JCM h;  4F7U G;  2EYZ A;  3M0T A;  3TRE A;  4RTW A;  1WIE A;  2GCX A;  1B07 A;  4J9F A;  3EGX A;  2QEX A;  1NG2 A;  4EDU A;  1SG5 A;  2MF2 A;  2RQV A;  3EH2 A;  4M4Z A;  2JT4 A;  3JCM f;  2L3S A;  2K5I A;  1LOJ A;  1UEC A;  3X20 B;  4KUD K;  1JRI A;  2EIF A;  3OYC A;  3CXC A;  3HFN A;  2R57 A;  4NOY A;  4N4G A;  2VV5 A;  4Z88 A;  4FYV B;  1FMV A;  3X24 B;  1VQ4 Q;  2JXB A;  3MJX A;  2AKL A;  5A0D A;  5GAO m;  2K4Y A;  4RTX A;  3IQL A;  1VQN T;  1WQ7 A;  2DTI A;  3TU4 K;  1H92 A;  2F69 A;  1P92 A;  1T3S A;  4BI8 B;  1NBE B;  2KYM A;  2CYZ B;  2EYW A;  1AEY A;  1OI1 A;  3FJP A;  2ZPG B;  4J9B A;  2LP5 A;  2E5K A;  3VYG A;  2JUF A;  2JTF A;  1UE9 A;  3ZBD A;  1MMN A;  2OX7 A;  2FPE A;  1LNX A;  2X4Y A;  3ER0 A;  4FL6 A;  3OS2 A;  1BBZ A;  4AFZ C;  1X6O A;  1KSW A;  1N5Z A;  4HCB A;  1Y96 B;  4PK4 A;  3OYM A;  3CXC S;  2X4X A;  4DBQ A;  4ZGD B;  3QBY A;  2RPN A;  1M8M A;  4QW2 A;  5FU7 B;  1Q82 C;  1HD3 A;  1VYT A;  2FVU A;  5GAM j;  4D8K A;  1H3H A;  4M75 E;  3OYA A;  2K6D A;  4L59 A;  1PHT A;  2FHD A;  2BKD N;  2QG9 B;  2DBK A;  3VYH B;  2HDA A;  3VV0 A;  4E7K A;  4F16 A;  4WF2 A;  2VYT A;  3VS2 A;  2PU9 B;  3OA6 A;  3NHN A;  1UHC A;  3MP8 A;  3L42 A;  2CP7 A;  1NEB A;  2JW4 A;  3OS1 A;  3CC2 Q;  4LDX A;  1H8K A;  5D6X A;  3PVQ A;  5KE2 A;  4ZTJ A;  5LJ5 h;  1K76 A;  4FW2 A;  4ZGJ B;  3OBY A;  3EFS A;  4AT1 B;  2C0I A;  1TUD A;  1BKB A;  3KBG A;  3OYH A;  1ZA1 B;  4BD3 A;  2KQW A;  4M77 E;  3EFR A;  1M5Q 1;  1N9S A;  1PKT A;  1IRE B;  1RAF B;  1BK2 A;  1Z9Z A;  5GAN 7;  2EKH A;  4ELZ C;  5LJ5 f;  2M51 A;  4DQ2 A;  1NYG A;  2IG0 A;  1QCO A;  2LX7 A;  2HQH A;  2F5T X;  2L8D A;  3PMI A;  3EG2 A;  2CH4 W;  3TCJ A;  1WHK A;  3CCV T;  2O01 E;  5FWB A;  2XK0 A;  4KH1 B;  1YIJ Q;  3FDR A;  2JM8 A;  1H64 1;  4M75 F;  1RAD B;  3L2Q A;  3NGP A;  2EQM A;  3G6E A;  2YXY A;  4OMQ A;  5CR2 A;  2FZC B;  2HNI A;  4ZGE B;  1R77 A;  2CZ6 B;  2DRM A;  4IUU A;  4KGX B;  3RKY A;  1GBQ A;  2H3J A;  3NTK A;  1PD0 A;  2AKK A;  3QYG B;  1OQK A;  1GCQ C;  2K3B A;  2QAZ A;  2XIC A;  3LWH A;  2I0N A;  4FT2 A;  3CCM Q;  3KFV A;  2CDT A;  2L89 A;  2QEX T;  1B34 A;  5FW9 A;  2E64 A;  2DET A;  2PTK A;  1KG1 A;  1QKX A;  3HTR A;  3CC7 Q;  2F1L A;  1PC0 A;  2E4H A;  4RTT A;  2FRY A;  2DL4 A;  3JRZ A;  4M77 F;  4P5N A;  1YJ9 A;  2DEQ A;  1XNI A;  2L0A A;  4NL2 A;  1EZZ B;  3P8D A;  4C8Q C;  2RO0 A;  4OGC A;  1TOV A;  2FYK A;  4PFP A;  2D8J A;  1SRL A;  5FWC A;  3G71 A;  1VQ5 Q;  2QGF B;  1S72 Q;  5FU6 B;  2NUP B;  1YI2 Q;  4FM4 B;  4LXC A;  4M7D E;  1OYX A;  1UTI A;  2P4T A;  2KGT A;  1WA7 A;  1TWB A;  2DE0 X;  1SHF A;  1BI3 A;  1VQK A;  4OP0 A;  9ATC B;  3I55 T;  1TU0 B;  3A8G B;  2KRO A;  1M1K C;  1PRL C;  3I35 A;  3VKI A;  5A0G A;  4MDX A;  4J9G A;  4KBM B;  1VYU A;  1Q7Y C;  4DA4 A;  2EVR A;  5IXB A;  2KI7 A;  2O31 A;  2O9S A;  5GAN h;  4KT0 E;  1MHN A;  3PVL A;  1KQS P;  3H8Z A;  3QJ6 A;  2RF0 A;  1ARK A;  4D8D A;  3JB9 D;  2XKO C;  3M56 A;  5GJV B;  2HKQ B;  4UC4 A;  1MV3 A;  1K8A R;  3EHR A;  1J3T A;  2O4X A;  2QDY B;  1ABO A;  1MMA A;  4CRI A;  3VRZ A;  1ZSZ A;  5GAN f;  3QZ9 B;  1VQM A;  2RHX A;  1K73 R;  2E70 A;  2KT1 A;  1XQH A;  2DIQ A;  4J6X A;  1VA7 A;  1KJW A;  4JZ4 A;  2EYY A;  2QQ9 A;  1RAE B;  2LNV A;  1ABQ A;  2CGH A;  4M7D F;  3S3O A;  1KQS A;  3SFM A;  1VQL Q;  3LH0 A;  4EMK A;  5GAN 4;  4CC3 A;  3JCM c;  1RAC B;  5I22 A;  3EFO A;  4KRT A;  3F70 A;  4JRP A;  4AFQ C;  2CT3 A;  2M1H A;  1NPP A;  3G6E T;  2GQV A;  2LNH B;  1V29 B;  5CCA A;  3V7C A;  3KUF A;  4C0F A;  2HKN A;  2C0T A;  2RJC A;  2X3X D;  3ME9 A;  2J6K A;  4MZM A;  4XU1 A;  4AG2 C;  2PVG B;  4E47 A;  1KQS S;  4A4H A;  2W0Z A;  3M9Q A;  4XTX A;  1VQ5 A;  4PFZ A;  2LDM A;  1ZSG A;  2QK0 A;  4OMM A;  1QQJ A;  2CUD A;  2HQX A;  1XOV A;  2DA9 A;  2KRS A;  2F2V A;  1K8A U;  2OAW A;  3OS5 A;  4C92 A;  3HHT B;  4C8Q E;  1YJ9 T;  5CKD A;  1SHG A;  2CZ7 B;  2MYS A;  5KYN A;  4BE1 A;  2EKO A;  3RNJ A;  4A4K A;  4CC7 A;  3CPF A;  4OMO A;  1SPK A;  4BAC A;  1K73 U;  4RG2 A;  3OS0 A;  3G71 T;  4B6M A;  1X2K A;  1Z9Q A;  3L2U A;  4DEY A;  1Q82 R;  3CCR Q;  1TSF A;  2MWO A;  2FZG B;  3DKM A;  1I0C A;  1YFN A;  1M3A A;  1WXB A;  2SEM A;  2KYB A;  2LCS A;  3OBW A;  5LJ5 g;  3E2U A;  2RQR A;  4XTW A;  2H3E B;  5ECA A;  3E9F A;  5KYU A;  4VUB A;  2DXU A;  1VQK T;  1WZO A;  3UF4 A;  1PCX A;  1BI1 A;  5D6W A;  1KQ2 A;  4EMH A;  4EMG A;  1AZG B;  2FPD A;  5D6Y A;  3HPW A;  4FSX A;  1JB0 E;  4Y91 A;  3MP6 A;  3P8H A;  3H41 A;  4GY5 A;  2XHC A;  1YJN Q;  1M4Z A;  3URG A;  2H8H A;  4E7S A;  4RG8 A;  3ZFJ A;  1FMW A;  1UJY A;  1OUL A;  3LWI A;  1WHM A;  3TVT A;  2AIR B;  4J8O A;  1ZLM A;  3PGG A;  1EFN A;  1VQM T;  2LJ3 A;  5GAO r;  1ZUU A;  3RIR A;  3REB B;  1S1N A;  2EW3 A;  4F7U E;  1E6G A;  3OB9 A;  2QQA A;  3OY9 A;  3R6O A;  2JNG A;  2XMF A;  1YCY A;  3CME Q;  3CCQ A;  5L8R E;  3HL8 A;  4C8Q B;  2QAS A;  3CCJ A;  1C0M A;  1KC8 C;  2V8K A;  3M54 A;  1OX9 A;  2DJZ A;  4OGE A;  2VXF A;  1Q82 U;  2G3R A;  2ED1 A;  1N8R C;  2R5A A;  3CD6 A;  2IIM A;  2KSS A;  4C8Q G;  3HRU A;  1KHI A;  2QA4 Q;  1VQ8 Q;  2BIV A;  3WXM B;  4ZTF A;  4E7I A;  3CCU Q;  1YWP A;  1ZBJ A;  2B8A A;  3A1P A;  2DKG A;  1UGV A;  2QQS A;  2DL3 A;  5GMK m;  1ZQ1 A;  2E5Q A;  3QII A;  1ZA2 B;  5GAO l;  2YUP A;  4N4I A;  1ZSZ C;  3I9Q A;  2GFU A;  2PVO B;  3CMA A;  4QVD A;  4HT8 A;  2EPD A;  2DIG A;  1YHQ Q;  3JB9 I;  1C1A A;  2QTX A;  2COY A;  2KE9 A;  2EGA A;  4JS5 A;  3VS1 A;  2BE9 B;  4PJL A;  4QQG A;  1VQ5 T;  5LJ5 d;  3EGD A;  1SRM A;  1Q86 R;  4F7U F;  1VQ9 A;  3RMQ A;  2WAC A;  4IKF A;  1YBY A;  4EMK C;  2DZ9 A;  3RBB B;  3LW5 E;  4O6J A;  1WQW A;  1A0N B;  3SDZ A;  3VJP A;  1BU1 A;  2ZPH B;  5GAN g;  1NEG A;  4KH0 B;  3FC3 A;  2EJF A;  3CC4 A;  3MO8 A;  3QDR B;  2HQE A;  1I5L A;  1Q7Y R;  3A98 A;  3JV3 A;  2GQI A;  5DY9 A;  3QO3 A;  3CEY A;  3VS7 A;  3JAM E;  2LT1 A;  4M78 A;  2CP5 A;  3FRN A;  1UG1 A;  1VQ7 A;  1MGQ A;  2R5M A;  3A8M B;  2HCK A;  2Y4X A;  3M4Y A;  3O5Z A;  4A4G A;  1YJN A;  3G4S A;  4BI3 A;  1Y7X A;  3OMG A;  1AD5 A;  1M30 A;  1WGS A;  2CUB A;  3RKW A;  1G8X A;  2FG0 A;  4OB0 B;  3CQT A;  3QKJ A;  3CCL Q;  1W2B P;  1LVK A;  4RTZ A;  3JCM e;  1WJQ A;  2DYI A;  1VIF A;  2XD0 A;  1K1Z A;  2MWP A;  1IHW A;  2FRW A;  5M9O A;  3C95 A;  4XTV A;  1UEB A;  4C92 C;  3CBM A;  1TS9 A;  4XU3 A;  4F17 A;  4BY6 C;  3S6W A;  2LCL A;  1GFD A;  4OF1 A;  2ZPE B;  2M0O A;  4TVR A;  5GMK h;  1WHL A;  2HL3 A;  1D3B B;  4DOV A;  1QVG P;  1VUB A;  3CCE A;  3HSB A;  2JTM A;  2WSC E;  3QJY A;  3JCM V;  2MCN A;  3RES A;  3HRT A;  1Q86 U;  4RCC A;  1ZUY A;  3GLX A;  2QA4 A;  1NJI C;  2OTL Q;  3AT1 B;  3CCU A;  2DZC A;  3J81 E;  1W2B A;  1I1J A;  4PJO A;  1CKA A;  3PIP A;  3CCQ T;  5KCO A;  3CBP A;  2ROL A;  5IHN A;  3C0C A;  1FXX A;  5IAY A;  3MPU B;  3QWY A;  4ZNX A;  3CCJ T;  4HXJ A;  3I55 A;  2X51 A;  4KGZ B;  4PJO D;  1Q7Y U;  2LJ1 A;  3GNG A;  2DAQ A;  4MZP A;  2WSE E;  1NLO C;  3EH1 A;  3CD6 T;  1M2V B;  1N9R A;  1SF9 A;  3MEW A;  1X75 C;  1AWJ A;  4JJD A;  1QVG A;  1G5V A;  1I4K 1;  4BDY A;  2HAX A;  5GAN d;  1W70 A;  2E6Z A;  3C94 A;  2MK5 A;  1FWZ A;  3LH5 A;  1AVZ C;  1BCM A;  1LPL A;  5KYY A;  1V1C A;  2OTJ A;  1ZBX A;  1XTD A;  1M1F A;  3CMA T;  2P4R A;  4LE9 A;  2YLB A;  1YJW A;  3M55 A;  4HVW A;  4JRQ A;  1W2B S;  2X35 A;  2DXC A;  1QVP A;  2RQT A;  4IUR A;  2L3P A;  4AFS C;  1K9M C;  3JB9 H;  1FYN A;  3VS3 A;  4IIO A;  5AYF A;  4C0D B;  1BIB A;  4PJM A;  4C5E A;  1I5O B;  2ZCF B;  1VQ9 T;  5CKF A;  4M7A A;  5LJ5 e;  2X4J A;  1UFF A;  4PLI A;  1VQO Q;  3VUB A;  2BZ8 A;  3SD4 A;  1QVG S;  1GRI A;  2RM4 A;  3CC4 T;  2M02 A;  4M7A D;  3OYJ A;  4FW1 A;  4J83 A;  1RL2 A;  3FIF A;  1VQ7 T;  2LQK A;  2RK1 A;  2Y4Y A;  4PFO A;  5LL6 S;  1U8R A;  3CBO A;  3QUI A;  2ZAE A;  4PJJ A;  1YJN T;  2JS0 A;  4ESR A;  4J6W A;  2DL5 A;  3G4S T;  1VQ4 A;  3JCM Q;  2NUZ A;  2AZS A;  2GFA A;  5LJ3 h;  3WVE B;  3SB2 A;  1V76 A;  3JB9 G;  1QVF P;  4A4E A;  3TEE A;  5KCH A;  4E7L A;  2RH2 A;  1TUG B;  2QDL A;  2O4X B;  2RK2 A;  4K11 A;  2OTL A;  2E12 A;  1ZSZ B;  3OMC A;  4OMN A;  3GIB A;  2DL7 A;  5GJW B;  4RMO A;  2X9H A;  5LJ3 f;  4LDU A;  3HRS A;  5FRO A;  3E9G A;  1IXD A;  2KXD A;  2YSQ A;  3CCE T;  1WXT A;  4FU6 A;  2J7I A;  1VQP Q;  4E7J A;  4M78 C;  2CP6 A;  4Z8A A;  1N8R R;  2EWN A;  3P8B B;  3OYD A;  1QCN A;  2QA4 T;  1QLY A;  4CC2 A;  2P84 A;  3CCU T;  2EQI A;  4II1 A;  1GFC A;  1MUZ A;  2D0Q B;  2FB7 A;  2CH4 A;  2HBP A;  3PMT A;  1D1B A;  1QVF A;  3SWN A;  2CRE A;  2HSE B;  4PJN A;  3JCM W;  2COZ A;  4HA8 A;  2J6O A;  1NYF A;  3TQ7 P;  4LNP A;  2CP2 A;  1KIK A;  2A28 A;  3QXE B;  2FEI A;  2JTE A;  3CC2 A;  4GLM A;  1WI7 A;  1DJ7 B;  3ASK A;  5D7U A;  2L2P A;  3DB4 A;  2BUD A;  4PNO A;  5J39 A;  3L2V A;  2JVV A;  1WHH A;  1R0B G;  1AHJ B;  1OOT A;  5IHI A;  4Z89 A;  5GAN e;  1G3Y A;  4WCI A;  2D9T A;  2OTJ T;  3X25 B;  1MMG A;  2ATC B;  4XU0 A;  3HKS A;  1YJW T;  4J6Y A;  2QTV A;  2LVM A;  3A8O B;  1I07 A;  2GF7 A;  1QVF S;  1VQ6 Q;  4HCK A;  2CZ1 B;  4PJO C;  2LQW A;  4E6R A;  3JCM g;  2FL7 A;  5GAO q;  4OMP A;  2V8I A;  4KUL A;  4BY6 B;  2DLP A;  5I2M A;  1RAH B;  5GAN 8;  1JU5 C;  1YIJ A;  2EQU A;  2BE7 D;  4R0K A;  1NLP C;  4M75 A;  1WPY A;  1SKU B;  2JS2 A;  2KRN A;  3EHQ A;  4C92 G;  1U1T A;  4BDZ A;  2YRD A;  2ABL A;  3V7R A;  4XTZ A;  3NTH A;  5CKB A;  1B3Q A;  1N8R U;  2RA2 A;  4M75 D;  1AWO A;  2A36 A;  4E7H A;  3HP9 A;  1KQ1 A;  3MKD A;  4FIB A;  3CCM A;  1Q81 C;  2NLU A;  5KYU B;  3OSS C;  3QHS A;  2NUP A;  3UAT A;  3O8V A;  3LGL A;  5GAM h;  1IGQ A;  4ANJ A;  2DJQ A;  3OYK A;  2RHU A;  2L3Q A;  3FJ5 A;  3CC7 A;  1PNJ A;  4JLG A;  1VQN Q;  1X6B A;  3G7Z A;  4LDW A;  1XJW B;  2V1R A;  4M77 A;  3JCM b;  1VQ4 T;  2MAM A;  1PD1 A;  2QQB A;  3QZ5 B;  1VIE A;  4JDS A;  1RAI B;  3OQ5 A;  5GAM f;  1U1S A;  4M7A C;  1AWW A;  4FSS A;  2RI3 A;  3EG3 A;  1T3L A;  1X2Q A;  5HKC A;  2BZX A;  3VRY A;  3HFO A;  1S72 A;  2HBW A;  1YI2 A;  1NJI R;  2OTL T;  1X69 A;  5GAN 5;  2AZV A;  2EYX A;  1AT1 B;  3JSC A;  4WTO B;  2RQW A;  3G1J A;  2G6F X;  4CC4 B;  5A2Q E;  4R56 A;  2GBQ A;  1QW1 A;  4HT9 A;  1ZHI A;  4Y28 E;  4C92 D;  3PIO A;  4IUQ A;  2HZY A;  4MDW A;  1UGQ B;  3E1S A;  4BI4 A;  3QWX X;  4C0Z A;  4DBF A;  4PLL A;  1WXU A;  1WJS A;  2J6F A;  1ZX6 A;  3QDF A;  1I81 A;  4OML A;  1QKW A;  5EG2 A;  5EC7 A;  3V8L A;  3QPH A;  1Y57 A;  3CCS Q;  1TXQ A;  1IGU A;  4V2S A;  2YUQ A;  1G3T A;  3C4S A;  4XK8 E;  3JCM d;  2ROT A;  2Z0W A;  5FU7 C;  2NUT A;  1W1F A;  2JMA A;  3CC2 T;  1K0X A;  2HEQ A;  1K9M R;  4ATO A;  3RER A;  2SRC A;  3T9N A;  1K0S A;  2J05 A;  1YWO A;  3GP8 A;  2EQJ A;  2FZK B;  2DTO A;  2F5K A;  2E65 A;  4C0G A;  2HMA A;  4A54 A;  5DM7 R;  3C12 A;  4M7D A;  4HCZ A;  2Y90 A;  4C8Q F;  3BDL A;  3CCV Q;  4L6V 5;  3EGD B;  4YTL A;  3RUX A;  1VQL A;  1VYV A;  4PKC C;  1HSQ A;  1AOJ A;  4M7D D;  3U23 A;  2DXT A;  2JZ2 A;  1NJI U;  3SWN C;  5KYY B;  1NZ9 A;  3OYB A;  1YIJ T;  3M0R A;  1CKB A;  5LJ3 g;  2A7Y A;  2PNI A;  1NE8 A;  3EG0 A;  2EAY A;  5LJ5 j;  3OYE A;  4B9X A;  3MEA A;  2KMT A;  2QEX Q;  1QMC A;  2YUN A;  5GAN 2;  1OU8 A;  2VWF A;  3OYL A;  2XU8 A;  1OPK A;  1TG0 A;  1OV3 A;  1D0X A;  2CSQ A;  2CZ0 B;  4RCB A;  2BTT A;  1R8O B;  2K79 A;  3CCM T;  1BCO A;  4L5G A;  2MOX A;  2P0K A;  1M1G A;  1G2B A;  2VC8 A;  4M78 G;  2GTJ A;  4OB1 B;  5KYW A;  2GGR A;  2XDD A;  1HYO A;  4BE2 A;  2CKK A;  1UGS B;  3LX7 A;  2PUO B;  3FLG A;  3CC7 T;  1RAA B;  3M0P A;  1MND A;  1O9S A;  4F04 B;  4ELY C;  5HY6 A;  4X1V A;  3EGX B;  2R58 A;  5CO7 A;  3SHW A;  2RI5 A;  3PFS A;  3L2R A;  1CSK A;  1K9M U;  1PG5 B;  2M16 A;  2E3I A;  3V8J A;  2JJ9 A;  4DBH A;  2K5L A;  2D0N A;  1S72 T;  4M75 C;  3OYY A;  2RJD A;  1YI2 T;  3CCR A;  1U5S A;  2EJ9 A;  8ATC B;  4D6W A;  1KD1 C;  3D7S B;  2LCC A;  4QQ6 A;  3L2Z A;  3OYG A;  2RNA A;  2V8J A;  3V7S A;  1MMD A;  3PNW C;  4LUD A;  1M1K R;  2LJ0 A;  4PJO B;  2ED0 A;  5FU6 C;  2KDS A;  4KUI A;  4J7I A;  1M3C A;  2FO0 A;  3RDV A;  2DYB A;  3GF5 A;  4J5Y A;  4M77 C;  4PJO G;  2DD5 A;  2D1X A;  4J7F A;  2X4W A;  3EAE A;  1X43 A;  4Y92 A;  5GAO p;  4M78 D;  2KR3 A;  4JPB W;  4RTY A;  2KAF A;  2KBT A;  1BB9 A;  4JLI A;  1GXI E;  1YNZ A;  2A0F B;  3VU3 C;  2VVK A;  2V1Q A;  5LJ3 d;  2DK3 A;  3EG9 A;  3JCM J;  4QVZ A;  1T0H A;  1R0C B;  4IIM A;  2OJ2 A;  2WSF E;  2EFI A;  2YDL A;  4NL3 A;  1UB4 A;  2EQK A;  1JXO A;  1M9S A;  4OB2 B;  3M58 A;  3CME A;  1X6G A;  3NPF A;  2J06 A;  5GAN j;  1VQL T;  5GAM g;  3M53 A;  2CT4 A;  2DD4 A;  4M7A B;  5GMK e;  5KYX A;  2COW A;  4PL6 A;  1BIA A;  4BB7 A;  3G6E Q;  1PKS A;  2DM1 A;  1Q81 R;  1VQ8 A;  5I11 A;  2MPX C;  3M4G A;  3S3N A;  4M7A G;  1E7O A;  2VAS A;  1WHJ A;  2AK5 A;  2KT8 A;  2DMO A;  3M0S A;  1D1C A;  2RN8 A;  5KE3 A;  1M1K U;  3I56 Q;  2YHT A;  2K3X A;  2O88 A;  4J9E A;  4FYW B;  4A4F A;  2K57 A;  3EGU A;  1YHQ A;  3PTA A;  4J9I A;  1K4U S;  1YP5 A;  2E41 A;  2JN0 A;  2K5F A;  2YT6 A;  2X3W D;  1WJR A;  2F2W A;  1YJ9 Q;  1OZ2 A;  3L2W A;  2AT1 B;  1AZE A;  4F7U A;  4M7D C;  5IT9 E;  4MML A;  2EYQ A;  5AT1 B;  2LZ6 B;  3VS6 A;  1FMK A;  3G71 Q;  1YCS B;  2LMJ A;  4EIK A;  3H6Z A;  1RUW A;  1B34 B;  3VS5 A;  1RLP C;  2DEU A;  1RI0 A;  2C06 A;  3BY7 A;  4RUG A;  4OVA A;  2K9G A;  5IH2 A;  4XTU A;  5FRM A;  2QYZ A;  5CIU A;  3N5B B;  3GPL A;  1EIF A;  1TUC A;  3TSW A;  1PWT A;  3CCR T;  1VQK Q;  2XDP A;  5C0M A;  2XI9 A;  2LQN A;  1BI2 A;  4JS4 A;  2ESW A;  2RQU A;  4XTY A;  3BFM A;  3NFC A;  3DB3 A;  2KK4 A;  2BZY A;  1UGR B;  1OEB A;  4X9C A;  2DPP B;  3Q1J A;  1O75 A;  3CCS T;  4ME7 A;  3JB9 F;  5GAO n;  3GBQ A;  3VUZ A;  1X27 A;  4BE0 A;  3M0Q A;  3PE0 A;  1D3B A;  5I21 A;  2E6N A;  2MMP A;  5GAN 6;  1RLQ C;  1F1B B;  1Q81 U;  2ENM A;  2RD1 A;  3SWN B;  3CCL A;  1JXM A;  2JOY A;  4JJB A;  2K7A A;  4ZN3 A;  1E6H A;  2ZGW A;  1KHC A;  2DO3 A;  1VOM A;  3M59 A;  3S3M A;  1VQM Q;  4GBQ A;  2CS7 A;  5GAM d;  1G3S A;  2E1H A;  1Y0M A;  1QWF A;  1UHF A;  2YLC A;  4FT4 A;  4HVU A;  5CK9 A;  1PRM C;  2LRQ A;  1Y96 A;  1M90 C;  1HXD A;  4C92 E;  3ZEH A;  1TH7 A;  4A53 A;  2VGN A;  2QXF A;  3TSZ A;  3ULR B;  1M2V A;  4N0A A;  7AT1 B;  2DXB A;  1C6V X;  2L3R A;  2IPO B;  5LJ3 e;  2FPF A;  2YRV A;  2KRM A;  2VB6 A;  3QYH B;  3X26 B;  4IUP A;  1RAG B;  1M8V A;  3CME T;  3MEV A;  1YIT Q;  4HVV A;  4B9W A;  4JJN K;  3LLR A;  3I56 A;  1LJO A;  3BW1 A;  1I8F A;  1KC8 R;  3UA7 A;  4AMC A;  1WX6 A;  3VS0 A;  2DER A;  5J26 A;  4M75 B;  2ZPI B;  3A5Z B;  5DLQ E;  2DX1 A;  1VQ8 T;  5IN1 A;  1JQQ A;  4EMK B;  4JRK A;  6AT1 B;  1D09 B;  2DRK A;  2VUB A;  3MHX A;  3H0F A;  1M3B A;  2P0Q A;  2RHZ A;  4M75 G;  3EFO B;  2RB6 A;  5L23 A;  2PUK B;  3NTI A;  8AT1 B;  5KH6 A;  5HK0 A;  2XID A;  1Q95 G;  2DNU A;  4QQD A;  1Q86 C;  1YHQ T;  3JCM X;  2YWW A;  1OZ3 A;  3I5S A;  1K9A A;  4A63 B;  3H0H A;  4C92 F;  1JO8 A;  2LX9 A;  4M77 B;  4X9D A;  2LT4 A;  3UDC A;  1IB8 A;  2XG8 D;  4J9H A;  3EG1 A;  3OW2 P;  3JCM P;  1KD1 R;  2A37 A;  4J9C A;  1WNL A;  4M77 G;  2KY9 A;  1VQO A;  3SEM A;  3OYF A;  4JJC A;  3RR6 A;  3FEO A;  1IO6 A;  3MET A;  2VKN A;  2D8H A;  4ORZ A;  2L5Q A;  4C92 B;  4JRI A;  5GAN 3;  3THK A;  4NS5 A;  2O9V A;  1TTH B;  4X34 A;  3UWN A;  2JMC A;  3MCA B;  4JUV A;  3LGF A;  3J80 E;  2A3L A;  2PZ1 A;  4N4H A;  2ZPB B;  3WVD B;  4C5H A;  4LDY A;  1KC8 U;  1T0J A;  1WFW A;  1QWE A;  2EJG A;  2RJE A;  3M5A A;  3OW2 A;  1D0Z A;  3MEU A;  2GTO A;  2RI2 A;  3CCL T;  2NWM A;  1G3W A;  4DBR A;  1ZUK A;  5IXF A;  2NUT B;  2AHJ B;  1JEG A;  2MI6 A;  1PM3 A;  2E3H A;  3INZ A;  4C5G A;  5GAM e;  3V8K A;  1YIT A;  1IZ6 A;  1BYM A;  3BDU A;  1Y71 A;  2EBP A;  2RHI A;  3REA B;  5CAI A;  2HSP A;  2W10 A;  4C5I A;  1WHG A;  3CCQ Q;  1VQP A;  4M77 D;  1FX7 A;  3DLL A;  2ZPF B;  2PVD B;  4M7D B;  3RKX A;  5DLO A;  3CCJ Q;  3OW2 S;  3QG1 A;  4JZ3 A;  1KD1 U;  1GL5 A;  4DOW A;  1PSE A;  3CD6 Q;  1PSF A;  4M7D G;  1N27 A;  1KFZ A;  2OI3 A;  3I56 T;  5FRN A;  2QGG A;  4M78 E;  3M0U A;  2D6F A;  1AWX A;  2DL8 A;  1M2O A;  2DVJ A;  4QKU A;  2ECZ A;  3A8H B;  4E2F B;  2DVE A;  3L1A A;  5GMK j;  5GMK l;  1EX4 A;  1OU9 A;  1SSH A;  1UJ0 A;  2VXE A;  3CMA Q;  1KK7 A;  3AHU A;  5HCK A;  2P0P A;  1SEM A;  1X01 A;  2RMO A;  1M27 C;  2F2X A;  4E7Z A;  1MV0 B;  2YRC A;  4RTU A;  1HK9 A;  3OSV A;  1H3Z A;  1VQ9 Q;  1HJD A;  5KYW B;  4N0A C;  4XQ3 A;  3H0I A;  2CP0 A;  1UUE A;  3LYI A;  3OYI A;  1LCK A;  1VQ6 A;  4AFU C;  4IUV A;  3CC4 Q;  3UPU A;  3UT1 A;  3X28 B;  2KVQ G;  2K2V A;  2JM9 A;  1OPL A;  1WYX A;  2RJF A;  1VQO T;  2YUO A;  2DF6 A;  3M57 A;  5CQY A;  4PJO E;  1VQ7 Q;  2DBM A;  4M78 F;  1QCF A;  4C0D C;  1GCP A;  4Q5W A;  1RAB B;  3A8L B;  1WLP B;  1MNE A;  5C6S A;  2CSI A;  2HD0 A;  2KNB B;  5HK3 A;  4LD9 K;  5GMK i;  1RI9 A;  4XAX B;  5IHK A;  5A0L A;  3G4S Q;  1ACM B;  3MP1 A;  4HKE A;  4F14 A;  2XDB A;  1GBR A;  1W6X A;  2IVW A;  2M0Y A;  4QVC A;  3OYN A;  4OMF B;  1SSF A;  1VQN A;  2A08 A;  2O2O A;  1OX8 A;  3I5R A;  4M78 B;  2NYS A;  1JJ2 P;  2EGE A;  4QT7 A;  5FLX E;  2VGM A;  1M90 R;  3CPW P;  4BUG A;  2DIL A;  2RHY A;  2MIO A;  2ZZD A;  2EGC A;  2CP3 A;  1QP2 A;  3CCE Q;  4HCC A;  2LTO A;  4ZN1 A;  5CKH A;  4LDV A;  1YIT T;  3EG9 B;  2E10 A;  4MMK A;  4M7A E;  3RMS A;  2V26 A;  1D0Y A;  1YN8 A;  3KXT A;  4PJO F;  4DEX A;  4CI0 C;  5CVI A;  1VQP T;  4Z02 A;  4MZT A;  1UGP B;  5J3B A;  4O5V A;  3E19 A;  2PQW A;  3DLM A;  4R55 A;  1Y07 A;  1BI0 A;  3BE3 A;  4KGV B;  3I55 Q;  1JJ2 A;  4GLK A;  4RTV A;  2OAU A;  1NPR A;  2I2L A;  3CPW A;  1WDX A;  2K3Y A;  5LJ3 j;  4FCY A;  2C0O A;  5KYX B;  4LD6 A;  4RKU E;  2GNC A;  1QP3 A;  3CCS A;  3ZL7 C;  2LQ8 A;  3GNF B;  1W4S A;  1GCQ A;  1N6A A;  1D1A A;  1U06 A;  5CQX A;  1G83 A;  4AG1 C;  4FYX B;  3VS4 A;  3JB9 J;  4EPC A;  2HL5 C;  1B7T A;  3FB9 A;  2OTJ Q;  2B86 A;  1NM7 A;  3QSU A;  5I2S A;  1K8A C;  3UA6 A;  1YJW Q;  2DTH A;  4FYY B; 
#chains in the Genus database with same CATH homology
 3OW2 P;  1QVF P;  1YJN Q;  3CC4 Q;  3CCS Q;  1KD1 R;  3G6E Q;  1JJ2 P;  1VQP Q;  3G4S Q;  1VQ8 Q;  1VQO Q;  2QA4 Q;  1VQ5 Q;  1K8A R;  1M90 R;  1S72 Q;  1Q81 R;  3CPW P;  3CCQ Q;  3CCU Q;  1N8R R;  3CC2 Q;  2OTL Q;  1YI2 Q;  1M1K R;  3CC7 Q;  1VQL Q;  3CME Q;  1VQM Q;  1VQ4 Q;  1VQ9 Q;  1Q82 R;  3CD6 Q;  1YJ9 Q;  3CCR Q;  3CCJ Q;  1NJI R;  3CXC P;  3CCV Q;  1Q7Y R;  1VQN Q;  1Q86 R;  1K9M R;  1KQS P;  1VQ6 Q;  1K73 R;  2QEX Q;  3CCE Q;  3CMA Q;  3CCL Q;  1W2B P;  1VQ7 Q;  3I55 Q;  1QVG P;  1YIT Q;  1YJW Q;  1VQK Q;  2OTJ Q;  3I56 Q;  3CCM Q;  1YIJ Q;  1YHQ Q;  3G71 Q;  1KC8 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...