1KD1W

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
b'TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1kd1W00
1NJIW 1S72V 1K8AW 3CCQV 1KQSU 3G4SV 3CC4V 3G71V 1YJ9V 2QA4V 3CC7V 1N8RW 1VQ6V 3CCMV 3CC2V 3CCVV 4WFBV 3CPWU 3CCJV 1YIJV 3I56V 1YJNV 1Q81W 1VQKV 4WCEV 4WFAV 1KC8W 1M90W 1VQ4V 1Q7YW 2OTLV 1VQLV 3CMEV 1W2BU 1K9MW 1YITV 3CD6V 5DM6V 1YJWV 1Q86W 2D3OW 1KD1W 3OW2U 1K73W 3CXCU 1VQ8V 3I55V 1VQ9V 1VQNV 1VQ5V 3CMAV 3CCRV 3CCLV 1YHQV 3CCSV 3CCEV 1Q82W 1M1KW 1YI2V 1QVGU 1JJ2U 1VQMV 3G6EV 3CCUV 1VQ7V 2OTJV 1VQPV 2QEXV 1VQOV 4WF9V 1QVFU 1R73A
chains in the Genus database with same CATH superfamily
4DR4B 1RP3B 2ZE6A 4W4LA 3G71V 2ITCC 1Q81W 2HHHO 1O9GA 4OGQB 1FFXB 2ITDC 1S3JA 4EB6A 1VQLV 3HKDB 1GM9A 1JJOA 2P90A 3S3XA 1PV0A 2NR5A 5HFMA 4DV4O 2YIAA 2DMXA 2CGNA 1K34A 4HYOA 4ZOLA 4DYLA 3CCMV 2FL4A 5IJ0A 4WFBV 3GVMA 1SESA 4PHZA 3L72H 3QO5A 4YJ2A 1RSOA 1FXVA 2WPDG 1K9MW 4DV2B 3OTOB 2Y48A 3E86A 4ZI7B 4F6RB 1FD9A 4E2LA 4MW8A 4QNHB 1L1FA 1P7GA 3ABMC 1WNSA 5L3GA 1BCCH 2IJJA 2ZKOA 1OJHA 2R70A 3ZMSA 4JI2B 4FFBB 4BIOA 1TA8A 1AJQA 4DUYO 1PNLA 4JI5O 1MABG 4DR1B 2CH7B 5BMVB 1GRJA 1AILA 2UU9O 3K5OA 5BR8O 1N36B 1EN6A 4TV8A 2M7WA 5ITZA 1J5EB 4QE9A 2DWDC 2E5LO 4JPRA 1MNGA 1IURA 1DF5A 5IYZB 4EFEA 1H8EG 2ZXWC 2JJ1G 2EILB 2DJVA 3L73H 1KKDA 3K0GA 1KUQA 3ZS8C 5LMNB 3DXRA 2MW2B 2V4DA 2ZT9B 5D5QA 3ZHRA 4DV1B 1Q82W 3B8NA 1QBZA 1VQOV 3RWRD 1YEWA 2A9HA 4NXMB 4HBNA 3QO7A 1FXHA 5DECA 3DC6A 3ZHSA 4FLYA 3N2GB 3ETGA 3H01A 4XDLA 4TQFA 1GN4A 2XT9A 1JX9A 2RCVA 3LSQA 2QKCA 4CZZA 4NTYA 2PYJA 1B06A 2ZDIC 1Q43A 4EFBA 4PI2A 3BCCH 1K97A 4LF7B 4G27B 1K5SA 4PJ0Z 3G67A 2DN9A 3RW0A 1MA1A 3O65A 5F2VO 2ZNIA 3U10A 2LGWA 1BMFG 3GWKC 3GWOA 4DR5B 3AG3C 3AG7A 1WAZA 2ZNJA 4JI4O 2DQ0A 1TAEA 5LHHA 5CBFA 5H6QA 4MT8A 1AR5A 3E2EA 5JH7B 4LFBB 2A3QA 1J95A 4DV5O 1XMOO 4JI3B 4U3JA 2F95B 5KUKA 4LBEC 5K1XA 1I08A 1D5AA 3B40A 4OXSA 4JV5B 1NH2B 3OMNB 1IDSA 4GCZA 3T1HB 1S72V 4AQYB 3ZJZA 3SDLA 3E8GA 4FM1A 2F4VB 1YTFD 5B1OA 4K8XA 2GSMB 2BCCH 3BVOA 4HNAB 4MTFA 3P30A 4OPHA 2WLIB 5L3DA 1OZ0A 1S76D 4E4EA 1I0HA 3IGAC 4I4TB 4AI8A 1YF2A 4CS4A 5KUMA 1OCOC 4YIPA 1OV9A 5JJEB 1R3JC 3UQ8A 1VP7A 3JAWA 5IT9N 3VQWA 3G6BA 2YXLA 3CX5F 5CMUA 3ZX6A 1AI7A 1M56C 3BEHA 2A0LA 3JASB 1LUVA 2YC0A 2FB5A 1N34O 4FJCC 3FAVA 3MAQA 4JI6B 2V7QG 2XUMA 1ZX3A 1XUQA 1XL4A 1IX9A 3RYIB 1V55B 3ABLB 1WB7A 5LYJB 3N27A 1RM1B 3OFNG 1QLEC 5IYDO 4LF4B 4UFZA 1QLNA 4I7ZB 2ZE5A 3OMIB 4FLZA 3K59A 5LP6A 1R73A 3F5TA 3H1IH 5L3EA 5J2UB 1OCCB 4JYYA 2Z0AA 2ADQB 3F5WC 1OCZB 2YIDA 2LW1A 3NXSA 1F4MA 1FJGO 5CBGA 4X64B 3E8BA 1THZA 5A9GA 1AP6A 1Q6IA 3DC5A 2B1GA 1AR4A 2HVKC 3WU2Z 3AK2A 5LA6B 2A79B 1BHBA 5GW7A 5CA0A 1H2SB 1YHQV 4F4LA 1H2NA 3N2KB 1DGSA 4LP8A 5C8YA 1SQXH 3TCUA 4LF8B 3I5DA 2H94A 1NR1A 3KZIZ 2RDCA 4IHJB 2PI5A 1E1QG 1N32O 4LF5B 4DW0A 1FFTB 4LF9B 3ASOC 2VQEB 2WLHA 1Q86W 2R9AA 4TUYA 2QTOA 4QJFB 4J11A 3RN4A 3CJHB 4B3MO 3D8CA 4O2BB 3ASNB 4I50B 4X88A 1MG1A 2DWEC 3ABKB 1YIJV 2KQXA 3Q4HA 3STLC 1BZKA 3QTCA 4FMTA 5E79Z 1MZFA 1ORQC 2OIGA 4X65B 3SPHA 2LW7A 4PDLA 3RYFB 2DYSC 5EZYA 4LNUB 2QWPB 3SYOA 5EIBD 4YHHO 1YJWV 2BTOA 1YSCA 3OW2U 2VQFB 1AVMA 1ENVA 4FLXA 4FLTA 2QE7G 4JI7O 1VQPV 2GUZB 1NTMH 4DR6O 3AG4B 5IY5C 2RMKB 4XDKA 3ABTA 1Q5OA 3CC7V 2YDEA 4JI1B 4TV9A 4RQFA 1XILA 3IFXA 4O2AB 4GKKB 1IBLB 3LSUA 2XAHA 3D3QA 2C2AA 1OCRC 2UUCB 1K73W 4B7KA 5EC1C 4LFCB 3FB6C 4NR1A 4X20B 3T1YB 4DV0O 5LXTB 4FLWA 4BR6A 2BTQA 3CE2A 1HR0B 3VQVA 1IBMO 1M57C 3K9AA 2XNDG 2G38A 4TWKA 1IZ3A 1DLBA 4X9QA 2ZINA 4X1IA 2DYRC 2UXNA 3C3TA 1E79G 2OCHA 5KX5B 2ZQMA 1Q6HA 1VQ8V 4PA4A 3E8HA 2WLLA 2WLNA 1EN4A 3CCRV 4CC5A 5EBLC 2FKXA 1QNMA 3E8FA 4H0LB 4DV7O 3CCJV 4N21A 4IYHA 1IBKO 2Q0AA 1FKAO 4ZHQA 4X66O 1NZ6A 3OR6C 2YUAA 2OIEA 1S5LZ 1HNXB 2ZE8A 2QWOB 2X6BA 3LNNA 1VEWA 1I94O 1ZAUA 4B3TB 4MVZA 2YIBA 1FFXA 2V1DA 5B3SB 4LH6A 4P30A 2YI9A 4DR2B 3EFFK 3GB7C 1I7FA 3HKDA 2JVDA 2E76B 2JDIG 4LFAB 1W2BU 3ICXA 2RN9A 3JARB 1BQ0A 4B3RB 5C93A 3ZRVA 2VWJA 4K8ZA 2QDOA 3UM7A 4MW3A 4ZI7A 4F6RA 3K5MA 2ATKC 1PNKA 5EYPB 1Z5VA 1W0KG 3FB5C 1SQFA 1XBLA 3JD1A 4JTAB 1SQPH 4GX2A 1VQ9V 4O4HB 1JOYA 1GN2A 4ABMA 3H1JH 4FFBA 3G80A 3ETQA 5IDJA 1EN5A 2XASA 2GTSA 4JZGA 2PI4A 5EIBC 3ZHQA 4X62O 2UUBO 2Q7GA 3OT7A 5BMVA 4P9PA 4WFHA 2HVJC 2JK5C 1MZEA 2LFRA 1GAXA 4IL6Z 1HNWB 4UV9A 2Q68A 5EBWC 2AW9A 5IYZA 1GM7A 2XTAA 1N4CA 2JEUA 3KKYA 4DV4B 1CEZA 2OTJV 4WF9V 5GTHZ 3VQYA 2EIJB 2P06A 4HAMA 1KMIZ 3QG5A 1HDJA 2UXCO 4RUEA 3ZN0A 1MSDA 3UKMA 5LMUO 4D7SA 3F7VC 2PF4E 3CXHF 2CK3G 1BQZA 2PUSA 4DUYB 4JI5B 3HKCB 3ZBHA 3N2GA 4PDRA 4FLVA 3ETDA 4LCUC 4HZ3A 2UU9B 5BR8B 1GTOA 3SYCA 5H5NA 1XI1A 4H37A 3CMEV 3RFRA 3ABUA 4NKGB 2PTMA 1M1KW 2ZR3A 4DW1A 4DUZO 2ZIMA 1KQSU 3JCUZ 4MTOA 3SYQA 3ZEDA 2MK3A 3H1HH 4J41A 4WFAV 2P6JA 1G4YB 3ZCCA 1YDXA 3DGEA 2O57A 3EXAA 1FXKB 4GYCB 5JH7A 3K5NA 2OCCB 5EC2C 4UVBA 3QNEA 2FYUH 4BAYA 2R9IA 3D3IA 4XDJA 4FIPC 3LDEA 4WBNB 2LGQA 4G28B 1NI8A 5IJ9B 4H33A 2Y0PA 3CEIA 5B66Z 3B09A 4OPAA 4P2ZA 4UCOA 1BL8A 3SR2C 2GHYA 2XHBA 1XMQO 1H2MA 1SZTA 4K35A 4KP4A 4UCTA 4GKJB 2P4KA 1SQBH 4HNAA 1N8RW 3BFRA 2WLIA 4IT5A 1R6KA 1VF7A 4I4TA 3JATB 1GKFA 2JGDB 1K92A 2IH3C 4JI4B 2B9ZA 3AG1B 5KLVH 3MHHC 2ZM6B 1VQ7V 5A2QN 4Z2WA 5J2TB 2VRZA 4KHPO 1S77D 2CUGA 3JASA 1JA8A 1Y66A 4PA6A 2EIKB 2XAQA 4UVAA 4DV2O 1HW7A 3K57A 1L8DA 3RYIA 5KHIA 3RYCB 5JVDB 4O4JB 1KP3A 3JAKB 3DTUB 5LYJA 2A7WA 1R3LC 5IE9A 1OCCC 1S5JA 4JI2O 3MHSC 3O9OA 2QKSA 1QCEA 4CH3A 4UUJC 4NXNB 4DR1O 1NVPB 5DM6V 1GO3F 5JWPA 1KP2A 3CCLV 1N36O 3CCEV 4EB6B 2WWWA 1YVWA 1LUWA 5J2UA 3JSNA 2QJ1A 1V54C 2EJRA 4MVOA 2W0XA 4CH4A 2QWNB 3TJTA 4DK1A 3OEEG 1I5YA 3IJ4A 4JYAO 3APQA 3AK1A 1H38A 5B1AC 4GX0A 2IJHA 2VWKA 2R9RB 1KBHA 2X0LA 3APOA 2KKWA 3RGBA 2GDSA 5LA6A 1SS3A 3KCXA 5LBQA 1COWG 1Q7YW 3SYAA 4ZBMA 4DR3O 2RQ6A 3N2KA 1FPOA 2DW4A 4JGSA 1MOFA 1AR1B 2LQTA 3ABMB 4IHJA 1I5XA 4XBFA 2XAFA 2CDYA 1H2LA 1PKXA 4KL1A 1Q90D 1H2GA 3OEHG 3CRAA 2HP8A 3CJHA 3HKBA 2F1MA 1ZL8B 2ZD9A 4O2BA 4R7CA 3I55V 2WA4A 3X2QC 1DF4A 2Y69C 1DTOA 3AG4C 5KHKA 2IU3A 4QGPA 1U96A 2BE3A 3RYFA 4LNUA 3T4ZA 1Q8IA 1FYJA 5LP6C 3JALB 4GX1A 2OYQA 2Q8VA 4JI3O 2GUZA 1BS3A 4FZ0A 4IYIA 1QR9A 3ZHTA 4PV1B 2L35A 1PD3A 2WLKA 4O2AA 2JGUA 4I0XB 4O4IB 1QQCA 1XHXA 1M9NA 1N32B 3W7SA 1PP9H 3PN1A 3SPCA 1SQGA 1K7DA 2N74A 1SF9A 4X20A 4LWSB 5LXTA 2E74B 4Z1MG 4FZ1A 4B3MB 2EZPA 1NU1H 4DV3B 2HJDA 5CA1B 2YIBD 2Y4TA 3OMAB 1Y67A 2HLDG 4GX5A 1BHAA 5KX5A 1BSMA 1Y74B 1VQ4V 4YHHB 2YSUB 3OM3B 2Q4PA 3T4DA 5IWAO 2IH1C 3K58A 3CRRA 1XNQO 5KMGB 3AG3B 4JI7B 3WG7C 4DR6B 2ARHA 5DN6G 1N0NA 3ZRSA 3LNMB 3P3NA 2QWRB 5B3SC 1O9HA 1EM1A 4OX9B 5H9CA 1G6UA 2ZIOA 2DOSA 1PPJH 5AG2A 3BAAA 4LC1A 4O4LB 3KCYA 5LOVB 3W7TA 5E1AC 3KG2A 3MDSA 2EIMC 2YI8A 3THOA 3H1KH 2JJ2G 1GK9A 2ETNA 3A0BZ 3JD2A 1IBMB 4X1KB 4UCSA 2AZ2A 2A06H 4MVUA 3A0HZ 3FB8C 4UVCA 4PA3A 1TUBB 1G1XB 3CC2V 3JARA 2D2CB 3SYPA 2RNBA 3F7YC 1YITV 2HFEC 1WA8B 3OAAG 3FYEB 1B6QA 3AG2B 4AHCA 1PL4A 2AHYA 2EINC 4DR7O 2E3CA 5KA5A 5EYPA 1OCOB 4MS2A 3BHPA 3SJQC 1IBKB 1VF6C 4X66B 2IBZH 2HR3A 2IJKA 4MTGA 4O4HA 4DXWA 4K0KO 1TUEB 1I94B 4C7UA 4N23A 1SA0B 1HP8A 3QF7A 1P49A 3CMAV 4MVMA 5JCOA 1MMMA 1VF6A 4P9OA 4CS2A 3K9SA 2PGGA 1XNRO 4FLUA 4IGGA 2P67A 4JAAA 3JCZA 5L3CA 1MSWD 1R1BA 3EHBB 1IXBA 3I56V 4J80A 2YXHA 2CTRA 2WA3A 5BXZA 1HNZO 1XL6A 4YY3O 5FPOA 1NT2B 2ZCEA 3CD6V 1QLEB 3B4SA 4LF6B 5GONB 2VQEO 4EEQA 3U11A 2UXBO 1M4UA 4NTWA 5KHGA 2HJFC 5LHGA 2L6LA 3G4SV 1R3KC 1EZVH 1XHZA 2Z3YA 3C90A 2BSKA 4K3AA 3QVNA 4I55B 4TQDA 2QWQB 2CTWA 5FLXN 5LL6Y 1WPBA 4X65O 1M5IA 3K3WA 3IC9A 3HKCA 4X62B 5CBHA 4BIUA 2VQFO 1XEQA 2Q6AA 5LGTA 1TVKB 4LR3A 2UUAO 4FPPA 5BZBA 4MVRA 3HKEB 2GV9A 1SQQH 2FTKA 3P3PA 5D5PA 3CRMA 3R66A 2OTLV 1H8HG 1Q3EA 2Q7HA 1NH2D 3SGIA 1VARA 4GT1A 1SERA 1VQNV 1Y6XA 1FXKC 5LGNA 3TXSA 1W59A 2JIZG 1XDCA 1AB3A 2F93B 2AGAA 2YEVB 2UXCB 1FXKA 2UXDO 2B5UA 1L0NH 4UB8Z 3ASOB 4X89A 2GBOA 4LH7A 4J42A 4BW9A 5LMUB 2PYLA 1YTFB 2P5OA 1AJNA 1Y4MA 4TT3G 4JTCB 3DSQA 3ZIAG 5EZYB 1TGOA 4DRXB 4B08A 1R3IC 4YIOA 4WBNA 2K9PA 4QPKA 1JFFB 5FNVB 5IJ9A 2HHHB 2CH7A 2QGNA 2IJIA 3CCVV 1AP5A 2QTSA 3WB1A 5B1BB 1N33O 2EILC 4JAVA 1RFYA 2B1IA 3D36A 2X7RB 1CP9A 2XOKG 4MTXA 4JI8O 3RYHB 4DUZB 4RAIA 4KXRA 1K33A 3TXQA 4Q6GA 1QVFU 4B3TO 5IY5B 3JATA 4B3SO 3M99B 2JGDA 1PNMA 3SJAC 4YJ3B 2Q7EA 4NVPA 1U97A 1XOUA 4ZIBA 4LFAO 1B3QA 5EBMC 5J2TA 4I5SA 2QSAA 5HFLA 4DV6O 5BY1A 1WB8A 5JQGB 3JD3A 4X1IB 3UT5B 1VF5B 3TGUH 2X6CA 4JI0O 1M57B 2KG7B 3H1LH 1WLEA 4BW5A 5FL7G 1BE3H 3STZC 4MVSA 2Y4UA 3RYCA 4WFFA 2KSDA 5JVDA 1XMQB 4O4JA 1SZXA 3JAKA 2E5LB 3LDCA 3W7WA 3ZRWB 3T1CA 1F4NA 1Z5WA 2K1EA 4UB6Z 4PI0A 3J81N 4GUNA 2CTPA 3SPJA 2LO1A 1HNWO 5J9PC 1AJPA 3E22B 2PZSA 4CS3A 3ZMUA 2AHZA 3CRCA 4KHPB 3U0ZA 5B5EZ 1EBOA 1L0LH 3T2MA 2P4VA 3E35A 1YJ9V 5CB4B 3HR0A 1N0JA 3B2EE 1F51A 1YJNV 1JQ0A 2P22C 1PL0A 5LHIA 5K1PA 4IIJB 4TSFG 2OT5A 1X59A 2H3OA 3HB3B 1PM9A 3PJSK 4U3FH 4RO2A 4JF3A 3CCQV 1RPRA 4NB5A 5FPRA 4X1YB 1ZSPA 3ZHVA 1G8MA 2Y0IA 1S0VA 4DR4O 3BABA 3OTFA 2Q0OC 5LGUA 1GM8A 3FX7A 4EKWA 1UPGA 4Q20A 1Z2GA 3TK1A 4DV5B 4J10A 1XMOB 1ZL8A 3OE7G 4JYAB 4Z1VA 3OUFA 1V55C 2ZE7A 3ABLC 3L75H 3QO8A 1SRYA 1GN6A 4CH6A 2FMLA 1ZUQA 1RM1C 3JAMN 1H2KA 3L70H 4RWUA 3OTOO 1VMGA 3L9DA 1Y76B 3IC7A 3K06A 4JYCA 1NS1A 3JALA 1YCIA 1F23A 1ZWIC 2QA4V 4D7TA 4AILC 2ADPA 4DR3B 4FVMA 4H13B 3BA8A 2EBOA 4UV8A 1OCZC 1D2DA 1WN7A 3VQXA 4MVQA 2QM4A 4I0XA 3L71H 4O4IA 3ZHUA 1K5QA 1JJ2U 1T5EA 1J5EO 4R6ZA 4R50A 4LWSA 1QU7A 4YXWG 3JYCA 4PD4F 4GKJO 1UJWB 1OHHG 1VQKV 1P4RA 3K03A 2ZDIA 2Q67A 4ZOLB 1ZLZA 4PDMA 1K4CC 1EFRG 3VOUA 5CA1A 5IJ0B 1FAFA 2BOBC 1N34B 4YJ2B 1RSOB 3AK3A 5LMNO 1Y74A 1R6NA 3W7UA 4DV1O 2ZM6O 1JCHA 5KAFZ 1ROPA 1KKCA 2NN4A 5KMGA 4NXMO 3B8MA 4KFMA 4ZKIA 1JVMA 2W6IG 2HKOA 4UCUA 1GMGA 1W0JG 3K79A 2D3OW 4RUFA 1KECA 4L8JA 4UCVA 1NTKH 4DK0A 2Q73A 3BRCA 2QEXV 4O4LA 5LOVA 4TV8B 4PA7A 5ITZB 4BIZA 3ASNC 3OR7C 3EVKA 2QM7A 3ABKC 4LF7O 1SETA 4WCEV 3E89A 3TETA 2EZOA 2HG5C 4PA9A 1FJGB 1AI4A 4X1KA 2WLJA 4R8CA 1AI6A 3AG2C 4NXNO 1TUBA 3SJBC 3FB7C 4I50A 4DR5O 2Z5UA 3G6EV 1YXBA 3DXRB 3R65A 3CP1A 1WA8A 4CC6A 4JZ2A 5IWAB 4QE7A 2ZXWB 3WB0A 4WFGA 1XNQB 4LFBO 2CTQA 4I9QA 1V9PA 5KAIZ 1F7YA 4ASUG 2W0FC 2AZ0A 5IYCO 2EJ7A 4FM0A 5B1NA 1VQMV 3CCUV 1SQVH 1P84F 2XAGA 1BGYH 4JV5O 3T1HO 3JD0A 1BT8A 1SA0A 1IXMA 1KU9A 4AQYO 2F4VO 1NBMG 2N04A 4PDVA 3M7MX 3B77A 2OWOA 4B7EA 3RT3C 1QVGU 2HEPA 4GLXA 1NJIW 2JS5A 2QKAA 3JSLA 1JPXA 3J7AU 1CPYA 2NNUA 5GONA 2WAMA 1YZBA 3L74H 1M90W 1CXZB 4GZRB 3CHXA 4DR7B 1KB9F 1SC5B 3FKSG 4U3JB 3FD9A 4JYBA 1E1RG 2BOCC 4I55A 1XREA 1AI5A 1V54B 2XAJA 5KHHA 1R6TA 4K0KB 2ODMA 5TISZ 4JI6O 2QR4A 3SPGA 4L87A 3LUTB 5L3FA 2F23A 3A2FA 5IYBO 2VS0A 5B1AB 2LJ2A 1TVKA 1DK1A 4DV0B 4I9WA 3UCSC 1XNRB 3HKEA 4U7OA 1YI2V 4ICGA 3M8AA 1QHTA 2Q69A 3ETEA 4LF4O 2QM8A 4G2KA 3CC4V 1HNZB 1FS0G 4YY3B 5KHJA 2CAZC 1M93A 2Q5ZA 3K08A 4JTDB 3JAWB 2PY5A 2UXBB 2X6AA 3OGIB 3HKBB 3NR7A 2IW5A 2YEVA 4J7JA 4X64O 4TOIA 5H2FZ 1URFA 1K4DC 1IVSA 4DV3O 4DV7B 1KYOF 3OUSA 5JCOC 3CPWU 1K8AW 1EZJA 5B1BC 3FAVB 3CB2A 1M56B 2N05A 4DRXA 1JFFA 1D5NA 1GH6A 2M6YA 5FNVA 3X2QB 2UUAB 1AROP 2Y69B 2IU0A 3P32A 3RVZA 2WLMA 4X8AA 5JJJB 1SKVA 4PELA 4J9ZB 2EIJC 4LF8O 4OX9O 2NLJC 2ILMA 3RYHA 1LR1A 4NYKA 5LP6B 2ZR2A 4FFKA 2LFSA 3JD4A 2DE0X 3OD4A 2EULA 4LF5O 1NKDA 4LF9O 3AEIA 5KA6A 2JRIA 3ZRXA 2YXYA 4YJ3A 1WJZA 2UXDB 1HWYA 1NVPD 4FM2A 1B04A 3WB2A 5JQGA 1LNQA 3UT5A 2Q9LA 4KUMA 2WSSG 3ZMZA 2W6JG 4QIWF 2YICA 4J9YB 2UUBB 3ZMVA 2KG7A 1RPOA 5CA0B 3BA9A 4J7KA 3RBZA 4UXNA 2CE4A 3S3WA 2DQ3A 1N33B 4A5UB 3C3SA 1US6A 4D6TH 1NQTA 3ZMTA 3J80N 1KC8W 5C8YB 4JI1O 3LSSA 4CH5A 3RVYA 4JI8B 4GKKO 1IBLO 3ZRWA 3WG7B 2IM9A 4JAUA 3CCSV 5H6RA 2UUCO 3SPIA 4B3SB 1NTZH 2OCCC 4LFCO 1K3EA 3OGCC 3T1YO 2R72A 4TUYB 1NR7A 2KB1A 1HR0O 3IAYA 3E22A 3VBBA 3UO3A 2YS8A 2EIMB 2H8PC 4DV6B 3A8TA 3BY6A 4U7NA 2RJZA 3Q4HB 1S5HC 3CXCU 5JJNB 4F6EA 5CB4A 3FFQA 5DEDA 4LF6O 5GTIZ 2F43G 4RQEA 4JI0B 3D36C 3CYOA 1X4TA 3WFVA 1WPXA 4IIJA 2P7TC 4JASA 4MSWC 3E83A 4BWAA 1JMKC 4WFEA 1GN3A 2LP7A 1VIBA 4TV9B 2DYSB 1UFIA 3AG1C 1WP8A 1VQ5V 2EINB 3ZN1A 4X1YA 5CN0A 1HNXO 2JS3A 3K5LA 5CA3A 4UCRA 3BPZA 5L3BA 2E75B 3CSXA 3H9VA 1P7BA 2AXTZ 2EX3A 4DR2O 2CGOA 2BTQB 2GTAA 3K04A 1QR8A 1WP7A 3CS5A 2EIKC 1OCRB 3K0DA 4NTXA 3W7XA 1XQ8A 1ZTEA 3ML0A 4B3RO 1A32A 3FYIB 3SJCC 2WLLB 1VQ6V 4H44B 2UXXA 3UO2A 5EK0A 3CWBH 2JEXA 4FK5C 3MD0A 1Y76A 4DO2A 3LDDA 2DYRB 1Q6UA 2BSKB 1KD1W 3CRQA 4QPJA 4CBCA 3A0RA 4W4KA 4ZHQB 4J7ZA 1JR9A 2F66C 3HPLC
chains in the Genus database with same CATH topology
4R50A 5EBLC 3OMAB 4YXWG 3JYCA 3G71V 2HLDG 4GX5A 2ITCC 3E8FA 1BHAA 1UJWB 3CCJV 1Q81W 1VQ4V 1OHHG 1VQKV 4N21A 1P4RA 2YSUB 3OM3B 2ITDC 1S3JA 3K03A 3T4DA 2IH1C 1VQLV 2ZDIA 3OR6C 2Q67A 4PDMA 1K4CC 1EFRG 3AG3B 3VOUA 1GM9A 2P90A 2BOBC 2X6BA 3WG7C 5DN6G 5HFMA 3ZRSA 4MVZA 1R6NA 3LNMB 3W7UA 5B3SC 2V1DA 5B3SB 1JCHA 4P30A 5H9CA 1K34A 3EFFK 4HYOA 1ROPA 3GB7C 3CCMV 4WFBV 4LC1A 3B8MA 1SESA 3QO5A 3W7TA 2JDIG 4KFMA 5E1AC 4ZKIA 1JVMA 1FXVA 3KG2A 2W6IG 2WPDG 1W2BU 2HKOA 1K9MW 2EIMC 1GMGA 2Y48A 3E86A 1W0JG 3K79A 2D3OW 4RUFA 2JJ2G 4E2LA 1GK9A 4MW8A 4QNHB 1L1FA 3JD2A 1KECA 3ABMC 5L3GA 2QEXV 2IJJA 4MVUA 3ZRVA 5C93A 3FB8C 4UVCA 4PA7A 4PA3A 4BIZA 3ZMSA 3ASNC 3OR7C 3UM7A 2QM7A 3CC2V 1AJQA 4MW3A 3SYPA 2ATKC 1PNKA 1PNLA 1SETA 3ABKC 4WCEV 3E89A 3TETA 1MABG 2EZOA 2HG5C 4PA9A 1W0KG 3FB5C 3F7YC 1AI4A 2WLJA 4R8CA 1YITV 2HFEC 3OAAG 3FYEB 1AI6A 3JD1A 1B6QA 4JTAB 4GX2A 3AG2C 2M7WA 3AG2B 1VQ9V 3FB7C 4QE9A 1JOYA 2EINC 2AHYA 2DWDC 2Z5UA 5IDJA 3G6EV 4JPRA 5KA5A 2XASA 2PI4A 1DF5A 1OCOB 4MS2A 1H8EG 3R65A 4P9PA 3SJQC 3CP1A 4WFHA 2HR3A 2IJKA 4QE7A 4MTGA 2ZXWC 2HVJC 2JJ1G 2ZXWB 2JK5C 2EILB 4WFGA 4DXWA 2LFRA 1KKDA 4UV9A 3K0GA 1TUEB 2Q68A 5EBWC 4N23A 4ASUG 1GM7A 2JEUA 2W0FC 5IYCO 3CMAV 4MVMA 1Q82W 1CEZA 5B1NA 4P9OA 1VQMV 3CCUV 3B8NA 2OTJV 1QBZA 1VQOV 4WF9V 2A9HA 2XAGA 2P67A 3QO7A 2EIJB 3JCZA 5L3CA 1FXHA 1MSWD 3EHBB 4HAMA 3JD0A 1IXMA 3I56V 1XL6A 3ETGA 3H01A 4RUEA 3CD6V 4XDLA 1NBMG 3ZN0A 1QLEB 4PDVA 1JX9A 3LSQA 3B77A 4CZZA 3UKMA 1QVGU 2ZDIC 3F7VC 2HJFC 5LHGA 1NJIW 1K97A 2CK3G 3G4SV 1R3KC 4G27B 1K5SA 1JPXA 4PDRA 3RW0A 2Z3YA 1CPYA 3ETDA 2NNUA 4LCUC 4HZ3A 2WAMA 1M90W 1GTOA 3SYCA 4H37A 1BMFG 3CMEV 3GWOA 3AG3C 3ABUA 3K3WA 3FKSG 1M1KW 2ZR3A 4JYBA 5CBHA 4BIUA 2DQ0A 1E1RG 2BOCC 5LHHA 5CBFA 2Q6AA 5LGTA 5H6QA 1AI5A 1V54B 4FPPA 1KQSU 2XAJA 4MT8A 5BZBA 4MVRA 4MTOA 3E2EA 3SYQA 2MK3A 1J95A 2FTKA 4WFAV 3SPGA 2P6JA 4L87A 3LUTB 1G4YB 3ZCCA 5L3FA 2OTLV 1H8HG 3DGEA 5KUKA 4LBEC 5IYBO 1NH2D 5B1AB 4GT1A 1SERA 1VQNV 4I9WA 1FXKC 1FXKB 4OXSA 5LGNA 4U7OA 1YI2V 1NH2B 2OCCB 2Q69A 3ETEA 3OMNB 4UVBA 5EC2C 2QM8A 4GCZA 2JIZG 4G2KA 1S72V 3CC4V 3QNEA 3ZJZA 4BAYA 1FS0G 2YEVB 2R9IA 3E8GA 3D3IA 4XDJA 4FIPC 3LDEA 1YTFD 1FXKA 5B1OA 2GSMB 3K08A 2B5UA 4G28B 4JTDB 4H33A 3ASOB 4MTFA 4X89A 3P30A 2WLIB 5L3DA 1OZ0A 4P2ZA 1YTFB 1S76D 3IGAC 1BL8A 2X6AA 1AJNA 2GHYA 1Y4MA 4TT3G 4JTCB 2IW5A 1SZTA 2YEVA 4KP4A 3ZIAG 5KUMA 1R3IC 1K4DC 1OCOC 4QPKA 1R3JC 1N8RW 2IJIA 3OUSA 3CCVV 2WLIA 3CPWU 1R6KA 1K8AW 1EZJA 5B1BC 5B1BB 5CMUA 2EILC 1AI7A 4JAVA 1M56C 1GKFA 1M56B 1K92A 2B1IA 2IH3C 3BEHA 2X7RB 1CP9A 2XOKG 3D36A 3AG1B 4MTXA 2A0LA 3X2QB 4RAIA 1AROP 3MHHC 1VQ7V 2Y69B 1K33A 4FJCC 2IU0A 1QVFU 3P32A 3RVZA 2WLMA 5IY5B 4X8AA 2V7QG 3M99B 4PELA 4J9ZB 2EIJC 1S77D 1XL4A 2NLJC 1V55B 3ABLB 1PNMA 2ZR2A 2LFSA 1Y66A 3JD4A 1RM1B 3OFNG 4PA6A 2EIKB 1QLEC 2XAQA 5EBMC 4I5SA 5IYDO 4UVAA 1NKDA 5HFLA 1QLNA 3AEIA 3JD3A 5KA6A 3OMIB 1R73A 3ZRXA 1KP3A 3DTUB 5L3EA 1R3LC 2X6CA 1M57B 1HWYA 1NVPD 1OCCC 1OCCB 3MHSC 2QKSA 3F5WC 1WLEA 1QCEA 4BW5A 1OCZB 1LNQA 5FL7G 4UUJC 3STZC 4MVSA 3NXSA 1NVPB 4KUMA 2WSSG 4WFFA 1F4MA 5DM6V 5CBGA 1GO3F 3ZMZA 2W6JG 4QIWF 1KP2A 3E8BA 1THZA 3LDCA 3CCLV 3W7WA 3CCEV 2WWWA 4J9YB 3ZMVA 1RPOA 3ZRWB 3T1CA 1V54C 3RBZA 4UXNA 2EJRA 4MVOA 2DQ3A 1F4NA 2B1GA 2K1EA 1NQTA 3ZMTA 1KC8W 2HVKC 3LSSA 3OEEG 1I5YA 3RVYA 2A79B 1H38A 5B1AC 5GW7A 3SPJA 3ZRWA 1BHBA 5J9PC 1AJPA 4GX0A 2IJHA 3WG7B 1YHQV 4JAUA 3CCSV 5H6RA 3ZMUA 3SPIA 2R9RB 2AHZA 4F4LA 2X0LA 2OCCC 4LP8A 1K3EA 3OGCC 3TCUA 1EBOA 2H94A 3T2MA 1NR1A 3E35A 1YJ9V 1NR7A 2KB1A 1F51A 1YJNV 2PI5A 5LBQA 1JQ0A 1COWG 1PL0A 1Q7YW 5LHIA 1E1QG 3VBBA 3SYAA 4ZBMA 1FFTB 2EIMB 2H8PC 3ASOC 2WLHA 1Q86W 4TSFG 3BY6A 4U7NA 2OT5A 2QTOA 4QJFB 1S5HC 3CXCU 2DW4A 4JGSA 1MOFA 1AR1B 3ABMB 2F43G 4XBFA 1I5XA 3HB3B 4RQEA 3PJSK 3CYOA 2XAFA 4JF3A 4RO2A 3WFVA 3CCQV 3ASNB 1RPRA 4X88A 1WPXA 1MG1A 2DWEC 1G8MA 2P7TC 1S0VA 1PKXA 3ABKB 1YIJV 1H2GA 4JASA 4FMTA 3OEHG 4MSWC 3E83A 3STLC 4WFEA 2LP7A 1ORQC 3SPHA 5LGUA 4PDLA 2DYSC 1YJWV 3SYOA 2DYSB 1GM8A 2ZD9A 4EKWA 1YSCA 4R7CA 3OW2U 3I55V 3AG1C 1VQ5V 1ENVA 2EINB 3ZN1A 3X2QC 2QE7G 1DF4A 4Q20A 5CN0A 1VQPV 2Y69C 1DTOA 3AG4C 3AG4B 5CA3A 5IY5C 4XDKA 3ABTA 3TK1A 3CC7V 5L3BA 2IU3A 4RQFA 1P7BA 3OE7G 3IFXA 3T4ZA 3OUFA 1V55C 3ABLC 3QO8A 2XAHA 1SRYA 3K04A 1QR8A 2C2AA 4GX1A 1RM1C 1OCRC 2EIKC 1OCRB 3K0DA 3W7XA 1K73W 5EC1C 1QR9A 3FB6C 1PD3A 3IC7A 2WLKA 3ML0A 3K06A 4JYCA 3FYIB 2WLLB 1F23A 1ZWIC 2QA4V 1VQ6V 1M9NA 1M57C 2UXXA 3K9AA 2XNDG 3W7SA 5EK0A 3SPCA 2JEXA 1K7DA 4FK5C 4TWKA 2EBOA 1DLBA 3MD0A 4UV8A 1OCZC 4DO2A 2DYRC 2UXNA 3LDDA 2DYRB 1E79G 4Z1MG 2ZQMA 4MVQA 1KD1W 1VQ8V 4PA4A 3E8HA 2WLLA 2EZPA 2WLNA 4QPJA 3CCRV 4CBCA 3A0RA 1K5QA 1JJ2U 4R6ZA 3HPLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NJI W;  1S72 V;  1K8A W;  3CCQ V;  1KQS U;  3G4S V;  3CC4 V;  3G71 V;  1YJ9 V;  2QA4 V;  3CC7 V;  1N8R W;  1VQ6 V;  3CCM V;  3CC2 V;  3CCV V;  4WFB V;  3CPW U;  3CCJ V;  1YIJ V;  3I56 V;  1YJN V;  1Q81 W;  1VQK V;  4WCE V;  4WFA V;  1KC8 W;  1M90 W;  1VQ4 V;  1Q7Y W;  2OTL V;  1VQL V;  3CME V;  1W2B U;  1K9M W;  1YIT V;  3CD6 V;  5DM6 V;  1YJW V;  1Q86 W;  2D3O W;  1KD1 W;  3OW2 U;  1K73 W;  3CXC U;  1VQ8 V;  3I55 V;  1VQ9 V;  1VQN V;  1VQ5 V;  3CMA V;  3CCR V;  3CCL V;  1YHQ V;  3CCS V;  3CCE V;  1Q82 W;  1M1K W;  1YI2 V;  1QVG U;  1JJ2 U;  1VQM V;  3G6E V;  3CCU V;  1VQ7 V;  2OTJ V;  1VQP V;  2QEX V;  1VQO V;  4WF9 V;  1QVF U;  1R73 A; 
#chains in the Genus database with same CATH topology
 4DR4 B;  1RP3 B;  2ZE6 A;  4W4L A;  3G71 V;  2ITC C;  1Q81 W;  2HHH O;  1O9G A;  4OGQ B;  1FFX B;  2ITD C;  1S3J A;  4EB6 A;  1VQL V;  3HKD B;  1GM9 A;  1JJO A;  2P90 A;  3S3X A;  1PV0 A;  2NR5 A;  5HFM A;  4DV4 O;  2YIA A;  2DMX A;  2CGN A;  1K34 A;  4HYO A;  4ZOL A;  4DYL A;  3CCM V;  2FL4 A;  5IJ0 A;  4WFB V;  3GVM A;  1SES A;  4PHZ A;  3L72 H;  3QO5 A;  4YJ2 A;  1RSO A;  1FXV A;  2WPD G;  1K9M W;  4DV2 B;  3OTO B;  2Y48 A;  3E86 A;  4ZI7 B;  4F6R B;  1FD9 A;  4E2L A;  4MW8 A;  4QNH B;  1L1F A;  1P7G A;  3ABM C;  1WNS A;  5L3G A;  1BCC H;  2IJJ A;  2ZKO A;  1OJH A;  2R70 A;  3ZMS A;  4JI2 B;  4FFB B;  4BIO A;  1TA8 A;  1AJQ A;  4DUY O;  1PNL A;  4JI5 O;  1MAB G;  4DR1 B;  2CH7 B;  5BMV B;  1GRJ A;  1AIL A;  2UU9 O;  3K5O A;  5BR8 O;  1N36 B;  1EN6 A;  4TV8 A;  2M7W A;  5ITZ A;  1J5E B;  4QE9 A;  2DWD C;  2E5L O;  4JPR A;  1MNG A;  1IUR A;  1DF5 A;  5IYZ B;  4EFE A;  1H8E G;  2ZXW C;  2JJ1 G;  2EIL B;  2DJV A;  3L73 H;  1KKD A;  3K0G A;  1KUQ A;  3ZS8 C;  5LMN B;  3DXR A;  2MW2 B;  2V4D A;  2ZT9 B;  5D5Q A;  3ZHR A;  4DV1 B;  1Q82 W;  3B8N A;  1QBZ A;  1VQO V;  3RWR D;  1YEW A;  2A9H A;  4NXM B;  4HBN A;  3QO7 A;  1FXH A;  5DEC A;  3DC6 A;  3ZHS A;  4FLY A;  3N2G B;  3ETG A;  3H01 A;  4XDL A;  4TQF A;  1GN4 A;  2XT9 A;  1JX9 A;  2RCV A;  3LSQ A;  2QKC A;  4CZZ A;  4NTY A;  2PYJ A;  1B06 A;  2ZDI C;  1Q43 A;  4EFB A;  4PI2 A;  3BCC H;  1K97 A;  4LF7 B;  4G27 B;  1K5S A;  4PJ0 Z;  3G67 A;  2DN9 A;  3RW0 A;  1MA1 A;  3O65 A;  5F2V O;  2ZNI A;  3U10 A;  2LGW A;  1BMF G;  3GWK C;  3GWO A;  4DR5 B;  3AG3 C;  3AG7 A;  1WAZ A;  2ZNJ A;  4JI4 O;  2DQ0 A;  1TAE A;  5LHH A;  5CBF A;  5H6Q A;  4MT8 A;  1AR5 A;  3E2E A;  5JH7 B;  4LFB B;  2A3Q A;  1J95 A;  4DV5 O;  1XMO O;  4JI3 B;  4U3J A;  2F95 B;  5KUK A;  4LBE C;  5K1X A;  1I08 A;  1D5A A;  3B40 A;  4OXS A;  4JV5 B;  1NH2 B;  3OMN B;  1IDS A;  4GCZ A;  3T1H B;  1S72 V;  4AQY B;  3ZJZ A;  3SDL A;  3E8G A;  4FM1 A;  2F4V B;  1YTF D;  5B1O A;  4K8X A;  2GSM B;  2BCC H;  3BVO A;  4HNA B;  4MTF A;  3P30 A;  4OPH A;  2WLI B;  5L3D A;  1OZ0 A;  1S76 D;  4E4E A;  1I0H A;  3IGA C;  4I4T B;  4AI8 A;  1YF2 A;  4CS4 A;  5KUM A;  1OCO C;  4YIP A;  1OV9 A;  5JJE B;  1R3J C;  3UQ8 A;  1VP7 A;  3JAW A;  5IT9 N;  3VQW A;  3G6B A;  2YXL A;  3CX5 F;  5CMU A;  3ZX6 A;  1AI7 A;  1M56 C;  3BEH A;  2A0L A;  3JAS B;  1LUV A;  2YC0 A;  2FB5 A;  1N34 O;  4FJC C;  3FAV A;  3MAQ A;  4JI6 B;  2V7Q G;  2XUM A;  1ZX3 A;  1XUQ A;  1XL4 A;  1IX9 A;  3RYI B;  1V55 B;  3ABL B;  1WB7 A;  5LYJ B;  3N27 A;  1RM1 B;  3OFN G;  1QLE C;  5IYD O;  4LF4 B;  4UFZ A;  1QLN A;  4I7Z B;  2ZE5 A;  3OMI B;  4FLZ A;  3K59 A;  5LP6 A;  1R73 A;  3F5T A;  3H1I H;  5L3E A;  5J2U B;  1OCC B;  4JYY A;  2Z0A A;  2ADQ B;  3F5W C;  1OCZ B;  2YID A;  2LW1 A;  3NXS A;  1F4M A;  1FJG O;  5CBG A;  4X64 B;  3E8B A;  1THZ A;  5A9G A;  1AP6 A;  1Q6I A;  3DC5 A;  2B1G A;  1AR4 A;  2HVK C;  3WU2 Z;  3AK2 A;  5LA6 B;  2A79 B;  1BHB A;  5GW7 A;  5CA0 A;  1H2S B;  1YHQ V;  4F4L A;  1H2N A;  3N2K B;  1DGS A;  4LP8 A;  5C8Y A;  1SQX H;  3TCU A;  4LF8 B;  3I5D A;  2H94 A;  1NR1 A;  3KZI Z;  2RDC A;  4IHJ B;  2PI5 A;  1E1Q G;  1N32 O;  4LF5 B;  4DW0 A;  1FFT B;  4LF9 B;  3ASO C;  2VQE B;  2WLH A;  1Q86 W;  2R9A A;  4TUY A;  2QTO A;  4QJF B;  4J11 A;  3RN4 A;  3CJH B;  4B3M O;  3D8C A;  4O2B B;  3ASN B;  4I50 B;  4X88 A;  1MG1 A;  2DWE C;  3ABK B;  1YIJ V;  2KQX A;  3Q4H A;  3STL C;  1BZK A;  3QTC A;  4FMT A;  5E79 Z;  1MZF A;  1ORQ C;  2OIG A;  4X65 B;  3SPH A;  2LW7 A;  4PDL A;  3RYF B;  2DYS C;  5EZY A;  4LNU B;  2QWP B;  3SYO A;  5EIB D;  4YHH O;  1YJW V;  2BTO A;  1YSC A;  3OW2 U;  2VQF B;  1AVM A;  1ENV A;  4FLX A;  4FLT A;  2QE7 G;  4JI7 O;  1VQP V;  2GUZ B;  1NTM H;  4DR6 O;  3AG4 B;  5IY5 C;  2RMK B;  4XDK A;  3ABT A;  1Q5O A;  3CC7 V;  2YDE A;  4JI1 B;  4TV9 A;  4RQF A;  1XIL A;  3IFX A;  4O2A B;  4GKK B;  1IBL B;  3LSU A;  2XAH A;  3D3Q A;  2C2A A;  1OCR C;  2UUC B;  1K73 W;  4B7K A;  5EC1 C;  4LFC B;  3FB6 C;  4NR1 A;  4X20 B;  3T1Y B;  4DV0 O;  5LXT B;  4FLW A;  4BR6 A;  2BTQ A;  3CE2 A;  1HR0 B;  3VQV A;  1IBM O;  1M57 C;  3K9A A;  2XND G;  2G38 A;  4TWK A;  1IZ3 A;  1DLB A;  4X9Q A;  2ZIN A;  4X1I A;  2DYR C;  2UXN A;  3C3T A;  1E79 G;  2OCH A;  5KX5 B;  2ZQM A;  1Q6H A;  1VQ8 V;  4PA4 A;  3E8H A;  2WLL A;  2WLN A;  1EN4 A;  3CCR V;  4CC5 A;  5EBL C;  2FKX A;  1QNM A;  3E8F A;  4H0L B;  4DV7 O;  3CCJ V;  4N21 A;  4IYH A;  1IBK O;  2Q0A A;  1FKA O;  4ZHQ A;  4X66 O;  1NZ6 A;  3OR6 C;  2YUA A;  2OIE A;  1S5L Z;  1HNX B;  2ZE8 A;  2QWO B;  2X6B A;  3LNN A;  1VEW A;  1I94 O;  1ZAU A;  4B3T B;  4MVZ A;  2YIB A;  1FFX A;  2V1D A;  5B3S B;  4LH6 A;  4P30 A;  2YI9 A;  4DR2 B;  3EFF K;  3GB7 C;  1I7F A;  3HKD A;  2JVD A;  2E76 B;  2JDI G;  4LFA B;  1W2B U;  3ICX A;  2RN9 A;  3JAR B;  1BQ0 A;  4B3R B;  5C93 A;  3ZRV A;  2VWJ A;  4K8Z A;  2QDO A;  3UM7 A;  4MW3 A;  4ZI7 A;  4F6R A;  3K5M A;  2ATK C;  1PNK A;  5EYP B;  1Z5V A;  1W0K G;  3FB5 C;  1SQF A;  1XBL A;  3JD1 A;  4JTA B;  1SQP H;  4GX2 A;  1VQ9 V;  4O4H B;  1JOY A;  1GN2 A;  4ABM A;  3H1J H;  4FFB A;  3G80 A;  3ETQ A;  5IDJ A;  1EN5 A;  2XAS A;  2GTS A;  4JZG A;  2PI4 A;  5EIB C;  3ZHQ A;  4X62 O;  2UUB O;  2Q7G A;  3OT7 A;  5BMV A;  4P9P A;  4WFH A;  2HVJ C;  2JK5 C;  1MZE A;  2LFR A;  1GAX A;  4IL6 Z;  1HNW B;  4UV9 A;  2Q68 A;  5EBW C;  2AW9 A;  5IYZ A;  1GM7 A;  2XTA A;  1N4C A;  2JEU A;  3KKY A;  4DV4 B;  1CEZ A;  2OTJ V;  4WF9 V;  5GTH Z;  3VQY A;  2EIJ B;  2P06 A;  4HAM A;  1KMI Z;  3QG5 A;  1HDJ A;  2UXC O;  4RUE A;  3ZN0 A;  1MSD A;  3UKM A;  5LMU O;  4D7S A;  3F7V C;  2PF4 E;  3CXH F;  2CK3 G;  1BQZ A;  2PUS A;  4DUY B;  4JI5 B;  3HKC B;  3ZBH A;  3N2G A;  4PDR A;  4FLV A;  3ETD A;  4LCU C;  4HZ3 A;  2UU9 B;  5BR8 B;  1GTO A;  3SYC A;  5H5N A;  1XI1 A;  4H37 A;  3CME V;  3RFR A;  3ABU A;  4NKG B;  2PTM A;  1M1K W;  2ZR3 A;  4DW1 A;  4DUZ O;  2ZIM A;  1KQS U;  3JCU Z;  4MTO A;  3SYQ A;  3ZED A;  2MK3 A;  3H1H H;  4J41 A;  4WFA V;  2P6J A;  1G4Y B;  3ZCC A;  1YDX A;  3DGE A;  2O57 A;  3EXA A;  1FXK B;  4GYC B;  5JH7 A;  3K5N A;  2OCC B;  5EC2 C;  4UVB A;  3QNE A;  2FYU H;  4BAY A;  2R9I A;  3D3I A;  4XDJ A;  4FIP C;  3LDE A;  4WBN B;  2LGQ A;  4G28 B;  1NI8 A;  5IJ9 B;  4H33 A;  2Y0P A;  3CEI A;  5B66 Z;  3B09 A;  4OPA A;  4P2Z A;  4UCO A;  1BL8 A;  3SR2 C;  2GHY A;  2XHB A;  1XMQ O;  1H2M A;  1SZT A;  4K35 A;  4KP4 A;  4UCT A;  4GKJ B;  2P4K A;  1SQB H;  4HNA A;  1N8R W;  3BFR A;  2WLI A;  4IT5 A;  1R6K A;  1VF7 A;  4I4T A;  3JAT B;  1GKF A;  2JGD B;  1K92 A;  2IH3 C;  4JI4 B;  2B9Z A;  3AG1 B;  5KLV H;  3MHH C;  2ZM6 B;  1VQ7 V;  5A2Q N;  4Z2W A;  5J2T B;  2VRZ A;  4KHP O;  1S77 D;  2CUG A;  3JAS A;  1JA8 A;  1Y66 A;  4PA6 A;  2EIK B;  2XAQ A;  4UVA A;  4DV2 O;  1HW7 A;  3K57 A;  1L8D A;  3RYI A;  5KHI A;  3RYC B;  5JVD B;  4O4J B;  1KP3 A;  3JAK B;  3DTU B;  5LYJ A;  2A7W A;  1R3L C;  5IE9 A;  1OCC C;  1S5J A;  4JI2 O;  3MHS C;  3O9O A;  2QKS A;  1QCE A;  4CH3 A;  4UUJ C;  4NXN B;  4DR1 O;  1NVP B;  5DM6 V;  1GO3 F;  5JWP A;  1KP2 A;  3CCL V;  1N36 O;  3CCE V;  4EB6 B;  2WWW A;  1YVW A;  1LUW A;  5J2U A;  3JSN A;  2QJ1 A;  1V54 C;  2EJR A;  4MVO A;  2W0X A;  4CH4 A;  2QWN B;  3TJT A;  4DK1 A;  3OEE G;  1I5Y A;  3IJ4 A;  4JYA O;  3APQ A;  3AK1 A;  1H38 A;  5B1A C;  4GX0 A;  2IJH A;  2VWK A;  2R9R B;  1KBH A;  2X0L A;  3APO A;  2KKW A;  3RGB A;  2GDS A;  5LA6 A;  1SS3 A;  3KCX A;  5LBQ A;  1COW G;  1Q7Y W;  3SYA A;  4ZBM A;  4DR3 O;  2RQ6 A;  3N2K A;  1FPO A;  2DW4 A;  4JGS A;  1MOF A;  1AR1 B;  2LQT A;  3ABM B;  4IHJ A;  1I5X A;  4XBF A;  2XAF A;  2CDY A;  1H2L A;  1PKX A;  4KL1 A;  1Q90 D;  1H2G A;  3OEH G;  3CRA A;  2HP8 A;  3CJH A;  3HKB A;  2F1M A;  1ZL8 B;  2ZD9 A;  4O2B A;  4R7C A;  3I55 V;  2WA4 A;  3X2Q C;  1DF4 A;  2Y69 C;  1DTO A;  3AG4 C;  5KHK A;  2IU3 A;  4QGP A;  1U96 A;  2BE3 A;  3RYF A;  4LNU A;  3T4Z A;  1Q8I A;  1FYJ A;  5LP6 C;  3JAL B;  4GX1 A;  2OYQ A;  2Q8V A;  4JI3 O;  2GUZ A;  1BS3 A;  4FZ0 A;  4IYI A;  1QR9 A;  3ZHT A;  4PV1 B;  2L35 A;  1PD3 A;  2WLK A;  4O2A A;  2JGU A;  4I0X B;  4O4I B;  1QQC A;  1XHX A;  1M9N A;  1N32 B;  3W7S A;  1PP9 H;  3PN1 A;  3SPC A;  1SQG A;  1K7D A;  2N74 A;  1SF9 A;  4X20 A;  4LWS B;  5LXT A;  2E74 B;  4Z1M G;  4FZ1 A;  4B3M B;  2EZP A;  1NU1 H;  4DV3 B;  2HJD A;  5CA1 B;  2YIB D;  2Y4T A;  3OMA B;  1Y67 A;  2HLD G;  4GX5 A;  1BHA A;  5KX5 A;  1BSM A;  1Y74 B;  1VQ4 V;  4YHH B;  2YSU B;  3OM3 B;  2Q4P A;  3T4D A;  5IWA O;  2IH1 C;  3K58 A;  3CRR A;  1XNQ O;  5KMG B;  3AG3 B;  4JI7 B;  3WG7 C;  4DR6 B;  2ARH A;  5DN6 G;  1N0N A;  3ZRS A;  3LNM B;  3P3N A;  2QWR B;  5B3S C;  1O9H A;  1EM1 A;  4OX9 B;  5H9C A;  1G6U A;  2ZIO A;  2DOS A;  1PPJ H;  5AG2 A;  3BAA A;  4LC1 A;  4O4L B;  3KCY A;  5LOV B;  3W7T A;  5E1A C;  3KG2 A;  3MDS A;  2EIM C;  2YI8 A;  3THO A;  3H1K H;  2JJ2 G;  1GK9 A;  2ETN A;  3A0B Z;  3JD2 A;  1IBM B;  4X1K B;  4UCS A;  2AZ2 A;  2A06 H;  4MVU A;  3A0H Z;  3FB8 C;  4UVC A;  4PA3 A;  1TUB B;  1G1X B;  3CC2 V;  3JAR A;  2D2C B;  3SYP A;  2RNB A;  3F7Y C;  1YIT V;  2HFE C;  1WA8 B;  3OAA G;  3FYE B;  1B6Q A;  3AG2 B;  4AHC A;  1PL4 A;  2AHY A;  2EIN C;  4DR7 O;  2E3C A;  5KA5 A;  5EYP A;  1OCO B;  4MS2 A;  3BHP A;  3SJQ C;  1IBK B;  1VF6 C;  4X66 B;  2IBZ H;  2HR3 A;  2IJK A;  4MTG A;  4O4H A;  4DXW A;  4K0K O;  1TUE B;  1I94 B;  4C7U A;  4N23 A;  1SA0 B;  1HP8 A;  3QF7 A;  1P49 A;  3CMA V;  4MVM A;  5JCO A;  1MMM A;  1VF6 A;  4P9O A;  4CS2 A;  3K9S A;  2PGG A;  1XNR O;  4FLU A;  4IGG A;  2P67 A;  4JAA A;  3JCZ A;  5L3C A;  1MSW D;  1R1B A;  3EHB B;  1IXB A;  3I56 V;  4J80 A;  2YXH A;  2CTR A;  2WA3 A;  5BXZ A;  1HNZ O;  1XL6 A;  4YY3 O;  5FPO A;  1NT2 B;  2ZCE A;  3CD6 V;  1QLE B;  3B4S A;  4LF6 B;  5GON B;  2VQE O;  4EEQ A;  3U11 A;  2UXB O;  1M4U A;  4NTW A;  5KHG A;  2HJF C;  5LHG A;  2L6L A;  3G4S V;  1R3K C;  1EZV H;  1XHZ A;  2Z3Y A;  3C90 A;  2BSK A;  4K3A A;  3QVN A;  4I55 B;  4TQD A;  2QWQ B;  2CTW A;  5FLX N;  5LL6 Y;  1WPB A;  4X65 O;  1M5I A;  3K3W A;  3IC9 A;  3HKC A;  4X62 B;  5CBH A;  4BIU A;  2VQF O;  1XEQ A;  2Q6A A;  5LGT A;  1TVK B;  4LR3 A;  2UUA O;  4FPP A;  5BZB A;  4MVR A;  3HKE B;  2GV9 A;  1SQQ H;  2FTK A;  3P3P A;  5D5P A;  3CRM A;  3R66 A;  2OTL V;  1H8H G;  1Q3E A;  2Q7H A;  1NH2 D;  3SGI A;  1VAR A;  4GT1 A;  1SER A;  1VQN V;  1Y6X A;  1FXK C;  5LGN A;  3TXS A;  1W59 A;  2JIZ G;  1XDC A;  1AB3 A;  2F93 B;  2AGA A;  2YEV B;  2UXC B;  1FXK A;  2UXD O;  2B5U A;  1L0N H;  4UB8 Z;  3ASO B;  4X89 A;  2GBO A;  4LH7 A;  4J42 A;  4BW9 A;  5LMU B;  2PYL A;  1YTF B;  2P5O A;  1AJN A;  1Y4M A;  4TT3 G;  4JTC B;  3DSQ A;  3ZIA G;  5EZY B;  1TGO A;  4DRX B;  4B08 A;  1R3I C;  4YIO A;  4WBN A;  2K9P A;  4QPK A;  1JFF B;  5FNV B;  5IJ9 A;  2HHH B;  2CH7 A;  2QGN A;  2IJI A;  3CCV V;  1AP5 A;  2QTS A;  3WB1 A;  5B1B B;  1N33 O;  2EIL C;  4JAV A;  1RFY A;  2B1I A;  3D36 A;  2X7R B;  1CP9 A;  2XOK G;  4MTX A;  4JI8 O;  3RYH B;  4DUZ B;  4RAI A;  4KXR A;  1K33 A;  3TXQ A;  4Q6G A;  1QVF U;  4B3T O;  5IY5 B;  3JAT A;  4B3S O;  3M99 B;  2JGD A;  1PNM A;  3SJA C;  4YJ3 B;  2Q7E A;  4NVP A;  1U97 A;  1XOU A;  4ZIB A;  4LFA O;  1B3Q A;  5EBM C;  5J2T A;  4I5S A;  2QSA A;  5HFL A;  4DV6 O;  5BY1 A;  1WB8 A;  5JQG B;  3JD3 A;  4X1I B;  3UT5 B;  1VF5 B;  3TGU H;  2X6C A;  4JI0 O;  1M57 B;  2KG7 B;  3H1L H;  1WLE A;  4BW5 A;  5FL7 G;  1BE3 H;  3STZ C;  4MVS A;  2Y4U A;  3RYC A;  4WFF A;  2KSD A;  5JVD A;  1XMQ B;  4O4J A;  1SZX A;  3JAK A;  2E5L B;  3LDC A;  3W7W A;  3ZRW B;  3T1C A;  1F4N A;  1Z5W A;  2K1E A;  4UB6 Z;  4PI0 A;  3J81 N;  4GUN A;  2CTP A;  3SPJ A;  2LO1 A;  1HNW O;  5J9P C;  1AJP A;  3E22 B;  2PZS A;  4CS3 A;  3ZMU A;  2AHZ A;  3CRC A;  4KHP B;  3U0Z A;  5B5E Z;  1EBO A;  1L0L H;  3T2M A;  2P4V A;  3E35 A;  1YJ9 V;  5CB4 B;  3HR0 A;  1N0J A;  3B2E E;  1F51 A;  1YJN V;  1JQ0 A;  2P22 C;  1PL0 A;  5LHI A;  5K1P A;  4IIJ B;  4TSF G;  2OT5 A;  1X59 A;  2H3O A;  3HB3 B;  1PM9 A;  3PJS K;  4U3F H;  4RO2 A;  4JF3 A;  3CCQ V;  1RPR A;  4NB5 A;  5FPR A;  4X1Y B;  1ZSP A;  3ZHV A;  1G8M A;  2Y0I A;  1S0V A;  4DR4 O;  3BAB A;  3OTF A;  2Q0O C;  5LGU A;  1GM8 A;  3FX7 A;  4EKW A;  1UPG A;  4Q20 A;  1Z2G A;  3TK1 A;  4DV5 B;  4J10 A;  1XMO B;  1ZL8 A;  3OE7 G;  4JYA B;  4Z1V A;  3OUF A;  1V55 C;  2ZE7 A;  3ABL C;  3L75 H;  3QO8 A;  1SRY A;  1GN6 A;  4CH6 A;  2FML A;  1ZUQ A;  1RM1 C;  3JAM N;  1H2K A;  3L70 H;  4RWU A;  3OTO O;  1VMG A;  3L9D A;  1Y76 B;  3IC7 A;  3K06 A;  4JYC A;  1NS1 A;  3JAL A;  1YCI A;  1F23 A;  1ZWI C;  2QA4 V;  4D7T A;  4AIL C;  2ADP A;  4DR3 B;  4FVM A;  4H13 B;  3BA8 A;  2EBO A;  4UV8 A;  1OCZ C;  1D2D A;  1WN7 A;  3VQX A;  4MVQ A;  2QM4 A;  4I0X A;  3L71 H;  4O4I A;  3ZHU A;  1K5Q A;  1JJ2 U;  1T5E A;  1J5E O;  4R6Z A;  4R50 A;  4LWS A;  1QU7 A;  4YXW G;  3JYC A;  4PD4 F;  4GKJ O;  1UJW B;  1OHH G;  1VQK V;  1P4R A;  3K03 A;  2ZDI A;  2Q67 A;  4ZOL B;  1ZLZ A;  4PDM A;  1K4C C;  1EFR G;  3VOU A;  5CA1 A;  5IJ0 B;  1FAF A;  2BOB C;  1N34 B;  4YJ2 B;  1RSO B;  3AK3 A;  5LMN O;  1Y74 A;  1R6N A;  3W7U A;  4DV1 O;  2ZM6 O;  1JCH A;  5KAF Z;  1ROP A;  1KKC A;  2NN4 A;  5KMG A;  4NXM O;  3B8M A;  4KFM A;  4ZKI A;  1JVM A;  2W6I G;  2HKO A;  4UCU A;  1GMG A;  1W0J G;  3K79 A;  2D3O W;  4RUF A;  1KEC A;  4L8J A;  4UCV A;  1NTK H;  4DK0 A;  2Q73 A;  3BRC A;  2QEX V;  4O4L A;  5LOV A;  4TV8 B;  4PA7 A;  5ITZ B;  4BIZ A;  3ASN C;  3OR7 C;  3EVK A;  2QM7 A;  3ABK C;  4LF7 O;  1SET A;  4WCE V;  3E89 A;  3TET A;  2EZO A;  2HG5 C;  4PA9 A;  1FJG B;  1AI4 A;  4X1K A;  2WLJ A;  4R8C A;  1AI6 A;  3AG2 C;  4NXN O;  1TUB A;  3SJB C;  3FB7 C;  4I50 A;  4DR5 O;  2Z5U A;  3G6E V;  1YXB A;  3DXR B;  3R65 A;  3CP1 A;  1WA8 A;  4CC6 A;  4JZ2 A;  5IWA B;  4QE7 A;  2ZXW B;  3WB0 A;  4WFG A;  1XNQ B;  4LFB O;  2CTQ A;  4I9Q A;  1V9P A;  5KAI Z;  1F7Y A;  4ASU G;  2W0F C;  2AZ0 A;  5IYC O;  2EJ7 A;  4FM0 A;  5B1N A;  1VQM V;  3CCU V;  1SQV H;  1P84 F;  2XAG A;  1BGY H;  4JV5 O;  3T1H O;  3JD0 A;  1BT8 A;  1SA0 A;  1IXM A;  1KU9 A;  4AQY O;  2F4V O;  1NBM G;  2N04 A;  4PDV A;  3M7M X;  3B77 A;  2OWO A;  4B7E A;  3RT3 C;  1QVG U;  2HEP A;  4GLX A;  1NJI W;  2JS5 A;  2QKA A;  3JSL A;  1JPX A;  3J7A U;  1CPY A;  2NNU A;  5GON A;  2WAM A;  1YZB A;  3L74 H;  1M90 W;  1CXZ B;  4GZR B;  3CHX A;  4DR7 B;  1KB9 F;  1SC5 B;  3FKS G;  4U3J B;  3FD9 A;  4JYB A;  1E1R G;  2BOC C;  4I55 A;  1XRE A;  1AI5 A;  1V54 B;  2XAJ A;  5KHH A;  1R6T A;  4K0K B;  2ODM A;  5TIS Z;  4JI6 O;  2QR4 A;  3SPG A;  4L87 A;  3LUT B;  5L3F A;  2F23 A;  3A2F A;  5IYB O;  2VS0 A;  5B1A B;  2LJ2 A;  1TVK A;  1DK1 A;  4DV0 B;  4I9W A;  3UCS C;  1XNR B;  3HKE A;  4U7O A;  1YI2 V;  4ICG A;  3M8A A;  1QHT A;  2Q69 A;  3ETE A;  4LF4 O;  2QM8 A;  4G2K A;  3CC4 V;  1HNZ B;  1FS0 G;  4YY3 B;  5KHJ A;  2CAZ C;  1M93 A;  2Q5Z A;  3K08 A;  4JTD B;  3JAW B;  2PY5 A;  2UXB B;  2X6A A;  3OGI B;  3HKB B;  3NR7 A;  2IW5 A;  2YEV A;  4J7J A;  4X64 O;  4TOI A;  5H2F Z;  1URF A;  1K4D C;  1IVS A;  4DV3 O;  4DV7 B;  1KYO F;  3OUS A;  5JCO C;  3CPW U;  1K8A W;  1EZJ A;  5B1B C;  3FAV B;  3CB2 A;  1M56 B;  2N05 A;  4DRX A;  1JFF A;  1D5N A;  1GH6 A;  2M6Y A;  5FNV A;  3X2Q B;  2UUA B;  1ARO P;  2Y69 B;  2IU0 A;  3P32 A;  3RVZ A;  2WLM A;  4X8A A;  5JJJ B;  1SKV A;  4PEL A;  4J9Z B;  2EIJ C;  4LF8 O;  4OX9 O;  2NLJ C;  2ILM A;  3RYH A;  1LR1 A;  4NYK A;  5LP6 B;  2ZR2 A;  4FFK A;  2LFS A;  3JD4 A;  2DE0 X;  3OD4 A;  2EUL A;  4LF5 O;  1NKD A;  4LF9 O;  3AEI A;  5KA6 A;  2JRI A;  3ZRX A;  2YXY A;  4YJ3 A;  1WJZ A;  2UXD B;  1HWY A;  1NVP D;  4FM2 A;  1B04 A;  3WB2 A;  5JQG A;  1LNQ A;  3UT5 A;  2Q9L A;  4KUM A;  2WSS G;  3ZMZ A;  2W6J G;  4QIW F;  2YIC A;  4J9Y B;  2UUB B;  3ZMV A;  2KG7 A;  1RPO A;  5CA0 B;  3BA9 A;  4J7K A;  3RBZ A;  4UXN A;  2CE4 A;  3S3W A;  2DQ3 A;  1N33 B;  4A5U B;  3C3S A;  1US6 A;  4D6T H;  1NQT A;  3ZMT A;  3J80 N;  1KC8 W;  5C8Y B;  4JI1 O;  3LSS A;  4CH5 A;  3RVY A;  4JI8 B;  4GKK O;  1IBL O;  3ZRW A;  3WG7 B;  2IM9 A;  4JAU A;  3CCS V;  5H6R A;  2UUC O;  3SPI A;  4B3S B;  1NTZ H;  2OCC C;  4LFC O;  1K3E A;  3OGC C;  3T1Y O;  2R72 A;  4TUY B;  1NR7 A;  2KB1 A;  1HR0 O;  3IAY A;  3E22 A;  3VBB A;  3UO3 A;  2YS8 A;  2EIM B;  2H8P C;  4DV6 B;  3A8T A;  3BY6 A;  4U7N A;  2RJZ A;  3Q4H B;  1S5H C;  3CXC U;  5JJN B;  4F6E A;  5CB4 A;  3FFQ A;  5DED A;  4LF6 O;  5GTI Z;  2F43 G;  4RQE A;  4JI0 B;  3D36 C;  3CYO A;  1X4T A;  3WFV A;  1WPX A;  4IIJ A;  2P7T C;  4JAS A;  4MSW C;  3E83 A;  4BWA A;  1JMK C;  4WFE A;  1GN3 A;  2LP7 A;  1VIB A;  4TV9 B;  2DYS B;  1UFI A;  3AG1 C;  1WP8 A;  1VQ5 V;  2EIN B;  3ZN1 A;  4X1Y A;  5CN0 A;  1HNX O;  2JS3 A;  3K5L A;  5CA3 A;  4UCR A;  3BPZ A;  5L3B A;  2E75 B;  3CSX A;  3H9V A;  1P7B A;  2AXT Z;  2EX3 A;  4DR2 O;  2CGO A;  2BTQ B;  2GTA A;  3K04 A;  1QR8 A;  1WP7 A;  3CS5 A;  2EIK C;  1OCR B;  3K0D A;  4NTX A;  3W7X A;  1XQ8 A;  1ZTE A;  3ML0 A;  4B3R O;  1A32 A;  3FYI B;  3SJC C;  2WLL B;  1VQ6 V;  4H44 B;  2UXX A;  3UO2 A;  5EK0 A;  3CWB H;  2JEX A;  4FK5 C;  3MD0 A;  1Y76 A;  4DO2 A;  3LDD A;  2DYR B;  1Q6U A;  2BSK B;  1KD1 W;  3CRQ A;  4QPJ A;  4CBC A;  3A0R A;  4W4K A;  4ZHQ B;  4J7Z A;  1JR9 A;  2F66 C;  3HPL C; 
#chains in the Genus database with same CATH homology
 4R50 A;  5EBL C;  3OMA B;  4YXW G;  3JYC A;  3G71 V;  2HLD G;  4GX5 A;  2ITC C;  3E8F A;  1BHA A;  1UJW B;  3CCJ V;  1Q81 W;  1VQ4 V;  1OHH G;  1VQK V;  4N21 A;  1P4R A;  2YSU B;  3OM3 B;  2ITD C;  1S3J A;  3K03 A;  3T4D A;  2IH1 C;  1VQL V;  2ZDI A;  3OR6 C;  2Q67 A;  4PDM A;  1K4C C;  1EFR G;  3AG3 B;  3VOU A;  1GM9 A;  2P90 A;  2BOB C;  2X6B A;  3WG7 C;  5DN6 G;  5HFM A;  3ZRS A;  4MVZ A;  1R6N A;  3LNM B;  3W7U A;  5B3S C;  2V1D A;  5B3S B;  1JCH A;  4P30 A;  5H9C A;  1K34 A;  3EFF K;  4HYO A;  1ROP A;  3GB7 C;  3CCM V;  4WFB V;  4LC1 A;  3B8M A;  1SES A;  3QO5 A;  3W7T A;  2JDI G;  4KFM A;  5E1A C;  4ZKI A;  1JVM A;  1FXV A;  3KG2 A;  2W6I G;  2WPD G;  1W2B U;  2HKO A;  1K9M W;  2EIM C;  1GMG A;  2Y48 A;  3E86 A;  1W0J G;  3K79 A;  2D3O W;  4RUF A;  2JJ2 G;  4E2L A;  1GK9 A;  4MW8 A;  4QNH B;  1L1F A;  3JD2 A;  1KEC A;  3ABM C;  5L3G A;  2QEX V;  2IJJ A;  4MVU A;  3ZRV A;  5C93 A;  3FB8 C;  4UVC A;  4PA7 A;  4PA3 A;  4BIZ A;  3ZMS A;  3ASN C;  3OR7 C;  3UM7 A;  2QM7 A;  3CC2 V;  1AJQ A;  4MW3 A;  3SYP A;  2ATK C;  1PNK A;  1PNL A;  1SET A;  3ABK C;  4WCE V;  3E89 A;  3TET A;  1MAB G;  2EZO A;  2HG5 C;  4PA9 A;  1W0K G;  3FB5 C;  3F7Y C;  1AI4 A;  2WLJ A;  4R8C A;  1YIT V;  2HFE C;  3OAA G;  3FYE B;  1AI6 A;  3JD1 A;  1B6Q A;  4JTA B;  4GX2 A;  3AG2 C;  2M7W A;  3AG2 B;  1VQ9 V;  3FB7 C;  4QE9 A;  1JOY A;  2EIN C;  2AHY A;  2DWD C;  2Z5U A;  5IDJ A;  3G6E V;  4JPR A;  5KA5 A;  2XAS A;  2PI4 A;  1DF5 A;  1OCO B;  4MS2 A;  1H8E G;  3R65 A;  4P9P A;  3SJQ C;  3CP1 A;  4WFH A;  2HR3 A;  2IJK A;  4QE7 A;  4MTG A;  2ZXW C;  2HVJ C;  2JJ1 G;  2ZXW B;  2JK5 C;  2EIL B;  4WFG A;  4DXW A;  2LFR A;  1KKD A;  4UV9 A;  3K0G A;  1TUE B;  2Q68 A;  5EBW C;  4N23 A;  4ASU G;  1GM7 A;  2JEU A;  2W0F C;  5IYC O;  3CMA V;  4MVM A;  1Q82 W;  1CEZ A;  5B1N A;  4P9O A;  1VQM V;  3CCU V;  3B8N A;  2OTJ V;  1QBZ A;  1VQO V;  4WF9 V;  2A9H A;  2XAG A;  2P67 A;  3QO7 A;  2EIJ B;  3JCZ A;  5L3C A;  1FXH A;  1MSW D;  3EHB B;  4HAM A;  3JD0 A;  1IXM A;  3I56 V;  1XL6 A;  3ETG A;  3H01 A;  4RUE A;  3CD6 V;  4XDL A;  1NBM G;  3ZN0 A;  1QLE B;  4PDV A;  1JX9 A;  3LSQ A;  3B77 A;  4CZZ A;  3UKM A;  1QVG U;  2ZDI C;  3F7V C;  2HJF C;  5LHG A;  1NJI W;  1K97 A;  2CK3 G;  3G4S V;  1R3K C;  4G27 B;  1K5S A;  1JPX A;  4PDR A;  3RW0 A;  2Z3Y A;  1CPY A;  3ETD A;  2NNU A;  4LCU C;  4HZ3 A;  2WAM A;  1M90 W;  1GTO A;  3SYC A;  4H37 A;  1BMF G;  3CME V;  3GWO A;  3AG3 C;  3ABU A;  3K3W A;  3FKS G;  1M1K W;  2ZR3 A;  4JYB A;  5CBH A;  4BIU A;  2DQ0 A;  1E1R G;  2BOC C;  5LHH A;  5CBF A;  2Q6A A;  5LGT A;  5H6Q A;  1AI5 A;  1V54 B;  4FPP A;  1KQS U;  2XAJ A;  4MT8 A;  5BZB A;  4MVR A;  4MTO A;  3E2E A;  3SYQ A;  2MK3 A;  1J95 A;  2FTK A;  4WFA V;  3SPG A;  2P6J A;  4L87 A;  3LUT B;  1G4Y B;  3ZCC A;  5L3F A;  2OTL V;  1H8H G;  3DGE A;  5KUK A;  4LBE C;  5IYB O;  1NH2 D;  5B1A B;  4GT1 A;  1SER A;  1VQN V;  4I9W A;  1FXK C;  1FXK B;  4OXS A;  5LGN A;  4U7O A;  1YI2 V;  1NH2 B;  2OCC B;  2Q69 A;  3ETE A;  3OMN B;  4UVB A;  5EC2 C;  2QM8 A;  4GCZ A;  2JIZ G;  4G2K A;  1S72 V;  3CC4 V;  3QNE A;  3ZJZ A;  4BAY A;  1FS0 G;  2YEV B;  2R9I A;  3E8G A;  3D3I A;  4XDJ A;  4FIP C;  3LDE A;  1YTF D;  1FXK A;  5B1O A;  2GSM B;  3K08 A;  2B5U A;  4G28 B;  4JTD B;  4H33 A;  3ASO B;  4MTF A;  4X89 A;  3P30 A;  2WLI B;  5L3D A;  1OZ0 A;  4P2Z A;  1YTF B;  1S76 D;  3IGA C;  1BL8 A;  2X6A A;  1AJN A;  2GHY A;  1Y4M A;  4TT3 G;  4JTC B;  2IW5 A;  1SZT A;  2YEV A;  4KP4 A;  3ZIA G;  5KUM A;  1R3I C;  1K4D C;  1OCO C;  4QPK A;  1R3J C;  1N8R W;  2IJI A;  3OUS A;  3CCV V;  2WLI A;  3CPW U;  1R6K A;  1K8A W;  1EZJ A;  5B1B C;  5B1B B;  5CMU A;  2EIL C;  1AI7 A;  4JAV A;  1M56 C;  1GKF A;  1M56 B;  1K92 A;  2B1I A;  2IH3 C;  3BEH A;  2X7R B;  1CP9 A;  2XOK G;  3D36 A;  3AG1 B;  4MTX A;  2A0L A;  3X2Q B;  4RAI A;  1ARO P;  3MHH C;  1VQ7 V;  2Y69 B;  1K33 A;  4FJC C;  2IU0 A;  1QVF U;  3P32 A;  3RVZ A;  2WLM A;  5IY5 B;  4X8A A;  2V7Q G;  3M99 B;  4PEL A;  4J9Z B;  2EIJ C;  1S77 D;  1XL4 A;  2NLJ C;  1V55 B;  3ABL B;  1PNM A;  2ZR2 A;  2LFS A;  1Y66 A;  3JD4 A;  1RM1 B;  3OFN G;  4PA6 A;  2EIK B;  1QLE C;  2XAQ A;  5EBM C;  4I5S A;  5IYD O;  4UVA A;  1NKD A;  5HFL A;  1QLN A;  3AEI A;  3JD3 A;  5KA6 A;  3OMI B;  1R73 A;  3ZRX A;  1KP3 A;  3DTU B;  5L3E A;  1R3L C;  2X6C A;  1M57 B;  1HWY A;  1NVP D;  1OCC C;  1OCC B;  3MHS C;  2QKS A;  3F5W C;  1WLE A;  1QCE A;  4BW5 A;  1OCZ B;  1LNQ A;  5FL7 G;  4UUJ C;  3STZ C;  4MVS A;  3NXS A;  1NVP B;  4KUM A;  2WSS G;  4WFF A;  1F4M A;  5DM6 V;  5CBG A;  1GO3 F;  3ZMZ A;  2W6J G;  4QIW F;  1KP2 A;  3E8B A;  1THZ A;  3LDC A;  3CCL V;  3W7W A;  3CCE V;  2WWW A;  4J9Y B;  3ZMV A;  1RPO A;  3ZRW B;  3T1C A;  1V54 C;  3RBZ A;  4UXN A;  2EJR A;  4MVO A;  2DQ3 A;  1F4N A;  2B1G A;  2K1E A;  1NQT A;  3ZMT A;  1KC8 W;  2HVK C;  3LSS A;  3OEE G;  1I5Y A;  3RVY A;  2A79 B;  1H38 A;  5B1A C;  5GW7 A;  3SPJ A;  3ZRW A;  1BHB A;  5J9P C;  1AJP A;  4GX0 A;  2IJH A;  3WG7 B;  1YHQ V;  4JAU A;  3CCS V;  5H6R A;  3ZMU A;  3SPI A;  2R9R B;  2AHZ A;  4F4L A;  2X0L A;  2OCC C;  4LP8 A;  1K3E A;  3OGC C;  3TCU A;  1EBO A;  2H94 A;  3T2M A;  1NR1 A;  3E35 A;  1YJ9 V;  1NR7 A;  2KB1 A;  1F51 A;  1YJN V;  2PI5 A;  5LBQ A;  1JQ0 A;  1COW G;  1PL0 A;  1Q7Y W;  5LHI A;  1E1Q G;  3VBB A;  3SYA A;  4ZBM A;  1FFT B;  2EIM B;  2H8P C;  3ASO C;  2WLH A;  1Q86 W;  4TSF G;  3BY6 A;  4U7N A;  2OT5 A;  2QTO A;  4QJF B;  1S5H C;  3CXC U;  2DW4 A;  4JGS A;  1MOF A;  1AR1 B;  3ABM B;  2F43 G;  4XBF A;  1I5X A;  3HB3 B;  4RQE A;  3PJS K;  3CYO A;  2XAF A;  4JF3 A;  4RO2 A;  3WFV A;  3CCQ V;  3ASN B;  1RPR A;  4X88 A;  1WPX A;  1MG1 A;  2DWE C;  1G8M A;  2P7T C;  1S0V A;  1PKX A;  3ABK B;  1YIJ V;  1H2G A;  4JAS A;  4FMT A;  3OEH G;  4MSW C;  3E83 A;  3STL C;  4WFE A;  2LP7 A;  1ORQ C;  3SPH A;  5LGU A;  4PDL A;  2DYS C;  1YJW V;  3SYO A;  2DYS B;  1GM8 A;  2ZD9 A;  4EKW A;  1YSC A;  4R7C A;  3OW2 U;  3I55 V;  3AG1 C;  1VQ5 V;  1ENV A;  2EIN B;  3ZN1 A;  3X2Q C;  2QE7 G;  1DF4 A;  4Q20 A;  5CN0 A;  1VQP V;  2Y69 C;  1DTO A;  3AG4 C;  3AG4 B;  5CA3 A;  5IY5 C;  4XDK A;  3ABT A;  3TK1 A;  3CC7 V;  5L3B A;  2IU3 A;  4RQF A;  1P7B A;  3OE7 G;  3IFX A;  3T4Z A;  3OUF A;  1V55 C;  3ABL C;  3QO8 A;  2XAH A;  1SRY A;  3K04 A;  1QR8 A;  2C2A A;  4GX1 A;  1RM1 C;  1OCR C;  2EIK C;  1OCR B;  3K0D A;  3W7X A;  1K73 W;  5EC1 C;  1QR9 A;  3FB6 C;  1PD3 A;  3IC7 A;  2WLK A;  3ML0 A;  3K06 A;  4JYC A;  3FYI B;  2WLL B;  1F23 A;  1ZWI C;  2QA4 V;  1VQ6 V;  1M9N A;  1M57 C;  2UXX A;  3K9A A;  2XND G;  3W7S A;  5EK0 A;  3SPC A;  2JEX A;  1K7D A;  4FK5 C;  4TWK A;  2EBO A;  1DLB A;  3MD0 A;  4UV8 A;  1OCZ C;  4DO2 A;  2DYR C;  2UXN A;  3LDD A;  2DYR B;  1E79 G;  4Z1M G;  2ZQM A;  4MVQ A;  1KD1 W;  1VQ8 V;  4PA4 A;  3E8H A;  2WLL A;  2EZP A;  2WLN A;  4QPJ A;  3CCR V;  4CBC A;  3A0R A;  1K5Q A;  1JJ2 U;  4R6Z A;  3HPL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...