1KD1W

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1kd1W00
4WCEV 3CCQV 2QA4V 1VQMV 1YHQV 5DM6V 1VQOV 1Q86W 3G71V 1KC8W 1VQ4V 2OTLV 2OTJV 3G6EV 1YITV 3CMEV 3CD6V 1VQ9V 3CCLV 3I56V 2D3OW 1VQ5V 1VQ8V 2QEXV 1YI2V 1K73W 1N8RW 4WFBV 3I55V 1KQSU 1VQPV 1Q7YW 1VQ7V 3CCRV 4WFAV 1YJ9V 1W2BU 1M1KW 1M90W 1QVFU 3G4SV 3CPWU 3CCJV 1Q81W 1R73A 1YIJV 1YJWV 1VQLV 1K8AW 1QVGU 3OW2U 1Q82W 1YJNV 1KD1W 3CCMV 4WF9V 1NJIW 1S72V 3CCSV 3CC7V 1K9MW 1JJ2U 1VQKV 3CCEV 3CMAV 3CC2V 3CCUV 3CC4V 1VQNV 3CCVV 3CXCU 1VQ6V
chains in the Genus database with same CATH superfamily
4BW5A 2P90A 4FZ0A 4LNUA 4K0KO 2MK3A 3BY6A 2A9HA 2EIMB 1UFIA 1N8RW 1OJHA 3QVNA 1Z5VA 4X66B 2HJFC 5L3CA 1VQPV 1NTKH 1Y66A 4DXWA 1Z2GA 1B6QA 1SC5B 4OPAA 3H1HH 4DV0B 4JGSA 4H0LB 3T1YO 1RPRA 4JYCA 4UCTA 3K5MA 3STLC 4JV5O 1ZLZA 2GUZB 4U3JB 1AR5A 1X4TA 3RYIB 1F4NA 4PDMA 4GCZA 4X8AA 5J2UA 1IXMA 5F2VO 1VQ7V 2JJ1G 3E22A 4ZKIA 1BQZA 4UVAA 2HG5C 2JRIA 1R3KC 4B7EA 4PI0A 3K04A 2RMKB 3BHPA 2CGNA 4MVZA 1S0VA 2ZNIA 5CBGA 5GONB 4JI2B 5CA3A 2CTRA 2EINC 2QKCA 3CHXA 4DR5O 3UT5A 1YHQV 1IX9A 3IC7A 3HKEB 2GTAA 1CEZA 1GRJA 4FVMA 3QO7A 2DQ0A 1R6KA 3D3QA 2LW1A 5LA6A 2WLHA 4UVCA 3RYCB 1R73A 4H33A 4FZ1A 2B1GA 3H9VA 3WG7C 3K79A 3T1HB 5LXTB 3HKBB 2EX3A 1YEWA 5IY5B 4RAIA 2W6JG 3OMAB 5GW7A 2ZD9A 5LYJB 4DR6O 1VQ5V 2LP7A 1EN6A 4J9YB 1T5EA 1K92A 2CDYA 4DV0O 2Q7GA 1J5EB 1CXZB 4LF9B 4BWAA 4B3RO 5D5QA 4JI1B 3ZX6A 3AG2C 1WJZA 5JCOC 4O4IB 5L3EA 1IVSA 3FYEB 4X20A 1M57C 3LNMB 4PDVA 5J2TA 3E86A 2EIJB 2AHYA 2FTKA 1N36O 1HNXO 2VQFB 4FK5C 1IBKO 3N2GB 4DUYO 3CX5F 1PNMA 5C8YB 3J7AU 2XT9A 3JD2A 4U3JA 3SJBC 2CTWA 2QM7A 1YITV 2ZDIC 3PN1A 3AG3C 1I08A 4J10A 4QJFB 3ZRVA 1QLNA 3ZMUA 2Q6AA 1THZA 5E1AC 2Q7HA 1KD1W 1YJNV 3RBZA 1VF6C 2UU9O 2HP8A 2QWPB 4PA6A 3QO8A 3MHSC 1Q6HA 2L6LA 1NI8A 3JALA 3E35A 2WLMA 3SJQC 2LGWA 1OCRC 1ZL8A 4R50A 1AB3A 2JJ2G 4BAYA 5C8YA 1URFA 3RW0A 3UKMA 2LGQA 1QVGU 4MTOA 1GAXA 4GKKB 3OGCC 4KP4A 3APQA 5IWAB 1GM8A 1JVMA 1S5HC 3H1JH 2QWOB 4MTXA 1CP9A 1WLEA 4UCRA 2Y69C 1XILA 2PUSA 4X20B 2BTQB 5LMNB 1AP6A 1K9MW 1XBLA 4XDKA 3JALB 4LF8B 4TQFA 4DW1A 4WFHA 4CBCA 2Y48A 1OCCB 3CMEV 5D5PA 4X65O 3WB1A 4X1KB 3JARA 1MABG 1F51A 1PL4A 4GYCB 4LF9O 2YC0A 1KYOF 1HNWB 4DR3O 1YDXA 4WF9V 4DO2A 5IJ0B 2UUAO 5LA6B 2A7WA 3HKCB 5JQGB 4PJ0Z 1QLEC 3LDCA 1P49A 1S77D 1H2MA 3X2QB 4H44B 1K4CC 1M5IA 4GX2A 4MTFA 4GX1A 1Q6IA 5JH7B 2UXXA 4QPJA 1DF4A 1Y74B 4J7ZA 1Q7YW 1M56B 1AI4A 1R1BA 1E1QG 1M57B 4X65B 4JI6O 4JI5B 4DV7B 1WPXA 1JQ0A 2ZKOA 1XNQO 4DV6O 3KKYA 4UCOA 5IE9A 1N0JA 4NB5A 2F43G 3L72H 2DYSC 4X89A 3QTCA 5LMNO 1SRYA 2UUAB 3THOA 3FB6C 1YJ9V 3HKCA 2EIMC 2DMXA 3A2FA 4TV9A 1Y67A 4FLVA 5LYJA 2VQEB 1Q6UA 3BFRA 5FL7G 1KBHA 5JWPA 4FFBB 4KUMA 2YI8A 1U96A 1ORQC 1XOUA 5KX5B 1I0HA 3B4SA 4FPPA 4DR2O 2G38A 4BW9A 4WFAV 1K3EA 3MHHC 5KHHA 4QIWF 2Q8VA 4IIJB 4ZHQB 3A0RA 4JZGA 2Q7EA 4AI8A 4TV8A 3JARB 2DN9A 3GWOA 1LR1A 2RN9A 1IBKB 2ZT9B 5CBFA 1BGYH 1QHTA 4ZIBA 4O4HB 1YJWV 2YIDA 4LR3A 5B1BC 1BSMA 4MVOA 2ZNJA 2WLNA 4NVPA 1QR8A 2ZR3A 2YUAA 1VQMV 1M4UA 3GWKC 1VQOV 1S5JA 4JI1O 3SPCA 4K35A 2DW4A 3AEIA 1KU9A 4FM0A 1NVPD 4PD4F 2OCCC 1AI7A 1H2NA 1FXHA 3CS5A 3K9SA 4HBNA 1EFRG 3M7MX 2ZIMA 3HPLC 4ZOLA 3H01A 5B66Z 4FM1A 2R9RB 4CH6A 4UB8Z 5KUKA 3JAWB 4I5SA 3OAAG 3F5TA 3D36C 4UFZA 5IY5C 5LGUA 2CUGA 4ICGA 2RJZA 5A2QN 4UV8A 1Z5WA 1F4MA 1M1KW 4WFGA 5JJEB 5C93A 1SQBH 2XOKG 1SERA 3B09A 1A32A 4X1IA 1HR0O 3K5OA 1WN7A 3FAVB 1ROPA 4CS3A 4X66O 1V54B 4LWSA 4IHJA 3KCYA 3OUFA 3IFXA 2Z3YA 4K0KB 1QU7A 2WA3A 4PA4A 3EVKA 4TUYB 1G1XB 3ZRWB 3ZHVA 4FM2A 1QBZA 1HDJA 4JYYA 5KMGA 2IH3C 1ZAUA 3D8CA 1GN3A 3JSNA 2O57A 4I4TB 4OX9B 5LHHA 3HR0A 1KB9F 4ABMA 2XASA 2HHHB 3EHBB 4G2KA 4YY3B 3LDEA 4ZOLB 5KX5A 2OCHA 4JI8O 4DR2B 4GUNA 1PM9A 4U7OA 2D2CB 3HKBA 1BHAA 3S3XA 4YHHO 1FKAO 4RQEA 2CTQA 4K8ZA 5K1XA 1Y76B 3RYCA 1NR1A 5JJJB 4FJCC 4D7TA 5J2TB 2YICA 3G6EV 1Y6XA 3CD6V 4GKJB 4JYAB 4ASUG 1YVWA 1AP5A 4P2ZA 3K03A 3C3TA 3W7XA 3P32A 3CPWU 2B5UA 4IYIA 2QTOA 3OEEG 3JSLA 4DRXB 4LF6O 4GZRB 3T1YB 4LF5B 3OUSA 4ZI7A 3RGBA 3ZHTA 2K1EA 5BR8B 4I50A 5EBMC 1RFYA 4IIJA 2JVDA 3CB2A 5FLXN 1NBMG 4JI4B 3OR7C 2A3QA 4NYKA 3DC6A 5IYZA 4P9OA 5CA1A 1Q90D 2A06H 5H6RA 3T2MA 5LXTA 1YCIA 4MS2A 2E76B 3W7UA 3SPJA 3U10A 2VQEO 1NT2B 3K58A 2CE4A 1FYJA 3OM3B 2EINB 1OCZC 1I94O 4Z1VA 3U11A 4HZ3A 5B1AB 2NLJC 3BVOA 5LMUB 1D5AA 4DV5O 3CCVV 1Q86W 5KLVH 4IGGA 1BHBA 1XL6A 4NXMB 2WSSG 3ABKB 4IYHA 4CZZA 2BOCC 3N2KB 2IJHA 2XAHA 1WP8A 3WG7B 2EIKC 3G4SV 4KFMA 3JD1A 3K59A 3BEHA 3L9DA 2PYJA 3CRQA 1AI5A 4EB6A 3RYIA 5LOVB 2CGOA 1NQTA 3TGUH 3RYHA 2P5OA 1L0LH 3I56V 3UQ8A 3RT3C 2P6JA 3DSQA 3OMIB 4E2LA 1QNMA 1RP3B 3ZMTA 3L75H 1FJGB 1IZ3A 4XDLA 4EFEA 1DK1A 3LUTB 4B7KA 2YIAA 2Q0AA 3X2QC 2KKWA 1MNGA 3L73H 4UXNA 3ZHSA 3ZMSA 4I4TA 2N04A 5GTHZ 1SA0B 5EYPA 3RN4A 2YDEA 4NTXA 5LGTA 5KMGB 2DQ3A 3T4ZA 3K5LA 3KZIZ 3SYCA 4DV1O 4AILC 5B3SB 3ZMVA 2EZOA 1Q5OA 3RFRA 1NJIW 3CCSV 1YTFD 5A9GA 2A79B 3ASOC 1L1FA 3R66A 1VARA 2EJRA 3SPGA 3CCLV 1VQ8V 4TT3G 2QR4A 5H5NA 1S5LZ 1JR9A 2AZ0A 3VQYA 1IBMB 1NTMH 1NS1A 2DWDC 4DV1B 1YIJV 1R6NA 4R6ZA 1SZTA 4TQDA 4MW8A 3ABTA 4HNAA 3ZBHA 5FNVA 1PNKA 4DR1O 1WP7A 1HR0B 2GV9A 2GTSA 2JDIG 2V4DA 1EZVH 1JA8A 1K5SA 2W0FC 3ZHQA 5CA1B 1UPGA 1LUWA 2XUMA 1JFFB 4X88A 4LF8O 1D2DA 1GN4A 2Q0OC 3G80A 4P9PA 3STZC 3CYOA 1H8HG 4I50B 4KHPB 4L87A 1Q8IA 2IM9A 3OTFA 2AGAA 1AVMA 5CB4A 3P3PA 4CH4A 2P7TC 5BY1A 3BCCH 4LFAB 3E8HA 2WLIB 4J7KA 4PV1B 3ZHUA 1H8EG 2F23A 5L3GA 1XMQB 5K1PA 1P7GA 3L70H 4DR5B 5H9CA 4YXWG 1US6A 3IGAC 2YXLA 1FFXA 3Q4HB 2WLKA 1QQCA 3ZMZA 2WPDG 3M99B 5B5EZ 4UCVA 3KCXA 3TETA 3DXRA 2EIKB 4JI8B 2QWRB 2F4VB 3E89A 4A5UB 5ITZB 2UUCO 1KUQA 3JYCA 4JZ2A 5BR8O 3CRRA 1O9HA 4DR4O 4HYOA 2Q73A 4DK0A 5H6QA 2QSAA 2QA4V 3SPHA 4AQYO 1PPJH 2DE0X 3MDSA 3J81N 5KHJA 1BMFG 3RYFA 1ENVA 2X6CA 1ZTEA 1M56C 2PY5A 3W7SA 4Z1MG 5IJ9A 3CRMA 2GHYA 3D36A 3DTUB 4PDRA 4B3SB 1LNQA 1K4DC 3ABLC 4I55B 3P30A 5IDJA 2OTLV 1HWYA 2CK3G 3UT5B 2NR5A 3OTOB 1RSOA 2KG7A 1RM1C 4JTDB 1PNLA 1W2BU 1M90W 1JPXA 1CPYA 5GONA 1I5XA 3ASOB 5CMUA 3QNEA 5KA5A 3EFFK 4JI0O 4DR7B 1B04A 4TUYA 5LP6A 4B3TB 4DV4B 4X1KA 1GM9A 2HVJC 2LFSA 4NR1A 4LCUC 2Y0IA 3JASA 3T1CA 1QR9A 1OCRB 2ZQMA 1V55B 1NH2B 3SGIA 2BTOA 2LJ2A 5FPRA 2B1IA 3CCQV 2P06A 3R65A 2GDSA 3JATA 1K97A 1GN2A 3GB7C 3SPIA 4LWSB 4JAVA 2AW9A 3AG7A 4U3FH 1NKDA 4MTGA 2IBZH 5LL6Y 1K8AW 1S76D 4HAMA 3O65A 1JX9A 3BA9A 3ZN1A 2EJ7A 4LNUB 4RQFA 1VQ6V 5EYPB 4DW0A 5LHIA 4CH5A 4JTAB 2UUBO 2QEXV 2VWKA 2JGUA 2R70A 3E2EA 4MSWC 2CH7A 3N27A 2ARHA 4TV8B 4B3RB 2PYLA 2IJIA 1P4RA 5KAIZ 1N4CA 3JD4A 3BRCA 4I0XB 2HJDA 3JAMN 2F1MA 4BIUA 1FXVA 2QGNA 1XQ8A 1XEQA 4FIPC 4AHCA 5GTIZ 1N33B 2OTJV 2WWWA 2IU0A 4KHPO 3M8AA 5LBQA 1OCZB 1BE3H 4WFBV 4QGPA 2QKSA 3LSSA 1BL8A 4JTCB 2KSDA 3EXAA 2C2AA 4GX0A 2FKXA 2ITDC 4DR3B 4DUYB 3CCMV 4TV9B 5CBHA 1JMKC 4LFBO 1AILA 3UO2A 2P4KA 4WBNA 1PD3A 4DK1A 4Z2WA 2ITCC 2Q4PA 1AJNA 5B1NA 1FXKB 2QM4A 1GM7A 2BSKA 1Q43A 4NTYA 1H2LA 1MMMA 2AXTZ 3ABLB 2WLLB 4Q6GA 1FS0G 2HLDG 2CAZC 4X9QA 2KB1A 3FB8C 1SQQH 3DXRB 1OCOB 2CTPA 4ZI7B 1FXKA 3ZIAG 4JI7O 3TXQA 1XMOO 3CJHA 4PA3A 3MAQA 4JF3A 1B06A 1H2SB 3B8NA 3ETQA 3ZRXA 1E79G 1Y74A 5FPOA 5JJNB 4J7JA 3RYFB 4N21A 2JS5A 4X64O 2B9ZA 2QM8A 4MW3A 4C7UA 1HNWO 5EC2C 4EFBA 4LF7B 1BQ0A 4JI6B 1IBLB 3UM7A 4HNAB 4NKGB 1Q81W 3SJCC 3UO3A 1MOFA 1Q3EA 3FD9A 3DC5A 2F95B 4XDJA 1GTOA 3H1LH 2BTQA 1KKCA 2F4VO 5L3FA 4NXNO 2WA4A 1N34B 1JCHA 2OYQA 3BABA 4KXRA 4YJ2B 4G28B 3B40A 3VQWA 3IJ4A 3C90A 2K9PA 1ZX3A 1TGOA 3H1IH 2UXDO 1IBLO 1EN5A 1OHHG 1W0KG 2Y0PA 1W0JG 1WB7A 2XNDG 4WFFA 3WU2Z 3J80N 2YI9A 3AG4B 3CXHF 3AK1A 1YSCA 2RQ6A 3O9OA 4I9QA 3CCRV 4FLXA 4X62B 5BMVA 3SR2C 3P3NA 2V1DA 1H38A 4QNHB 1SF9A 1YZBA 3ZRSA 4OX9O 3VQXA 3AG1C 3AG4C 1VQ4V 4OPHA 1NR7A 2BE3A 3NR7A 1V54C 4IHJB 5LHGA 3IAYA 2ZDIA 3JCZA 4UVBA 1FJGO 4UB6Z 4J80A 2QTSA 3UCSC 5L3BA 4JYAO 1NU1H 1ZWIC 3FX7A 4MVSA 4PHZA 2VWJA 1ZL8B 5AG2A 1GO3F 1SA0A 4LFAO 2IJJA 4TSFG 2EBOA 1AJPA 2ILMA 3TXSA 2HKOA 1AI6A 1I7FA 3ZS8C 1ZUQA 2HVKC 5KA6A 2YS8A 1WAZA 3OGIB 3SYQA 1OCOC 5TISZ 2W0XA 1BT8A 2Q68A 4DV6B 2GSMB 1R3JC 3T4DA 4JV5B 4O4LB 1R3LC 1FFTB 4W4KA 4KL1A 5JVDB 2OIGA 1Y4MA 4LBEC 4ZBMA 4GKKO 3OR6C 4H37A 4DYLA 5E79Z 2M6YA 2E5LB 5EIBD 3S3WA 4B3MB 4FFBA 3BA8A 3OTOO 3QF7A 3N2GA 1FAFA 4O4HA 1M9NA 1SZXA 1QVFU 2ZXWB 5CA0B 2KG7B 2LW7A 1HW7A 2Y69B 1S72V 1AR1B 2WLIA 3CXCU 1EZJA 3ABMC 2ZE6A 2JGDA 3F5WC 5EBWC 2N74A 4X1YA 1KQSU 2X7RB 3SYAA 5LP6C 4F4LA 1F7YA 4F6RA 1OZ0A 5ITZA 1SQFA 1WB8A 1U97A 4LFBB 1KMIZ 1XDCA 2ATKC 2EILC 4DV3O 1HNZO 2OCCB 2P22C 4PA9A 4D6TH 5IT9N 3RWRD 1VF7A 1FFXB 2R9IA 1N0NA 2JEUA 3G67A 2E5LO 4QE7A 4X1YB 1VF5B 4JAUA 2X6BA 2ZE7A 1BZKA 3AG1B 2ODMA 1XI1A 4DV7O 4JI5O 4GKJO 2LQTA 3W7TA 2Q69A 3K5NA 4DR4B 3D3IA 2R72A 3FB5C 1MZFA 4I9WA 3ZRWA 2QE7G 1IDSA 1VQ9V 3A0BZ 3OD4A 1SQGA 4LP8A 4NXMO 2WLLA 3W7WA 4RWUA 1N34O 1FXKC 3FYIB 5EC1C 5KHIA 2UUBB 4CH3A 5CB4B 3FKSG 2DOSA 5J2UB 4DUZO 2BOBC 3JAKA 3K06A 2FMLA 5L3DA 4U7NA 1N33O 1I94B 5J9PC 2ZE5A 2EIJC 1TUEB 4JAAA 2OT5A 5FNVB 1XMOB 4LFCO 1K5QA 2EULA 4I0XA 4LF4O 2PZSA 1XHXA 3L74H 1TAEA 1PV0A 2ZIOA 2DYRC 1JJ2U 1JJOA 3SDLA 1S3JA 2H8PC 4IT5A 4FLUA 1MSWD 4QPKA 4BIOA 4K8XA 2NN4A 1P7BA 1WNSA 3AK2A 4YJ3B 1PP9H 2Y4TA 4XBFA 4R7CA 4PI2A 1NZ6A 1VMGA 1D5NA 4LF4B 1W59A 1H2KA 3JAKB 2BCCH 3PJSK 2Q9LA 5KAFZ 2HR3A 4BIZA 1VQKV 1IURA 4DR7O 2JEXA 1VP7A 2WAMA 4D7SA 1EM1A 3SJAC 4YJ2A 2AHZA 1NTZH 2MW2B 1XL4A 5EZYA 1YI2V 2H3OA 1K7DA 2IU3A 1XHZA 5KHKA 2IW5A 1X59A 4GT1A 3CEIA 2PGGA 2ADPA 5EBLC 4JI7B 2XAJA 1GN6A 1NVPB 3ASNB 3JAWA 1L0NH 3E8GA 3GVMA 2XAQA 1XNRB 2E74B 3ZCCA 2FB5A 2YEVB 4P30A 1OV9A 3CRCA 3VQVA 2Y4UA 3K3WA 2Q5ZA 5LP6B 3LSUA 3WB0A 1WPBA 3B8MA 3JCUZ 5BMVB 4O4IA 3HB3B 3H1KH 4QE9A 3HKDB 4JI4O 2EILB 3VOUA 1YXBA 2ZM6O 5IYZB 4MT8A 5IJ9B 2ZCEA 3CC7V 3LDDA 1OCCC 4JPRA 1DGSA 3CCUV 4FMTA 3RVYA 5KHGA 2VS0A 2JGDB 2VQFO 4PELA 1K73W 4O2AA 3DGEA 4RUEA 1K34A 4NXNB 1SKVA 4F6RB 5IYBO 2M7WA 2DJVA 2RDCA 4DV2O 4FLYA 2V7QG 4TWKA 5H2FZ 2JS3A 4WCEV 3K08A 4TOIA 5JH7A 2QWQB 4O2AB 2UU9B 3KG2A 1TUBA 4DRXA 4GLXA 2GBOA 4LF5O 1TVKA 3I5DA 5IJ0A 4DR1B 1QCEA 1BCCH 4JI0B 2EZPA 1G6UA 3E22B 4IL6Z 3T1HO 1B3QA 3CC4V 1MA1A 3A0HZ 4E4EA 3ETEA 2L35A 4O4JB 4OXSA 4PA7A 2AZ2A 1TA8A 2QKAA 1J5EO 1TVKB 2DYRB 4F6EA 1WA8A 2YXHA 3QO5A 1TUBB 1LUVA 1N36B 2W6IG 1MZEA 1M93A 5KUMA 3IC9A 3K0GA 2PI4A 4B3SO 3TCUA 2XAFA 1EBOA 3B2EE 2NNUA 2X6AA 4W4LA 2GUZA 2IJKA 3ZEDA 2OWOA 1R6TA 2DWEC 2ADQB 1SETA 1KECA 1YF2A 2FL4A 1XNQB 1K33A 5B3SC 3ICXA 4FLWA 2H94A 1XNRO 3OFNG 1DTOA 3WB2A 2UXCB 4YIPA 2UXBO 4LC1A 4RO2A 1V55C 1MSDA 5EZYB 1SESA 2X0LA 2ZM6B 1ZSPA 4O2BA 1SQPH 3OMNB 3CSXA 3HKDA 1VIBA 4J42A 3SYPA 1FPOA 4H13B 2PF4E 1KP3A 2KQXA 1XMQO 2YEVA 4FLZA 3CC2V 3NXSA 1GH6A 4YJ3A 1SQVH 3G71V 3JASB 3F7YC 4DR6B 5JCOA 1BS3A 1R3IC 3RYHB 2Q67A 4X64B 5LOVA 5BZBA 3FAVA 4JI2O 3TJTA 4G27B 2R9AA 2JK5C 3CMAV 3APOA 1F23A 4UV9A 5HFMA 3ABMB 3JATB 2QDOA 5LGNA 1HP8A 2WLJA 3ETDA 3ETGA 3ZJZA 3MD0A 1QLEB 4X1IB 2HEPA 3OT7A 1JOYA 1NH2D 4B3TO 1FD9A 2VRZA 5CN0A 3N2KA 1SS3A 5EK0A 4J11A 2Z0AA 3TK1A 4O2BB 1PL0A 4MVUA 5DEDA 2E75B 4CS2A 4K3AA 1VEWA 2D3OW 2UXDB 3CP1A 2UXCO 1EN4A 4EB6B 4O4JA 5HFLA 4BR6A 2JIZG 3OEHG 2XHBA 4DV4O 2A0LA 3AG3B 2UUCB 3OW2U 4LF7O 1GKFA 5IYCO 1UJWB 1IXBA 4J41A 3WFVA 4CC6A 1RSOB 1N32B 1XUQA 3CE2A 5DM6V 1J95A 4CS4A 4FLTA 2YXYA 3E83A 4FFKA 2F93B 5IWAO 2HFEC 1I5YA 4OGQB 3ZHRA 4B08A 3SYOA 1RPOA 3L71H 3CWBH 2ZR2A 2N05A 4DUZB 3RVZA 4B3MO 4I55A 2BSKB 1KKDA 1RM1B 1E1RG 2FYUH 1KP2A 2UXNA 4ZHQA 3I55V 5LMUO 4RUFA 3K9AA 1WA8B 4MVRA 1YTFB 3K0DA 2HHHO 4PDLA 1XREA 2F66C 1H2GA 1SQXH 1V9PA 3CCEV 1O9GA 1G4YB 3FFQA 4EKWA 5B1BB 4MVQA 1HNXB 5BXZA 1KC8W 5JVDA 4YHHB 2XTAA 5JQGA 3Q4HA 1L8DA 2ZXWC 4UCUA 4Q20A 2YIBA 3A8TA 1VF6A 4O4LA 1Y76A 1N32O 3VBBA 4WFEA 1IBMO 3CJHB 1VQLV 1AROP 2QJ1A 3ML0A 5DN6G 1Q82W 3LNNA 2UXBB 3HKEA 4GX5A 3LSQA 4LH7A 2XAGA 4UCSA 5EIBC 1DLBA 4WBNB 2YIBD 4CC5A 4JYBA 3JD0A 2ZINA 5CA0A 2YSUB 3AK3A 5B1AC 4R8CA 1COWG 1JFFA 1GMGA 2PTMA 4L8JA 3ASNC 2CH7B 3C3SA 4EEQA 1G8MA 2E3CA 5DECA 3E8FA 3K57A 3B77A 2P4VA 2RNBA 3ZN0A 1GK9A 2OIEA 4AQYB 1HNZB 3QG5A 2IH1C 3FB7C 2LO1A 4LFCB 4JI3B 2ZE8A 2DYSB 2ETNA 3CRAA 2LFRA 4X62O 3F7VC 5B1OA 2Z5UA 2PI5A 4JASA 3U0ZA 4DV5B 3AG2B 1AR4A 3ABKC 4NTWA 4UUJC 3JD3A 2RCVA 4YY3O 4LH6A 4J9ZB 1AJQA 3ABUA 1P84F 4JI3O 3OE7G 4DV3B 1PKXA 3E8BA 4MVMA 2P67A 1DF5A 3BPZA 4N23A 2QWNB 3CCJV 3G6BA 4LF6B 4I7ZB 5IYDO 4DV2B 3BAAA 4YIOA 1VQNV 1MG1A
chains in the Genus database with same CATH topology
3OUFA 5LHIA 4BW5A 2P90A 4JTAB 3IFXA 2Z3YA 2MK3A 3BY6A 2AHZA 2QEXV 1XL4A 2A9HA 4PA4A 2EIMB 1YI2V 1N8RW 3ZRWB 1K7DA 1QBZA 2HJFC 2IU3A 3E2EA 4MSWC 5L3CA 1VQPV 2IW5A 1Y66A 4GT1A 4DXWA 5EBLC 1B6QA 2IH3C 2IJIA 1P4RA 2XAJA 3JD4A 1NVPB 3ASNB 4JGSA 4BIUA 3E8GA 5LHHA 1FXVA 1RPRA 2XAQA 4FIPC 4JYCA 3STLC 2XASA 3ZCCA 2OTJV 3EHBB 4G2KA 2YEVB 2WWWA 3LDEA 4P30A 2IU0A 5LBQA 1F4NA 1OCZB 3K3WA 4WFBV 4PDMA 4GCZA 2QKSA 3B8MA 4X8AA 3HB3B 1IXMA 1BL8A 3LSSA 4JTCB 4U7OA 1VQ7V 1BHAA 2C2AA 4QE9A 4GX0A 2JJ1G 2EILB 3VOUA 4RQEA 4MT8A 2ITDC 3CCMV 4ZKIA 3CC7V 3LDDA 5CBHA 4UVAA 1OCCC 2HG5C 4JPRA 3CCUV 1NR1A 1R3KC 4FMTA 4FJCC 3RVYA 3K04A 1PD3A 3G6EV 3CD6V 2ITCC 4MVZA 1S0VA 1AJNA 5B1NA 4PELA 1K73W 1FXKB 3DGEA 1GM7A 5CBGA 4ASUG 4P2ZA 3K03A 4RUEA 1K34A 3W7XA 5CA3A 3P32A 3ABLB 2WLLB 5IYBO 3CPWU 2M7WA 2B5UA 1FS0G 2HLDG 2QTOA 2KB1A 3OEEG 3FB8C 2EINC 2V7QG 4TWKA 4WCEV 1OCOB 3OUSA 1YHQV 3K08A 3IC7A 1FXKA 3ZIAG 2K1EA 5EBMC 1CEZA 4PA3A 3KG2A 3QO7A 4JF3A 2DQ0A 1R6KA 1NBMG 2WLHA 4UVCA 3OR7C 1R73A 4H33A 3B8NA 2B1GA 3ZRXA 1QCEA 1E79G 4P9OA 2EZPA 3WG7C 3K79A 4N21A 3CC4V 5IY5B 3ETEA 5H6RA 3T2MA 2QM8A 4RAIA 4MW3A 2W6JG 3OMAB 5EC2C 4MS2A 5GW7A 2ZD9A 1VQ5V 3W7UA 4OXSA 2LP7A 4PA7A 3SPJA 4J9YB 3UM7A 1K92A 2DYRB 3OM3B 2EINB 1OCZC 3QO5A 2W6IG 1Q81W 5KUMA 3K0GA 3AG2C 1MOFA 4HZ3A 5B1AB 2PI4A 4XDJA 5L3EA 2NLJC 1GTOA 3TCUA 2XAFA 1EBOA 3FYEB 2NNUA 2X6AA 1M57C 5L3FA 3CCVV 2IJKA 1Q86W 1JCHA 3LNMB 2DWEC 4PDVA 1BHBA 1XL6A 1SETA 3E86A 2WSSG 3ABKB 1KECA 4G28B 4CZZA 2EIJB 1K33A 5B3SC 2BOCC 2AHYA 2H94A 2IJHA 2FTKA 2XAHA 3OFNG 3WG7B 2EIKC 3G4SV 4FK5C 1DTOA 4KFMA 3JD1A 3BEHA 4LC1A 1OHHG 4RO2A 1PNMA 1V55C 1W0KG 1W0JG 1AI5A 3JD2A 1SESA 2XNDG 4WFFA 1NQTA 2X0LA 2QM7A 1YITV 3I56V 2ZDIC 3AG4B 3AG3C 2P6JA 1YSCA 3OMIB 4QJFB 3ZRVA 3OMNB 4E2LA 1QLNA 3ZMTA 3ZMUA 2Q6AA 3SYPA 3CCRV 1THZA 5E1AC 4XDLA 2V1DA 1H38A 3LUTB 1KD1W 1KP3A 4QNHB 1YJNV 3RBZA 3ZRSA 2YEVA 3CC2V 3NXSA 3X2QC 3AG1C 3AG4C 4PA6A 4UXNA 3QO8A 3MHSC 1VQ4V 3G71V 1NR7A 3F7YC 3ZMSA 1V54C 3E35A 2WLMA 3SJQC 5LHGA 1OCRC 5LGTA 2ZDIA 4R50A 1R3IC 3JCZA 2JJ2G 4UVBA 4BAYA 2Q67A 2DQ3A 5BZBA 3T4ZA 3SYCA 3RW0A 3UKMA 5B3SB 3ZMVA 2EZOA 1QVGU 4MTOA 5L3BA 4G27B 1NJIW 3CCSV 3OGCC 2JK5C 1YTFD 1ZWIC 4MVSA 3CMAV 2A79B 4KP4A 3ASOC 1F23A 4UV9A 5HFMA 3ABMB 1GO3F 5LGNA 2WLJA 1L1FA 1GM8A 1JVMA 3SPGA 2EJRA 3ETDA 3ETGA 2IJJA 3CCLV 3ZJZA 1S5HC 1VQ8V 4TSFG 2EBOA 1AJPA 1QLEB 3MD0A 4TT3G 4MTXA 2HKOA 1JOYA 1CP9A 1AI6A 1WLEA 1NH2D 2Y69C 5KA6A 2HVKC 2DWDC 1YIJV 1R6NA 5CN0A 3SYQA 1OCOC 4R6ZA 1K9MW 1SZTA 4MW8A 4XDKA 5EK0A 2Q68A 3ABTA 3TK1A 2GSMB 4WFHA 1R3JC 3T4DA 1PL0A 1PNKA 2Y48A 4MVUA 4CBCA 1R3LC 1OCCB 1FFTB 3CMEV 2D3OW 3CP1A 5HFLA 2JDIG 2JIZG 1MABG 1F51A 3OEHG 1K5SA 2A0LA 2W0FC 3AG3B 1Y4MA 4LBEC 3OW2U 1GKFA 4ZBMA 5IYCO 1UJWB 4WF9V 3OR6C 4X88A 4DO2A 4H37A 3WFVA 4P9PA 1QLEC 3CYOA 1J95A 3LDCA 3STZC 5DM6V 1S77D 1H8HG 3E83A 3X2QB 4L87A 1K4CC 4GX2A 4MTFA 4GX1A 2UXXA 1M9NA 1DF4A 4QPJA 1Q7YW 2P7TC 1QVFU 3E8HA 2ZXWB 1M56B 2WLIB 1AI4A 2HFEC 1E1QG 1I5YA 1M57B 1H8EG 3SYOA 2Y69B 5L3GA 1WPXA 1S72V 1AR1B 2WLIA 1RPOA 1JQ0A 2ZR2A 5H9CA 4YXWG 3IGAC 3CXCU 2WLKA 3RVZA 3ZMZA 1EZJA 2WPDG 3M99B 1KKDA 2F43G 1RM1B 1E1RG 2DYSC 4X89A 1SRYA 3TETA 3ABMC 2EIKB 1KP2A 2UXNA 3F5WC 3FB6C 5EBWC 3I55V 3E89A 4RUFA 3K9AA 1KQSU 2X7RB 4MVRA 1YTFB 3K0DA 1YJ9V 3SYAA 2EIMC 4F4LA 4PDLA 1OZ0A 1H2GA 3JYCA 3CCEV 2EILC 2ATKC 1G4YB 5FL7G 4HYOA 4EKWA 5B1BB 4MVQA 5H6QA 4KUMA 2QA4V 3SPHA 1KC8W 2OCCB 4PA9A 1BMFG 1ORQC 1ENVA 2X6CA 1M56C 2ZXWC 2R9IA 4FPPA 2JEUA 4Q20A 3W7SA 4Z1MG 3VBBA 1K3EA 3MHHC 4QE7A 4WFAV 4WFEA 4QIWF 4JAUA 2X6BA 1VQLV 3A0RA 1AROP 3DTUB 2GHYA 3AG1B 3D36A 3ML0A 4PDRA 5DN6G 1Q82W 1LNQA 3W7TA 1K4DC 2Q69A 3ABLC 4GX5A 3D3IA 3LSQA 3FB5C 3P30A 3GWOA 5IDJA 2XAGA 3ZRWA 4I9WA 2OTLV 1HWYA 2CK3G 2QE7G 1VQ9V 1DLBA 5CBFA 4LP8A 4JYBA 3JD0A 2YSUB 2WLLA 1RM1C 4JTDB 5B1AC 3W7WA 1PNLA 4R8CA 1W2BU 1COWG 1M90W 1FXKC 1JPXA 3FYIB 1CPYA 1GMGA 5EC1C 3ASNC 1YJWV 1I5XA 1VQNV 3ASOB 5CMUA 3QNEA 3FKSG 5B1BC 4MVOA 5KA5A 3EFFK 2WLNA 1G8MA 1QR8A 3E8FA 2ZR3A 3B77A 2BOBC 3ZN0A 3K06A 1GK9A 5L3DA 4U7NA 1VQMV 1GM9A 5J9PC 2HVJC 1VQOV 2LFSA 2EIJC 1TUEB 4LCUC 2IH1C 2OT5A 3SPCA 3FB7C 2DW4A 3AEIA 1K5QA 1NVPD 2OCCC 1AI7A 3T1CA 1QR9A 2DYSB 1FXHA 1OCRB 2LFRA 3F7VC 2ZQMA 1V55B 5B1OA 1NH2B 2Z5UA 1EFRG 2PI5A 2DYRC 1JJ2U 1S3JA 3HPLC 2B1IA 2H8PC 3H01A 4JASA 1MSWD 4QPKA 2R9RB 3AG2B 3ABKC 3CCQV 5KUKA 1P7BA 4I5SA 3R65A 4UUJC 3JD3A 3OAAG 4J9ZB 5IY5C 1K97A 3GB7C 3SPIA 1AJQA 3ABUA 4JAVA 5LGUA 4R7CA 1NKDA 4XBFA 3OE7G 4UV8A 1PKXA 3E8BA 1F4MA 4MTGA 4MVMA 1M1KW 4WFGA 5C93A 2P67A 1DF5A 3PJSK 4N23A 3CCJV 2XOKG 1SERA 2HR3A 1K8AW 4BIZA 1S76D 4HAMA 1ROPA 5IYDO 1VQKV 1JX9A 3ZN1A 2JEXA 2WAMA 1V54B 4RQFA 1MG1A 1VQ6V
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WCE V;  3CCQ V;  2QA4 V;  1VQM V;  1YHQ V;  5DM6 V;  1VQO V;  1Q86 W;  3G71 V;  1KC8 W;  1VQ4 V;  2OTL V;  2OTJ V;  3G6E V;  1YIT V;  3CME V;  3CD6 V;  1VQ9 V;  3CCL V;  3I56 V;  2D3O W;  1VQ5 V;  1VQ8 V;  2QEX V;  1YI2 V;  1K73 W;  1N8R W;  4WFB V;  3I55 V;  1KQS U;  1VQP V;  1Q7Y W;  1VQ7 V;  3CCR V;  4WFA V;  1YJ9 V;  1W2B U;  1M1K W;  1M90 W;  1QVF U;  3G4S V;  3CPW U;  3CCJ V;  1Q81 W;  1R73 A;  1YIJ V;  1YJW V;  1VQL V;  1K8A W;  1QVG U;  3OW2 U;  1Q82 W;  1YJN V;  1KD1 W;  3CCM V;  4WF9 V;  1NJI W;  1S72 V;  3CCS V;  3CC7 V;  1K9M W;  1JJ2 U;  1VQK V;  3CCE V;  3CMA V;  3CC2 V;  3CCU V;  3CC4 V;  1VQN V;  3CCV V;  3CXC U;  1VQ6 V; 
#chains in the Genus database with same CATH topology
 4BW5 A;  2P90 A;  4FZ0 A;  4LNU A;  4K0K O;  2MK3 A;  3BY6 A;  2A9H A;  2EIM B;  1UFI A;  1N8R W;  1OJH A;  3QVN A;  1Z5V A;  4X66 B;  2HJF C;  5L3C A;  1VQP V;  1NTK H;  1Y66 A;  4DXW A;  1Z2G A;  1B6Q A;  1SC5 B;  4OPA A;  3H1H H;  4DV0 B;  4JGS A;  4H0L B;  3T1Y O;  1RPR A;  4JYC A;  4UCT A;  3K5M A;  3STL C;  4JV5 O;  1ZLZ A;  2GUZ B;  4U3J B;  1AR5 A;  1X4T A;  3RYI B;  1F4N A;  4PDM A;  4GCZ A;  4X8A A;  5J2U A;  1IXM A;  5F2V O;  1VQ7 V;  2JJ1 G;  3E22 A;  4ZKI A;  1BQZ A;  4UVA A;  2HG5 C;  2JRI A;  1R3K C;  4B7E A;  4PI0 A;  3K04 A;  2RMK B;  3BHP A;  2CGN A;  4MVZ A;  1S0V A;  2ZNI A;  5CBG A;  5GON B;  4JI2 B;  5CA3 A;  2CTR A;  2EIN C;  2QKC A;  3CHX A;  4DR5 O;  3UT5 A;  1YHQ V;  1IX9 A;  3IC7 A;  3HKE B;  2GTA A;  1CEZ A;  1GRJ A;  4FVM A;  3QO7 A;  2DQ0 A;  1R6K A;  3D3Q A;  2LW1 A;  5LA6 A;  2WLH A;  4UVC A;  3RYC B;  1R73 A;  4H33 A;  4FZ1 A;  2B1G A;  3H9V A;  3WG7 C;  3K79 A;  3T1H B;  5LXT B;  3HKB B;  2EX3 A;  1YEW A;  5IY5 B;  4RAI A;  2W6J G;  3OMA B;  5GW7 A;  2ZD9 A;  5LYJ B;  4DR6 O;  1VQ5 V;  2LP7 A;  1EN6 A;  4J9Y B;  1T5E A;  1K92 A;  2CDY A;  4DV0 O;  2Q7G A;  1J5E B;  1CXZ B;  4LF9 B;  4BWA A;  4B3R O;  5D5Q A;  4JI1 B;  3ZX6 A;  3AG2 C;  1WJZ A;  5JCO C;  4O4I B;  5L3E A;  1IVS A;  3FYE B;  4X20 A;  1M57 C;  3LNM B;  4PDV A;  5J2T A;  3E86 A;  2EIJ B;  2AHY A;  2FTK A;  1N36 O;  1HNX O;  2VQF B;  4FK5 C;  1IBK O;  3N2G B;  4DUY O;  3CX5 F;  1PNM A;  5C8Y B;  3J7A U;  2XT9 A;  3JD2 A;  4U3J A;  3SJB C;  2CTW A;  2QM7 A;  1YIT V;  2ZDI C;  3PN1 A;  3AG3 C;  1I08 A;  4J10 A;  4QJF B;  3ZRV A;  1QLN A;  3ZMU A;  2Q6A A;  1THZ A;  5E1A C;  2Q7H A;  1KD1 W;  1YJN V;  3RBZ A;  1VF6 C;  2UU9 O;  2HP8 A;  2QWP B;  4PA6 A;  3QO8 A;  3MHS C;  1Q6H A;  2L6L A;  1NI8 A;  3JAL A;  3E35 A;  2WLM A;  3SJQ C;  2LGW A;  1OCR C;  1ZL8 A;  4R50 A;  1AB3 A;  2JJ2 G;  4BAY A;  5C8Y A;  1URF A;  3RW0 A;  3UKM A;  2LGQ A;  1QVG U;  4MTO A;  1GAX A;  4GKK B;  3OGC C;  4KP4 A;  3APQ A;  5IWA B;  1GM8 A;  1JVM A;  1S5H C;  3H1J H;  2QWO B;  4MTX A;  1CP9 A;  1WLE A;  4UCR A;  2Y69 C;  1XIL A;  2PUS A;  4X20 B;  2BTQ B;  5LMN B;  1AP6 A;  1K9M W;  1XBL A;  4XDK A;  3JAL B;  4LF8 B;  4TQF A;  4DW1 A;  4WFH A;  4CBC A;  2Y48 A;  1OCC B;  3CME V;  5D5P A;  4X65 O;  3WB1 A;  4X1K B;  3JAR A;  1MAB G;  1F51 A;  1PL4 A;  4GYC B;  4LF9 O;  2YC0 A;  1KYO F;  1HNW B;  4DR3 O;  1YDX A;  4WF9 V;  4DO2 A;  5IJ0 B;  2UUA O;  5LA6 B;  2A7W A;  3HKC B;  5JQG B;  4PJ0 Z;  1QLE C;  3LDC A;  1P49 A;  1S77 D;  1H2M A;  3X2Q B;  4H44 B;  1K4C C;  1M5I A;  4GX2 A;  4MTF A;  4GX1 A;  1Q6I A;  5JH7 B;  2UXX A;  4QPJ A;  1DF4 A;  1Y74 B;  4J7Z A;  1Q7Y W;  1M56 B;  1AI4 A;  1R1B A;  1E1Q G;  1M57 B;  4X65 B;  4JI6 O;  4JI5 B;  4DV7 B;  1WPX A;  1JQ0 A;  2ZKO A;  1XNQ O;  4DV6 O;  3KKY A;  4UCO A;  5IE9 A;  1N0J A;  4NB5 A;  2F43 G;  3L72 H;  2DYS C;  4X89 A;  3QTC A;  5LMN O;  1SRY A;  2UUA B;  3THO A;  3FB6 C;  1YJ9 V;  3HKC A;  2EIM C;  2DMX A;  3A2F A;  4TV9 A;  1Y67 A;  4FLV A;  5LYJ A;  2VQE B;  1Q6U A;  3BFR A;  5FL7 G;  1KBH A;  5JWP A;  4FFB B;  4KUM A;  2YI8 A;  1U96 A;  1ORQ C;  1XOU A;  5KX5 B;  1I0H A;  3B4S A;  4FPP A;  4DR2 O;  2G38 A;  4BW9 A;  4WFA V;  1K3E A;  3MHH C;  5KHH A;  4QIW F;  2Q8V A;  4IIJ B;  4ZHQ B;  3A0R A;  4JZG A;  2Q7E A;  4AI8 A;  4TV8 A;  3JAR B;  2DN9 A;  3GWO A;  1LR1 A;  2RN9 A;  1IBK B;  2ZT9 B;  5CBF A;  1BGY H;  1QHT A;  4ZIB A;  4O4H B;  1YJW V;  2YID A;  4LR3 A;  5B1B C;  1BSM A;  4MVO A;  2ZNJ A;  2WLN A;  4NVP A;  1QR8 A;  2ZR3 A;  2YUA A;  1VQM V;  1M4U A;  3GWK C;  1VQO V;  1S5J A;  4JI1 O;  3SPC A;  4K35 A;  2DW4 A;  3AEI A;  1KU9 A;  4FM0 A;  1NVP D;  4PD4 F;  2OCC C;  1AI7 A;  1H2N A;  1FXH A;  3CS5 A;  3K9S A;  4HBN A;  1EFR G;  3M7M X;  2ZIM A;  3HPL C;  4ZOL A;  3H01 A;  5B66 Z;  4FM1 A;  2R9R B;  4CH6 A;  4UB8 Z;  5KUK A;  3JAW B;  4I5S A;  3OAA G;  3F5T A;  3D36 C;  4UFZ A;  5IY5 C;  5LGU A;  2CUG A;  4ICG A;  2RJZ A;  5A2Q N;  4UV8 A;  1Z5W A;  1F4M A;  1M1K W;  4WFG A;  5JJE B;  5C93 A;  1SQB H;  2XOK G;  1SER A;  3B09 A;  1A32 A;  4X1I A;  1HR0 O;  3K5O A;  1WN7 A;  3FAV B;  1ROP A;  4CS3 A;  4X66 O;  1V54 B;  4LWS A;  4IHJ A;  3KCY A;  3OUF A;  3IFX A;  2Z3Y A;  4K0K B;  1QU7 A;  2WA3 A;  4PA4 A;  3EVK A;  4TUY B;  1G1X B;  3ZRW B;  3ZHV A;  4FM2 A;  1QBZ A;  1HDJ A;  4JYY A;  5KMG A;  2IH3 C;  1ZAU A;  3D8C A;  1GN3 A;  3JSN A;  2O57 A;  4I4T B;  4OX9 B;  5LHH A;  3HR0 A;  1KB9 F;  4ABM A;  2XAS A;  2HHH B;  3EHB B;  4G2K A;  4YY3 B;  3LDE A;  4ZOL B;  5KX5 A;  2OCH A;  4JI8 O;  4DR2 B;  4GUN A;  1PM9 A;  4U7O A;  2D2C B;  3HKB A;  1BHA A;  3S3X A;  4YHH O;  1FKA O;  4RQE A;  2CTQ A;  4K8Z A;  5K1X A;  1Y76 B;  3RYC A;  1NR1 A;  5JJJ B;  4FJC C;  4D7T A;  5J2T B;  2YIC A;  3G6E V;  1Y6X A;  3CD6 V;  4GKJ B;  4JYA B;  4ASU G;  1YVW A;  1AP5 A;  4P2Z A;  3K03 A;  3C3T A;  3W7X A;  3P32 A;  3CPW U;  2B5U A;  4IYI A;  2QTO A;  3OEE G;  3JSL A;  4DRX B;  4LF6 O;  4GZR B;  3T1Y B;  4LF5 B;  3OUS A;  4ZI7 A;  3RGB A;  3ZHT A;  2K1E A;  5BR8 B;  4I50 A;  5EBM C;  1RFY A;  4IIJ A;  2JVD A;  3CB2 A;  5FLX N;  1NBM G;  4JI4 B;  3OR7 C;  2A3Q A;  4NYK A;  3DC6 A;  5IYZ A;  4P9O A;  5CA1 A;  1Q90 D;  2A06 H;  5H6R A;  3T2M A;  5LXT A;  1YCI A;  4MS2 A;  2E76 B;  3W7U A;  3SPJ A;  3U10 A;  2VQE O;  1NT2 B;  3K58 A;  2CE4 A;  1FYJ A;  3OM3 B;  2EIN B;  1OCZ C;  1I94 O;  4Z1V A;  3U11 A;  4HZ3 A;  5B1A B;  2NLJ C;  3BVO A;  5LMU B;  1D5A A;  4DV5 O;  3CCV V;  1Q86 W;  5KLV H;  4IGG A;  1BHB A;  1XL6 A;  4NXM B;  2WSS G;  3ABK B;  4IYH A;  4CZZ A;  2BOC C;  3N2K B;  2IJH A;  2XAH A;  1WP8 A;  3WG7 B;  2EIK C;  3G4S V;  4KFM A;  3JD1 A;  3K59 A;  3BEH A;  3L9D A;  2PYJ A;  3CRQ A;  1AI5 A;  4EB6 A;  3RYI A;  5LOV B;  2CGO A;  1NQT A;  3TGU H;  3RYH A;  2P5O A;  1L0L H;  3I56 V;  3UQ8 A;  3RT3 C;  2P6J A;  3DSQ A;  3OMI B;  4E2L A;  1QNM A;  1RP3 B;  3ZMT A;  3L75 H;  1FJG B;  1IZ3 A;  4XDL A;  4EFE A;  1DK1 A;  3LUT B;  4B7K A;  2YIA A;  2Q0A A;  3X2Q C;  2KKW A;  1MNG A;  3L73 H;  4UXN A;  3ZHS A;  3ZMS A;  4I4T A;  2N04 A;  5GTH Z;  1SA0 B;  5EYP A;  3RN4 A;  2YDE A;  4NTX A;  5LGT A;  5KMG B;  2DQ3 A;  3T4Z A;  3K5L A;  3KZI Z;  3SYC A;  4DV1 O;  4AIL C;  5B3S B;  3ZMV A;  2EZO A;  1Q5O A;  3RFR A;  1NJI W;  3CCS V;  1YTF D;  5A9G A;  2A79 B;  3ASO C;  1L1F A;  3R66 A;  1VAR A;  2EJR A;  3SPG A;  3CCL V;  1VQ8 V;  4TT3 G;  2QR4 A;  5H5N A;  1S5L Z;  1JR9 A;  2AZ0 A;  3VQY A;  1IBM B;  1NTM H;  1NS1 A;  2DWD C;  4DV1 B;  1YIJ V;  1R6N A;  4R6Z A;  1SZT A;  4TQD A;  4MW8 A;  3ABT A;  4HNA A;  3ZBH A;  5FNV A;  1PNK A;  4DR1 O;  1WP7 A;  1HR0 B;  2GV9 A;  2GTS A;  2JDI G;  2V4D A;  1EZV H;  1JA8 A;  1K5S A;  2W0F C;  3ZHQ A;  5CA1 B;  1UPG A;  1LUW A;  2XUM A;  1JFF B;  4X88 A;  4LF8 O;  1D2D A;  1GN4 A;  2Q0O C;  3G80 A;  4P9P A;  3STZ C;  3CYO A;  1H8H G;  4I50 B;  4KHP B;  4L87 A;  1Q8I A;  2IM9 A;  3OTF A;  2AGA A;  1AVM A;  5CB4 A;  3P3P A;  4CH4 A;  2P7T C;  5BY1 A;  3BCC H;  4LFA B;  3E8H A;  2WLI B;  4J7K A;  4PV1 B;  3ZHU A;  1H8E G;  2F23 A;  5L3G A;  1XMQ B;  5K1P A;  1P7G A;  3L70 H;  4DR5 B;  5H9C A;  4YXW G;  1US6 A;  3IGA C;  2YXL A;  1FFX A;  3Q4H B;  2WLK A;  1QQC A;  3ZMZ A;  2WPD G;  3M99 B;  5B5E Z;  4UCV A;  3KCX A;  3TET A;  3DXR A;  2EIK B;  4JI8 B;  2QWR B;  2F4V B;  3E89 A;  4A5U B;  5ITZ B;  2UUC O;  1KUQ A;  3JYC A;  4JZ2 A;  5BR8 O;  3CRR A;  1O9H A;  4DR4 O;  4HYO A;  2Q73 A;  4DK0 A;  5H6Q A;  2QSA A;  2QA4 V;  3SPH A;  4AQY O;  1PPJ H;  2DE0 X;  3MDS A;  3J81 N;  5KHJ A;  1BMF G;  3RYF A;  1ENV A;  2X6C A;  1ZTE A;  1M56 C;  2PY5 A;  3W7S A;  4Z1M G;  5IJ9 A;  3CRM A;  2GHY A;  3D36 A;  3DTU B;  4PDR A;  4B3S B;  1LNQ A;  1K4D C;  3ABL C;  4I55 B;  3P30 A;  5IDJ A;  2OTL V;  1HWY A;  2CK3 G;  3UT5 B;  2NR5 A;  3OTO B;  1RSO A;  2KG7 A;  1RM1 C;  4JTD B;  1PNL A;  1W2B U;  1M90 W;  1JPX A;  1CPY A;  5GON A;  1I5X A;  3ASO B;  5CMU A;  3QNE A;  5KA5 A;  3EFF K;  4JI0 O;  4DR7 B;  1B04 A;  4TUY A;  5LP6 A;  4B3T B;  4DV4 B;  4X1K A;  1GM9 A;  2HVJ C;  2LFS A;  4NR1 A;  4LCU C;  2Y0I A;  3JAS A;  3T1C A;  1QR9 A;  1OCR B;  2ZQM A;  1V55 B;  1NH2 B;  3SGI A;  2BTO A;  2LJ2 A;  5FPR A;  2B1I A;  3CCQ V;  2P06 A;  3R65 A;  2GDS A;  3JAT A;  1K97 A;  1GN2 A;  3GB7 C;  3SPI A;  4LWS B;  4JAV A;  2AW9 A;  3AG7 A;  4U3F H;  1NKD A;  4MTG A;  2IBZ H;  5LL6 Y;  1K8A W;  1S76 D;  4HAM A;  3O65 A;  1JX9 A;  3BA9 A;  3ZN1 A;  2EJ7 A;  4LNU B;  4RQF A;  1VQ6 V;  5EYP B;  4DW0 A;  5LHI A;  4CH5 A;  4JTA B;  2UUB O;  2QEX V;  2VWK A;  2JGU A;  2R70 A;  3E2E A;  4MSW C;  2CH7 A;  3N27 A;  2ARH A;  4TV8 B;  4B3R B;  2PYL A;  2IJI A;  1P4R A;  5KAI Z;  1N4C A;  3JD4 A;  3BRC A;  4I0X B;  2HJD A;  3JAM N;  2F1M A;  4BIU A;  1FXV A;  2QGN A;  1XQ8 A;  1XEQ A;  4FIP C;  4AHC A;  5GTI Z;  1N33 B;  2OTJ V;  2WWW A;  2IU0 A;  4KHP O;  3M8A A;  5LBQ A;  1OCZ B;  1BE3 H;  4WFB V;  4QGP A;  2QKS A;  3LSS A;  1BL8 A;  4JTC B;  2KSD A;  3EXA A;  2C2A A;  4GX0 A;  2FKX A;  2ITD C;  4DR3 B;  4DUY B;  3CCM V;  4TV9 B;  5CBH A;  1JMK C;  4LFB O;  1AIL A;  3UO2 A;  2P4K A;  4WBN A;  1PD3 A;  4DK1 A;  4Z2W A;  2ITC C;  2Q4P A;  1AJN A;  5B1N A;  1FXK B;  2QM4 A;  1GM7 A;  2BSK A;  1Q43 A;  4NTY A;  1H2L A;  1MMM A;  2AXT Z;  3ABL B;  2WLL B;  4Q6G A;  1FS0 G;  2HLD G;  2CAZ C;  4X9Q A;  2KB1 A;  3FB8 C;  1SQQ H;  3DXR B;  1OCO B;  2CTP A;  4ZI7 B;  1FXK A;  3ZIA G;  4JI7 O;  3TXQ A;  1XMO O;  3CJH A;  4PA3 A;  3MAQ A;  4JF3 A;  1B06 A;  1H2S B;  3B8N A;  3ETQ A;  3ZRX A;  1E79 G;  1Y74 A;  5FPO A;  5JJN B;  4J7J A;  3RYF B;  4N21 A;  2JS5 A;  4X64 O;  2B9Z A;  2QM8 A;  4MW3 A;  4C7U A;  1HNW O;  5EC2 C;  4EFB A;  4LF7 B;  1BQ0 A;  4JI6 B;  1IBL B;  3UM7 A;  4HNA B;  4NKG B;  1Q81 W;  3SJC C;  3UO3 A;  1MOF A;  1Q3E A;  3FD9 A;  3DC5 A;  2F95 B;  4XDJ A;  1GTO A;  3H1L H;  2BTQ A;  1KKC A;  2F4V O;  5L3F A;  4NXN O;  2WA4 A;  1N34 B;  1JCH A;  2OYQ A;  3BAB A;  4KXR A;  4YJ2 B;  4G28 B;  3B40 A;  3VQW A;  3IJ4 A;  3C90 A;  2K9P A;  1ZX3 A;  1TGO A;  3H1I H;  2UXD O;  1IBL O;  1EN5 A;  1OHH G;  1W0K G;  2Y0P A;  1W0J G;  1WB7 A;  2XND G;  4WFF A;  3WU2 Z;  3J80 N;  2YI9 A;  3AG4 B;  3CXH F;  3AK1 A;  1YSC A;  2RQ6 A;  3O9O A;  4I9Q A;  3CCR V;  4FLX A;  4X62 B;  5BMV A;  3SR2 C;  3P3N A;  2V1D A;  1H38 A;  4QNH B;  1SF9 A;  1YZB A;  3ZRS A;  4OX9 O;  3VQX A;  3AG1 C;  3AG4 C;  1VQ4 V;  4OPH A;  1NR7 A;  2BE3 A;  3NR7 A;  1V54 C;  4IHJ B;  5LHG A;  3IAY A;  2ZDI A;  3JCZ A;  4UVB A;  1FJG O;  4UB6 Z;  4J80 A;  2QTS A;  3UCS C;  5L3B A;  4JYA O;  1NU1 H;  1ZWI C;  3FX7 A;  4MVS A;  4PHZ A;  2VWJ A;  1ZL8 B;  5AG2 A;  1GO3 F;  1SA0 A;  4LFA O;  2IJJ A;  4TSF G;  2EBO A;  1AJP A;  2ILM A;  3TXS A;  2HKO A;  1AI6 A;  1I7F A;  3ZS8 C;  1ZUQ A;  2HVK C;  5KA6 A;  2YS8 A;  1WAZ A;  3OGI B;  3SYQ A;  1OCO C;  5TIS Z;  2W0X A;  1BT8 A;  2Q68 A;  4DV6 B;  2GSM B;  1R3J C;  3T4D A;  4JV5 B;  4O4L B;  1R3L C;  1FFT B;  4W4K A;  4KL1 A;  5JVD B;  2OIG A;  1Y4M A;  4LBE C;  4ZBM A;  4GKK O;  3OR6 C;  4H37 A;  4DYL A;  5E79 Z;  2M6Y A;  2E5L B;  5EIB D;  3S3W A;  4B3M B;  4FFB A;  3BA8 A;  3OTO O;  3QF7 A;  3N2G A;  1FAF A;  4O4H A;  1M9N A;  1SZX A;  1QVF U;  2ZXW B;  5CA0 B;  2KG7 B;  2LW7 A;  1HW7 A;  2Y69 B;  1S72 V;  1AR1 B;  2WLI A;  3CXC U;  1EZJ A;  3ABM C;  2ZE6 A;  2JGD A;  3F5W C;  5EBW C;  2N74 A;  4X1Y A;  1KQS U;  2X7R B;  3SYA A;  5LP6 C;  4F4L A;  1F7Y A;  4F6R A;  1OZ0 A;  5ITZ A;  1SQF A;  1WB8 A;  1U97 A;  4LFB B;  1KMI Z;  1XDC A;  2ATK C;  2EIL C;  4DV3 O;  1HNZ O;  2OCC B;  2P22 C;  4PA9 A;  4D6T H;  5IT9 N;  3RWR D;  1VF7 A;  1FFX B;  2R9I A;  1N0N A;  2JEU A;  3G67 A;  2E5L O;  4QE7 A;  4X1Y B;  1VF5 B;  4JAU A;  2X6B A;  2ZE7 A;  1BZK A;  3AG1 B;  2ODM A;  1XI1 A;  4DV7 O;  4JI5 O;  4GKJ O;  2LQT A;  3W7T A;  2Q69 A;  3K5N A;  4DR4 B;  3D3I A;  2R72 A;  3FB5 C;  1MZF A;  4I9W A;  3ZRW A;  2QE7 G;  1IDS A;  1VQ9 V;  3A0B Z;  3OD4 A;  1SQG A;  4LP8 A;  4NXM O;  2WLL A;  3W7W A;  4RWU A;  1N34 O;  1FXK C;  3FYI B;  5EC1 C;  5KHI A;  2UUB B;  4CH3 A;  5CB4 B;  3FKS G;  2DOS A;  5J2U B;  4DUZ O;  2BOB C;  3JAK A;  3K06 A;  2FML A;  5L3D A;  4U7N A;  1N33 O;  1I94 B;  5J9P C;  2ZE5 A;  2EIJ C;  1TUE B;  4JAA A;  2OT5 A;  5FNV B;  1XMO B;  4LFC O;  1K5Q A;  2EUL A;  4I0X A;  4LF4 O;  2PZS A;  1XHX A;  3L74 H;  1TAE A;  1PV0 A;  2ZIO A;  2DYR C;  1JJ2 U;  1JJO A;  3SDL A;  1S3J A;  2H8P C;  4IT5 A;  4FLU A;  1MSW D;  4QPK A;  4BIO A;  4K8X A;  2NN4 A;  1P7B A;  1WNS A;  3AK2 A;  4YJ3 B;  1PP9 H;  2Y4T A;  4XBF A;  4R7C A;  4PI2 A;  1NZ6 A;  1VMG A;  1D5N A;  4LF4 B;  1W59 A;  1H2K A;  3JAK B;  2BCC H;  3PJS K;  2Q9L A;  5KAF Z;  2HR3 A;  4BIZ A;  1VQK V;  1IUR A;  4DR7 O;  2JEX A;  1VP7 A;  2WAM A;  4D7S A;  1EM1 A;  3SJA C;  4YJ2 A;  2AHZ A;  1NTZ H;  2MW2 B;  1XL4 A;  5EZY A;  1YI2 V;  2H3O A;  1K7D A;  2IU3 A;  1XHZ A;  5KHK A;  2IW5 A;  1X59 A;  4GT1 A;  3CEI A;  2PGG A;  2ADP A;  5EBL C;  4JI7 B;  2XAJ A;  1GN6 A;  1NVP B;  3ASN B;  3JAW A;  1L0N H;  3E8G A;  3GVM A;  2XAQ A;  1XNR B;  2E74 B;  3ZCC A;  2FB5 A;  2YEV B;  4P30 A;  1OV9 A;  3CRC A;  3VQV A;  2Y4U A;  3K3W A;  2Q5Z A;  5LP6 B;  3LSU A;  3WB0 A;  1WPB A;  3B8M A;  3JCU Z;  5BMV B;  4O4I A;  3HB3 B;  3H1K H;  4QE9 A;  3HKD B;  4JI4 O;  2EIL B;  3VOU A;  1YXB A;  2ZM6 O;  5IYZ B;  4MT8 A;  5IJ9 B;  2ZCE A;  3CC7 V;  3LDD A;  1OCC C;  4JPR A;  1DGS A;  3CCU V;  4FMT A;  3RVY A;  5KHG A;  2VS0 A;  2JGD B;  2VQF O;  4PEL A;  1K73 W;  4O2A A;  3DGE A;  4RUE A;  1K34 A;  4NXN B;  1SKV A;  4F6R B;  5IYB O;  2M7W A;  2DJV A;  2RDC A;  4DV2 O;  4FLY A;  2V7Q G;  4TWK A;  5H2F Z;  2JS3 A;  4WCE V;  3K08 A;  4TOI A;  5JH7 A;  2QWQ B;  4O2A B;  2UU9 B;  3KG2 A;  1TUB A;  4DRX A;  4GLX A;  2GBO A;  4LF5 O;  1TVK A;  3I5D A;  5IJ0 A;  4DR1 B;  1QCE A;  1BCC H;  4JI0 B;  2EZP A;  1G6U A;  3E22 B;  4IL6 Z;  3T1H O;  1B3Q A;  3CC4 V;  1MA1 A;  3A0H Z;  4E4E A;  3ETE A;  2L35 A;  4O4J B;  4OXS A;  4PA7 A;  2AZ2 A;  1TA8 A;  2QKA A;  1J5E O;  1TVK B;  2DYR B;  4F6E A;  1WA8 A;  2YXH A;  3QO5 A;  1TUB B;  1LUV A;  1N36 B;  2W6I G;  1MZE A;  1M93 A;  5KUM A;  3IC9 A;  3K0G A;  2PI4 A;  4B3S O;  3TCU A;  2XAF A;  1EBO A;  3B2E E;  2NNU A;  2X6A A;  4W4L A;  2GUZ A;  2IJK A;  3ZED A;  2OWO A;  1R6T A;  2DWE C;  2ADQ B;  1SET A;  1KEC A;  1YF2 A;  2FL4 A;  1XNQ B;  1K33 A;  5B3S C;  3ICX A;  4FLW A;  2H94 A;  1XNR O;  3OFN G;  1DTO A;  3WB2 A;  2UXC B;  4YIP A;  2UXB O;  4LC1 A;  4RO2 A;  1V55 C;  1MSD A;  5EZY B;  1SES A;  2X0L A;  2ZM6 B;  1ZSP A;  4O2B A;  1SQP H;  3OMN B;  3CSX A;  3HKD A;  1VIB A;  4J42 A;  3SYP A;  1FPO A;  4H13 B;  2PF4 E;  1KP3 A;  2KQX A;  1XMQ O;  2YEV A;  4FLZ A;  3CC2 V;  3NXS A;  1GH6 A;  4YJ3 A;  1SQV H;  3G71 V;  3JAS B;  3F7Y C;  4DR6 B;  5JCO A;  1BS3 A;  1R3I C;  3RYH B;  2Q67 A;  4X64 B;  5LOV A;  5BZB A;  3FAV A;  4JI2 O;  3TJT A;  4G27 B;  2R9A A;  2JK5 C;  3CMA V;  3APO A;  1F23 A;  4UV9 A;  5HFM A;  3ABM B;  3JAT B;  2QDO A;  5LGN A;  1HP8 A;  2WLJ A;  3ETD A;  3ETG A;  3ZJZ A;  3MD0 A;  1QLE B;  4X1I B;  2HEP A;  3OT7 A;  1JOY A;  1NH2 D;  4B3T O;  1FD9 A;  2VRZ A;  5CN0 A;  3N2K A;  1SS3 A;  5EK0 A;  4J11 A;  2Z0A A;  3TK1 A;  4O2B B;  1PL0 A;  4MVU A;  5DED A;  2E75 B;  4CS2 A;  4K3A A;  1VEW A;  2D3O W;  2UXD B;  3CP1 A;  2UXC O;  1EN4 A;  4EB6 B;  4O4J A;  5HFL A;  4BR6 A;  2JIZ G;  3OEH G;  2XHB A;  4DV4 O;  2A0L A;  3AG3 B;  2UUC B;  3OW2 U;  4LF7 O;  1GKF A;  5IYC O;  1UJW B;  1IXB A;  4J41 A;  3WFV A;  4CC6 A;  1RSO B;  1N32 B;  1XUQ A;  3CE2 A;  5DM6 V;  1J95 A;  4CS4 A;  4FLT A;  2YXY A;  3E83 A;  4FFK A;  2F93 B;  5IWA O;  2HFE C;  1I5Y A;  4OGQ B;  3ZHR A;  4B08 A;  3SYO A;  1RPO A;  3L71 H;  3CWB H;  2ZR2 A;  2N05 A;  4DUZ B;  3RVZ A;  4B3M O;  4I55 A;  2BSK B;  1KKD A;  1RM1 B;  1E1R G;  2FYU H;  1KP2 A;  2UXN A;  4ZHQ A;  3I55 V;  5LMU O;  4RUF A;  3K9A A;  1WA8 B;  4MVR A;  1YTF B;  3K0D A;  2HHH O;  4PDL A;  1XRE A;  2F66 C;  1H2G A;  1SQX H;  1V9P A;  3CCE V;  1O9G A;  1G4Y B;  3FFQ A;  4EKW A;  5B1B B;  4MVQ A;  1HNX B;  5BXZ A;  1KC8 W;  5JVD A;  4YHH B;  2XTA A;  5JQG A;  3Q4H A;  1L8D A;  2ZXW C;  4UCU A;  4Q20 A;  2YIB A;  3A8T A;  1VF6 A;  4O4L A;  1Y76 A;  1N32 O;  3VBB A;  4WFE A;  1IBM O;  3CJH B;  1VQL V;  1ARO P;  2QJ1 A;  3ML0 A;  5DN6 G;  1Q82 W;  3LNN A;  2UXB B;  3HKE A;  4GX5 A;  3LSQ A;  4LH7 A;  2XAG A;  4UCS A;  5EIB C;  1DLB A;  4WBN B;  2YIB D;  4CC5 A;  4JYB A;  3JD0 A;  2ZIN A;  5CA0 A;  2YSU B;  3AK3 A;  5B1A C;  4R8C A;  1COW G;  1JFF A;  1GMG A;  2PTM A;  4L8J A;  3ASN C;  2CH7 B;  3C3S A;  4EEQ A;  1G8M A;  2E3C A;  5DEC A;  3E8F A;  3K57 A;  3B77 A;  2P4V A;  2RNB A;  3ZN0 A;  1GK9 A;  2OIE A;  4AQY B;  1HNZ B;  3QG5 A;  2IH1 C;  3FB7 C;  2LO1 A;  4LFC B;  4JI3 B;  2ZE8 A;  2DYS B;  2ETN A;  3CRA A;  2LFR A;  4X62 O;  3F7V C;  5B1O A;  2Z5U A;  2PI5 A;  4JAS A;  3U0Z A;  4DV5 B;  3AG2 B;  1AR4 A;  3ABK C;  4NTW A;  4UUJ C;  3JD3 A;  2RCV A;  4YY3 O;  4LH6 A;  4J9Z B;  1AJQ A;  3ABU A;  1P84 F;  4JI3 O;  3OE7 G;  4DV3 B;  1PKX A;  3E8B A;  4MVM A;  2P67 A;  1DF5 A;  3BPZ A;  4N23 A;  2QWN B;  3CCJ V;  3G6B A;  4LF6 B;  4I7Z B;  5IYD O;  4DV2 B;  3BAA A;  4YIO A;  1VQN V;  1MG1 A; 
#chains in the Genus database with same CATH homology
 3OUF A;  5LHI A;  4BW5 A;  2P90 A;  4JTA B;  3IFX A;  2Z3Y A;  2MK3 A;  3BY6 A;  2AHZ A;  2QEX V;  1XL4 A;  2A9H A;  4PA4 A;  2EIM B;  1YI2 V;  1N8R W;  3ZRW B;  1K7D A;  1QBZ A;  2HJF C;  2IU3 A;  3E2E A;  4MSW C;  5L3C A;  1VQP V;  2IW5 A;  1Y66 A;  4GT1 A;  4DXW A;  5EBL C;  1B6Q A;  2IH3 C;  2IJI A;  1P4R A;  2XAJ A;  3JD4 A;  1NVP B;  3ASN B;  4JGS A;  4BIU A;  3E8G A;  5LHH A;  1FXV A;  1RPR A;  2XAQ A;  4FIP C;  4JYC A;  3STL C;  2XAS A;  3ZCC A;  2OTJ V;  3EHB B;  4G2K A;  2YEV B;  2WWW A;  3LDE A;  4P30 A;  2IU0 A;  5LBQ A;  1F4N A;  1OCZ B;  3K3W A;  4WFB V;  4PDM A;  4GCZ A;  2QKS A;  3B8M A;  4X8A A;  3HB3 B;  1IXM A;  1BL8 A;  3LSS A;  4JTC B;  4U7O A;  1VQ7 V;  1BHA A;  2C2A A;  4QE9 A;  4GX0 A;  2JJ1 G;  2EIL B;  3VOU A;  4RQE A;  4MT8 A;  2ITD C;  3CCM V;  4ZKI A;  3CC7 V;  3LDD A;  5CBH A;  4UVA A;  1OCC C;  2HG5 C;  4JPR A;  3CCU V;  1NR1 A;  1R3K C;  4FMT A;  4FJC C;  3RVY A;  3K04 A;  1PD3 A;  3G6E V;  3CD6 V;  2ITC C;  4MVZ A;  1S0V A;  1AJN A;  5B1N A;  4PEL A;  1K73 W;  1FXK B;  3DGE A;  1GM7 A;  5CBG A;  4ASU G;  4P2Z A;  3K03 A;  4RUE A;  1K34 A;  3W7X A;  5CA3 A;  3P32 A;  3ABL B;  2WLL B;  5IYB O;  3CPW U;  2M7W A;  2B5U A;  1FS0 G;  2HLD G;  2QTO A;  2KB1 A;  3OEE G;  3FB8 C;  2EIN C;  2V7Q G;  4TWK A;  4WCE V;  1OCO B;  3OUS A;  1YHQ V;  3K08 A;  3IC7 A;  1FXK A;  3ZIA G;  2K1E A;  5EBM C;  1CEZ A;  4PA3 A;  3KG2 A;  3QO7 A;  4JF3 A;  2DQ0 A;  1R6K A;  1NBM G;  2WLH A;  4UVC A;  3OR7 C;  1R73 A;  4H33 A;  3B8N A;  2B1G A;  3ZRX A;  1QCE A;  1E79 G;  4P9O A;  2EZP A;  3WG7 C;  3K79 A;  4N21 A;  3CC4 V;  5IY5 B;  3ETE A;  5H6R A;  3T2M A;  2QM8 A;  4RAI A;  4MW3 A;  2W6J G;  3OMA B;  5EC2 C;  4MS2 A;  5GW7 A;  2ZD9 A;  1VQ5 V;  3W7U A;  4OXS A;  2LP7 A;  4PA7 A;  3SPJ A;  4J9Y B;  3UM7 A;  1K92 A;  2DYR B;  3OM3 B;  2EIN B;  1OCZ C;  3QO5 A;  2W6I G;  1Q81 W;  5KUM A;  3K0G A;  3AG2 C;  1MOF A;  4HZ3 A;  5B1A B;  2PI4 A;  4XDJ A;  5L3E A;  2NLJ C;  1GTO A;  3TCU A;  2XAF A;  1EBO A;  3FYE B;  2NNU A;  2X6A A;  1M57 C;  5L3F A;  3CCV V;  2IJK A;  1Q86 W;  1JCH A;  3LNM B;  2DWE C;  4PDV A;  1BHB A;  1XL6 A;  1SET A;  3E86 A;  2WSS G;  3ABK B;  1KEC A;  4G28 B;  4CZZ A;  2EIJ B;  1K33 A;  5B3S C;  2BOC C;  2AHY A;  2H94 A;  2IJH A;  2FTK A;  2XAH A;  3OFN G;  3WG7 B;  2EIK C;  3G4S V;  4FK5 C;  1DTO A;  4KFM A;  3JD1 A;  3BEH A;  4LC1 A;  1OHH G;  4RO2 A;  1PNM A;  1V55 C;  1W0K G;  1W0J G;  1AI5 A;  3JD2 A;  1SES A;  2XND G;  4WFF A;  1NQT A;  2X0L A;  2QM7 A;  1YIT V;  3I56 V;  2ZDI C;  3AG4 B;  3AG3 C;  2P6J A;  1YSC A;  3OMI B;  4QJF B;  3ZRV A;  3OMN B;  4E2L A;  1QLN A;  3ZMT A;  3ZMU A;  2Q6A A;  3SYP A;  3CCR V;  1THZ A;  5E1A C;  4XDL A;  2V1D A;  1H38 A;  3LUT B;  1KD1 W;  1KP3 A;  4QNH B;  1YJN V;  3RBZ A;  3ZRS A;  2YEV A;  3CC2 V;  3NXS A;  3X2Q C;  3AG1 C;  3AG4 C;  4PA6 A;  4UXN A;  3QO8 A;  3MHS C;  1VQ4 V;  3G71 V;  1NR7 A;  3F7Y C;  3ZMS A;  1V54 C;  3E35 A;  2WLM A;  3SJQ C;  5LHG A;  1OCR C;  5LGT A;  2ZDI A;  4R50 A;  1R3I C;  3JCZ A;  2JJ2 G;  4UVB A;  4BAY A;  2Q67 A;  2DQ3 A;  5BZB A;  3T4Z A;  3SYC A;  3RW0 A;  3UKM A;  5B3S B;  3ZMV A;  2EZO A;  1QVG U;  4MTO A;  5L3B A;  4G27 B;  1NJI W;  3CCS V;  3OGC C;  2JK5 C;  1YTF D;  1ZWI C;  4MVS A;  3CMA V;  2A79 B;  4KP4 A;  3ASO C;  1F23 A;  4UV9 A;  5HFM A;  3ABM B;  1GO3 F;  5LGN A;  2WLJ A;  1L1F A;  1GM8 A;  1JVM A;  3SPG A;  2EJR A;  3ETD A;  3ETG A;  2IJJ A;  3CCL V;  3ZJZ A;  1S5H C;  1VQ8 V;  4TSF G;  2EBO A;  1AJP A;  1QLE B;  3MD0 A;  4TT3 G;  4MTX A;  2HKO A;  1JOY A;  1CP9 A;  1AI6 A;  1WLE A;  1NH2 D;  2Y69 C;  5KA6 A;  2HVK C;  2DWD C;  1YIJ V;  1R6N A;  5CN0 A;  3SYQ A;  1OCO C;  4R6Z A;  1K9M W;  1SZT A;  4MW8 A;  4XDK A;  5EK0 A;  2Q68 A;  3ABT A;  3TK1 A;  2GSM B;  4WFH A;  1R3J C;  3T4D A;  1PL0 A;  1PNK A;  2Y48 A;  4MVU A;  4CBC A;  1R3L C;  1OCC B;  1FFT B;  3CME V;  2D3O W;  3CP1 A;  5HFL A;  2JDI G;  2JIZ G;  1MAB G;  1F51 A;  3OEH G;  1K5S A;  2A0L A;  2W0F C;  3AG3 B;  1Y4M A;  4LBE C;  3OW2 U;  1GKF A;  4ZBM A;  5IYC O;  1UJW B;  4WF9 V;  3OR6 C;  4X88 A;  4DO2 A;  4H37 A;  3WFV A;  4P9P A;  1QLE C;  3CYO A;  1J95 A;  3LDC A;  3STZ C;  5DM6 V;  1S77 D;  1H8H G;  3E83 A;  3X2Q B;  4L87 A;  1K4C C;  4GX2 A;  4MTF A;  4GX1 A;  2UXX A;  1M9N A;  1DF4 A;  4QPJ A;  1Q7Y W;  2P7T C;  1QVF U;  3E8H A;  2ZXW B;  1M56 B;  2WLI B;  1AI4 A;  2HFE C;  1E1Q G;  1I5Y A;  1M57 B;  1H8E G;  3SYO A;  2Y69 B;  5L3G A;  1WPX A;  1S72 V;  1AR1 B;  2WLI A;  1RPO A;  1JQ0 A;  2ZR2 A;  5H9C A;  4YXW G;  3IGA C;  3CXC U;  2WLK A;  3RVZ A;  3ZMZ A;  1EZJ A;  2WPD G;  3M99 B;  1KKD A;  2F43 G;  1RM1 B;  1E1R G;  2DYS C;  4X89 A;  1SRY A;  3TET A;  3ABM C;  2EIK B;  1KP2 A;  2UXN A;  3F5W C;  3FB6 C;  5EBW C;  3I55 V;  3E89 A;  4RUF A;  3K9A A;  1KQS U;  2X7R B;  4MVR A;  1YTF B;  3K0D A;  1YJ9 V;  3SYA A;  2EIM C;  4F4L A;  4PDL A;  1OZ0 A;  1H2G A;  3JYC A;  3CCE V;  2EIL C;  2ATK C;  1G4Y B;  5FL7 G;  4HYO A;  4EKW A;  5B1B B;  4MVQ A;  5H6Q A;  4KUM A;  2QA4 V;  3SPH A;  1KC8 W;  2OCC B;  4PA9 A;  1BMF G;  1ORQ C;  1ENV A;  2X6C A;  1M56 C;  2ZXW C;  2R9I A;  4FPP A;  2JEU A;  4Q20 A;  3W7S A;  4Z1M G;  3VBB A;  1K3E A;  3MHH C;  4QE7 A;  4WFA V;  4WFE A;  4QIW F;  4JAU A;  2X6B A;  1VQL V;  3A0R A;  1ARO P;  3DTU B;  2GHY A;  3AG1 B;  3D36 A;  3ML0 A;  4PDR A;  5DN6 G;  1Q82 W;  1LNQ A;  3W7T A;  1K4D C;  2Q69 A;  3ABL C;  4GX5 A;  3D3I A;  3LSQ A;  3FB5 C;  3P30 A;  3GWO A;  5IDJ A;  2XAG A;  3ZRW A;  4I9W A;  2OTL V;  1HWY A;  2CK3 G;  2QE7 G;  1VQ9 V;  1DLB A;  5CBF A;  4LP8 A;  4JYB A;  3JD0 A;  2YSU B;  2WLL A;  1RM1 C;  4JTD B;  5B1A C;  3W7W A;  1PNL A;  4R8C A;  1W2B U;  1COW G;  1M90 W;  1FXK C;  1JPX A;  3FYI B;  1CPY A;  1GMG A;  5EC1 C;  3ASN C;  1YJW V;  1I5X A;  1VQN V;  3ASO B;  5CMU A;  3QNE A;  3FKS G;  5B1B C;  4MVO A;  5KA5 A;  3EFF K;  2WLN A;  1G8M A;  1QR8 A;  3E8F A;  2ZR3 A;  3B77 A;  2BOB C;  3ZN0 A;  3K06 A;  1GK9 A;  5L3D A;  4U7N A;  1VQM V;  1GM9 A;  5J9P C;  2HVJ C;  1VQO V;  2LFS A;  2EIJ C;  1TUE B;  4LCU C;  2IH1 C;  2OT5 A;  3SPC A;  3FB7 C;  2DW4 A;  3AEI A;  1K5Q A;  1NVP D;  2OCC C;  1AI7 A;  3T1C A;  1QR9 A;  2DYS B;  1FXH A;  1OCR B;  2LFR A;  3F7V C;  2ZQM A;  1V55 B;  5B1O A;  1NH2 B;  2Z5U A;  1EFR G;  2PI5 A;  2DYR C;  1JJ2 U;  1S3J A;  3HPL C;  2B1I A;  2H8P C;  3H01 A;  4JAS A;  1MSW D;  4QPK A;  2R9R B;  3AG2 B;  3ABK C;  3CCQ V;  5KUK A;  1P7B A;  4I5S A;  3R65 A;  4UUJ C;  3JD3 A;  3OAA G;  4J9Z B;  5IY5 C;  1K97 A;  3GB7 C;  3SPI A;  1AJQ A;  3ABU A;  4JAV A;  5LGU A;  4R7C A;  1NKD A;  4XBF A;  3OE7 G;  4UV8 A;  1PKX A;  3E8B A;  1F4M A;  4MTG A;  4MVM A;  1M1K W;  4WFG A;  5C93 A;  2P67 A;  1DF5 A;  3PJS K;  4N23 A;  3CCJ V;  2XOK G;  1SER A;  2HR3 A;  1K8A W;  4BIZ A;  1S76 D;  4HAM A;  1ROP A;  5IYD O;  1VQK V;  1JX9 A;  3ZN1 A;  2JEX A;  2WAM A;  1V54 B;  4RQF A;  1MG1 A;  1VQ6 V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...