1KD1W

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1kd1W00
1KD1W 1N8RW 1YIJV 1KQSU 1M90W 3I55V 3CC2V 3CCLV 3OW2U 2D3OW 1VQNV 4WFBV 1R73A 2OTLV 1VQ9V 1YITV 1K8AW 1YHQV 1S72V 1NJIW 1VQ6V 2QA4V 3CCVV 1Q81W 3CMEV 1VQLV 1VQMV 1M1KW 1K73W 3CPWU 3CCRV 3CCUV 1W2BU 1Q86W 1VQ8V 3CXCU 1JJ2U 1VQ7V 4WCEV 3CCQV 2QEXV 1QVGU 2OTJV 3CD6V 3CCEV 1YJ9V 3CCMV 1YJWV 4WF9V 4WFAV 5DM6V 1VQ5V 1YJNV 3CCSV 1VQPV 1KC8W 1Q7YW 1Q82W 3CMAV 3CCJV 3G4SV 3CC7V 3I56V 3CC4V 1VQOV 1VQ4V 3G71V 1QVFU 1K9MW 3G6EV 1VQKV 1YI2V
chains in the Genus database with same CATH superfamily
1S0VA 2FB5A 1SF9A 4TSFG 2EILC 2IJJA 4JAUA 1JJOA 1K4DC 2VRZA 3W7UA 1HNZO 1YJWV 2DMXA 2XUMA 1MG1A 5JJJB 1W0KG 2YC0A 2OCHA 4DR6B 4DW0A 1L0NH 4DV2O 3ZJZA 2Y69B 1L1FA 4DV0B 3AG2C 4LFBO 4U3JA 2JDIG 1VF5B 1HNWO 2FTKA 1GRJA 2CGOA 1XNRO 2YIBA 4DV6O 3CRCA 1SQBH 4H37A 3UO3A 1Z5WA 2UU9O 1KKCA 3FKSG 1LUWA 4O4HB 3ETGA 2ADPA 3CJHB 3L73H 3SPGA 2DN9A 4I0XB 3HPLC 4I55A 3ABKB 2F93B 3MHSC 1V55C 4JI2O 2CDYA 2PI5A 1VQPV 4ZOLA 4JI5O 4JI3O 1AR5A 2UXBB 2CH7A 2F23A 2P67A 2DWDC 4UV8A 2HKOA 1M57C 2W6IG 4NTWA 2B5UA 5BR8B 1K8AW 3ABMB 3SYOA 2Z0AA 5LMNB 2VWKA 1FXKC 1K3EA 3BA9A 5FNVB 1OCRB 1AJNA 4DYLA 2Z3YA 1M56B 4X9QA 3K03A 5JJNB 3A0HZ 3IJ4A 1MSDA 1GH6A 4X1IB 5H5NA 4LF4B 5KHJA 4G27B 4JI1O 5LP6B 3I55V 5J2TA 4JYAO 2CE4A 1N33B 3RVZA 3JSLA 4GZRB 3O65A 4D7TA 2AXTZ 2QDOA 1M93A 2E76B 1ROPA 2ZXWC 3R66A 1XHZA 3SJQC 3HKCB 4BR6A 4I9QA 4MT8A 3CP1A 3IGAC 3JATB 1HNZB 3UT5A 1HR0B 5CBGA 1Q6HA 3FAVB 1M90W 4LFAB 5H9CA 1R6TA 2F4VO 4I50B 2WAMA 1TUBA 4LFBB 4DV4O 2CTQA 4NTYA 1H8EG 4F6EA 3ZMUA 2L35A 5JH7B 1X4TA 3U0ZA 4P30A 1KMIZ 2UUBO 3ZHUA 4X88A 4GKKO 4J42A 2JGDA 1JA8A 3L9DA 1ZL8A 3LNMB 3T1HB 5IJ9A 3MDSA 4BIUA 4X1YB 2H8PC 2Q7HA 3VQVA 1AP5A 3B4SA 5ITZB 3K58A 4WBNB 3ASNB 3ZHTA 4UVAA 4TOIA 4DRXB 2PF4E 4LCUC 3C90A 2CTWA 5BZBA 4PDLA 4I4TB 3BRCA 3ASOB 2PYJA 3BA8A 4X65B 5CA0A 1FJGB 1OCOB 5IYZB 1KKDA 3HKDB 3K08A 1J5EO 1OHHG 1N0JA 5IY5C 1V54B 3A0BZ 4DV1O 2RN9A 5JWPA 1F51A 2IH3C 3ZBHA 3FYIB 3ZRVA 1MA1A 4HNAB 4YXWG 2LO1A 2EULA 3K5OA 1AJQA 1K9MW 1Y4MA 1NT2B 3D36C 5FPOA 2Q7GA 2QWPB 4GUNA 4XDJA 2D3OW 1B04A 3D8CA 1FFTB 1BSMA 4QPJA 3ABUA 4B08A 1N34O 4KHPO 4FLUA 4PA7A 2Q0AA 1NU1H 2W0FC 2F4VB 4UCVA 5EK0A 4B3MO 4DUYB 4FLYA 4U7OA 3WB1A 1BQ0A 2BTQB 2QWNB 3K5LA 4J7JA 1QLEC 5GONA 4PA3A 5H2FZ 4DV7B 2XAFA 4OX9O 4PV1B 3H1KH 3FD9A 4LF7B 1S77D 1BZKA 4CS3A 4GX0A 3RYHB 4FFBA 3CXHF 4MVRA 4NXNO 1NTZH 1M5IA 5IT9N 3H1JH 5JVDA 5BY1A 4F6RA 4Q6GA 4JI4O 1WAZA 4O4LA 3FB5C 5CBFA 3RT3C 3H1HH 2Q67A 3P30A 1I08A 2ZIMA 4PA6A 5FLXN 4YHHB 3AG3C 3H01A 3NXSA 2E5LB 3RYCB 3HKBA 2IH1C 3JALB 1RM1B 5LGNA 4DK0A 1H38A 4PD4F 1VEWA 2LFSA 2Q6AA 4W4LA 5JCOA 2BSKB 1IBLO 4X64O 4TV8A 1PNKA 3TXQA 3SYPA 2MK3A 2A3QA 1VMGA 3CCJV 1NS1A 4X20A 1MABG 1Q3EA 3K0DA 3T1YB 4MTOA 3ZRXA 2YEVA 2XAQA 1IBKO 1GN4A 1K4CC 3AEIA 5B5EZ 3K06A 1P7GA 2CK3G 5B1NA 3OGIB 1YZBA 3CEIA 2WLKA 5DM6V 1N34B 3MD0A 2Y69C 4JI0B 3ZRWB 3WU2Z 5CBHA 2UUCB 2N04A 3BCCH 4XBFA 1RSOB 2YUAA 1YCIA 3OW2U 1WA8B 2NN4A 1MSWD 2JIZG 1K5SA 4ZHQA 3PJSK 4FLTA 4DUZO 1FD9A 4NTXA 1MMMA 4FPPA 4YY3B 1XMQB 4AQYO 4OX9B 1N0NA 5EYPB 2WPDG 5B3SB 3OR7C 2Q69A 3LSSA 2YSUB 2DE0X 2Q8VA 1S3JA 3ZHQA 3OTOB 1TAEA 3ABKC 1XNQO 1VQ9V 1LR1A 3E8FA 1S72V 4TQDA 4UCOA 1IVSA 1SQQH 3L72H 4FLVA 2AGAA 2QSAA 4NXMO 2QEXV 1NVPB 1BQZA 1YTFB 2QKCA 3E86A 1GN2A 1GN3A 1YXBA 3STLC 2P5OA 3SR2C 3ABMC 3A2FA 4EB6B 4UUJC 1I5XA 3VQYA 1VIBA 4O4IA 2DQ0A 4LFCB 3BHPA 1OCRC 1BE3H 1M56C 4IHJA 5DECA 1QU7A 3A0RA 4MVOA 1MZEA 3CE2A 1URFA 1XMOB 5KMGB 1BHAA 2W0XA 4UCUA 5B1AB 3WFVA 5LP6C 3E22B 2JGUA 1JVMA 1AI6A 2CAZC 4DR2B 3RW0A 3APOA 3U11A 1SC5B 1VF6A 4FM0A 4GYCB 4ZI7B 4O2BA 3ABLB 1JJ2U 4UVBA 4IGGA 1GTOA 4DO2A 5LHGA 2UUAO 1I5YA 1GN6A 3LSQA 3HKEB 4KFMA 2JJ2G 1Q90D 5JJEB 3CYOA 4PI2A 3S3XA 2E75B 3E8BA 1WJZA 4UFZA 3F5TA 3DSQA 4MTGA 3N27A 4J41A 4FLXA 4NYKA 1PL4A 1GM7A 3ZHRA 3QO7A 4IL6Z 4MW3A 1G6UA 2RJZA 3BAAA 3DXRB 3CC2V 4IYIA 1R73A 4O2AB 4LF9O 1AI4A 3OMNB 1SQVH 4AI8A 1HNXO 2QE7G 1JPXA 4O4JB 1KP3A 1XNQB 4J10A 2DQ3A 1NTKH 4LWSB 4JV5O 3D3QA 3ASNC 5FL7G 3EVKA 3F7YC 2XAGA 2VS0A 4G28B 1F4NA 2BOBC 1R3KC 4GX5A 1JMKC 1VQ6V 1M1KW 1AR4A 4B7EA 1FPOA 1F4MA 3QO8A 4JTAB 1JFFA 1JOYA 4K0KO 4WCEV 4DW1A 1R3IC 4PI0A 4DR7O 4DR1B 1OCOC 4CS2A 4FM2A 2ZD9A 2YIAA 4LNUB 2FYUH 4PHZA 1ENVA 2GSMB 2M6YA 4YJ2B 1YDXA 1NI8A 3CC4V 2XHBA 3G71V 3TGUH 3P3PA 1GMGA 4OGQB 4MVZA 1V54C 4K8ZA 4UCRA 2CTPA 1QNMA 2FL4A 1S5LZ 2QA4V 4DV3O 1VQMV 1XI1A 2OIGA 3N2GA 3AG1B 4R8CA 5LA6B 4GKJB 3CCEV 2V4DA 3B8MA 5C8YA 1I0HA 2KQXA 2HVJC 1LNQA 1O9HA 4R6ZA 5CA1B 5L3DA 4FLWA 1OCCB 3TK1A 4LH6A 4H0LB 4X62O 1Y74A 2AZ2A 2IBZH 2BCCH 2QM8A 3CCVV 2PZSA 3BEHA 5KA6A 1ZSPA 1V9PA 4K3AA 3K9SA 3BVOA 4B3SO 3RYFB 1KC8W 1EN6A 2QWOB 5A9GA 1E1RG 4FVMA 4QE9A 1Q8IA 2BTOA 1VQ4V 3VOUA 2P90A 1R6KA 3JAWA 3B40A 2VWJA 4JF3A 3ML0A 3M8AA 5LYJB 2HEPA 1I94O 4FJCC 1K33A 3GWKC 2ZM6O 4X66O 1K97A 3JARB 4IIJA 1FKAO 1H2GA 4CH3A 2YICA 4JZ2A 3JD3A 1KBHA 4JV5B 4B3RB 1K7DA 2R70A 4I4TA 1N8RW 5HFLA 2EIMB 1IBMO 3CMEV 1IURA 3OT7A 2WA4A 1TUEB 5LMUO 1AR1B 2Q7EA 2WLIB 2XT9A 2ZNIA 4DV5O 1RM1C 3I56V 4PA9A 1Q6IA 1WNSA 4MS2A 1KD1W 3P32A 2XTAA 5EBLC 1P84F 3OEHG 2YI8A 2UXDO 3APQA 5IJ0B 4JYBA 5L3FA 5LL6Y 3RWRD 5KHIA 1TVKA 3SGIA 3EFFK 1S5HC 5L3EA 3LUTB 2LQTA 2ETNA 4PDRA 4QNHB 1PPJH 5E1AC 1W59A 1Z2GA 5CB4B 2WLLA 3G80A 1BMFG 5EZYA 3F7VC 2XNDG 3E35A 2WSSG 3Q4HB 4NB5A 4DV2B 3IC7A 1W2BU 1ZUQA 2E74B 2R9AA 4Q20A 5LOVA 5K1XA 1PL0A 5IE9A 2HHHO 3JD2A 1HNWB 2QWRB 3MHHC 1XNRB 3GWOA 5KUKA 4CC5A 3N2KA 4DV6B 4B3SB 2ZE8A 4GX2A 1AP6A 2UU9B 3SPJA 3FB7C 3QO5A 3K04A 4UV9A 1SA0A 3E2EA 1VP7A 2N74A 1THZA 2H94A 3FB6C 4ZKIA 2ATKC 2MW2B 2KKWA 3ICXA 4U3JB 3SPCA 1OV9A 3CMAV 1NH2D 4TUYA 4LF8O 2YXYA 1KQSU 2ZT9B 5DN6G 4JI2B 3TJTA 4JI5B 5B1OA 2EJRA 4JI3B 3F5WC 1FXKA 2GBOA 4YIOA 1HP8A 1SZXA 1Q86W 1SQFA 2V1DA 1KB9F 1IBMB 4ABMA 4JI8O 1DGSA 3C3TA 2QM4A 5CMUA 2DJVA 4EFEA 1EN5A 4I55B 1P4RA 3CSXA 3WG7B 4GT1A 4JI7O 4Z1VA 1COWG 3WB2A 3CRMA 4JI6O 2N05A 4ZOLB 5IWAO 2CH7B 1N36O 3CCUV 5B1AC 1JCHA 4JI1B 4LBEC 2B1IA 4JYAB 3CRQA 4X1KA 3TXSA 3H9VA 4MVQA 2ZKOA 2HLDG 3B2EE 1VARA 4IYHA 1QR8A 4J11A 3STZC 3KZIZ 3J80N 2PYLA 2Q0OC 2LJ2A 1EZVH 4IT5A 3UCSC 5J2TB 1CPYA 2AHYA 2IW5A 2LW1A 1P7BA 4DV4B 4XDLA 1D5AA 3K3WA 1FS0G 5C93A 5H6QA 4KP4A 1XDCA 3ZRSA 4GCZA 2OTLV 3RN4A 2VQFO 1SESA 4OPAA 1NJIW 4CH6A 3J81N 1KUQA 2UUBB 3UT5B 1GK9A 1WP7A 4GKKB 3LDEA 1K92A 3EXAA 2HR3A 4D7SA 3JD0A 5KHHA 1TUBB 2DWEC 2R9IA 5EIBC 2P4VA 4FZ1A 4FFKA 3WB0A 4J7KA 4BW9A 4B3TO 2K9PA 4DR3O 1L8DA 5KAFZ 2OYQA 4EB6A 1OZ0A 3UKMA 1IXMA 1SQPH 4YIPA 4DR4O 4KL1A 3RYIA 4BIZA 3E8HA 2X6CA 1M9NA 2JGDB 3ETQA 1US6A 4JI8B 1NR7A 1ZL8B 3LDDA 4UCSA 5IJ9B 5EIBD 2VQEO 2UXNA 3R65A 2RMKB 1WPBA 1WN7A 3G67A 3JSNA 4QE7A 4PA4A 4JI6B 3CCQV 3CD6V 4BIOA 1J5EB 5IWAB 2O57A 1T5EA 3L70H 4DV1B 2JRIA 4ASUG 4ZI7A 2CTRA 3D36A 4DR5O 4HZ3A 3JD4A 2A9HA 3A8TA 1YIJV 5EC1C 5LXTA 3AG1C 1X59A 1RP3B 3ZMZA 2EINB 3ZMVA 1GKFA 1DK1A 5CA0B 5J2UA 2WWWA 2OT5A 2YIDA 3CCMV 1BS3A 2EBOA 1H2LA 1G1XB 5LHHA 2X0LA 3LDCA 4KHPB 2ZXWB 1OCCC 4UB8Z 4JAAA 2LW7A 3AG4B 3VBBA 1Y76A 4P9OA 4B3MB 1A32A 1L0LH 4HAMA 2GUZA 1NBMG 1YEWA 1VQLV 1BT8A 2ADQB 1XEQA 2JS3A 1K73W 1XHXA 2LP7A 1KP2A 3DXRA 4BW5A 4H13B 2E3CA 3B77A 2IU0A 4TV9A 3AK1A 1B3QA 1YSCA 2DYRB 5GW7A 5KHKA 3ZS8C 2QM7A 4N21A 3JASA 5TISZ 4NXNB 2B1GA 1H2MA 2Y4TA 4B7KA 4CBCA 5JQGA 5KX5A 4J80A 1AILA 4JI4B 5GONB 1XREA 4DR4B 2EIMC 5J9PC 2HJDA 1AI5A 3P3NA 5IYBO 5BMVA 4CC6A 2PI4A 2KG7A 3FFQA 4HYOA 1XOUA 1LUVA 4FFBB 3ZN1A 3TETA 1GM8A 4G2KA 3W7SA 2V7QG 5LHIA 1HW7A 5GTHZ 3CCRV 2WLJA 2YDEA 1QLNA 1JX9A 5JVDB 1XL6A 3K5MA 4E4EA 4F6RB 1R1BA 1IBLB 4X64B 3G6BA 4O4LB 1DTOA 2EX3A 4MTXA 4BAYA 1PD3A 1TA8A 4WFGA 1R6NA 2IU3A 3VQWA 4UVCA 1WB8A 4CH5A 3ZHVA 3HKBB 1H2NA 2A06H 5KAIZ 1IBKB 2HP8A 2R72A 1NR1A 2ITCC 3ZCCA 4XDKA 4NKGB 4JYYA 4CS4A 3G6EV 4X8AA 4TV8B 3ZEDA 3W7WA 3IC9A 3ZN0A 1F7YA 4QGPA 3CCLV 5EC2C 3K79A 4YJ3B 1B06A 2PY5A 4X20B 3OR6C 1Q6UA 1ZTEA 2YEVB 4O4HA 4DR6O 1ZLZA 1RFYA 4TT3G 3CJHA 4DV0O 4DUZB 4JZGA 3SYQA 1UFIA 1GAXA 4I0XA 5D5QA 5L3BA 4MSWC 3IAYA 3BPZA 4LH7A 4I7ZB 4AQYB 1G4YB 3JARA 1VQNV 4FK5C 1N32O 3HB3B 3CX5F 1VQ8V 4NVPA 1K5QA 3M99B 4J7ZA 4UXNA 3T1CA 4NXMB 2GTAA 2AW9A 1AI7A 3THOA 2EZPA 5FNVA 1PP9H 2YI9A 1SQXH 4JGSA 5CN0A 3ASOC 1EZJA 4C7UA 3CXCU 2UXBO 4X1IA 1BL8A 5LP6A 2ZR3A 4EFBA 5BR8O 5LMNO 4ICGA 3AG3B 3JAKB 1WPXA 1AVMA 1Y6XA 3HKCA 1IZ3A 3CPWU 3OE7G 3ZHSA 3JATA 4O4IB 4CH4A 3FAVA 4PDVA 2WLHA 4LF4O 1YF2A 4IHJB 2DW4A 1N33O 4I50A 3K9AA 2UUAB 4W4KA 3W7XA 3AK2A 3JAMN 1XL4A 1SZTA 3X2QB 3OM3B 2UXXA 3H1IH 5D5PA 5JH7A 1HWYA 2WLMA 2NNUA 1ZX3A 3RGBA 1HR0O 4WF9V 4BWAA 4JTCB 1XILA 4R7CA 3CCSV 4LFAO 4J9ZB 4P9PA 1QQCA 3LNNA 3M7MX 4O2BB 3BFRA 1VQOV 2F95B 3IFXA 3RVYA 2DYSB 1PKXA 4X1YA 2PTMA 1BGYH 1ZWIC 5ITZA 4U7NA 4LF9B 4WBNA 1N32B 3J7AU 1SQGA 4DRXA 1HNXB 3O9OA 2HVKC 2P4KA 2XAJA 1QVFU 3SYCA 3SJBC 4PELA 4LC1A 3T1HO 3OEEG 1RPRA 5F2VO 1ORQC 3JCZA 3KCYA 4FZ0A 2OTJV 1GM9A 5IYZA 3B8NA 3HKDA 5E79Z 2OWOA 2B9ZA 4K0KB 1CXZB 1EFRG 1KYOF 5EBMC 4QIWF 2JEUA 4RWUA 4DR7B 5IYDO 1YI2V 1F23A 4WFBV 2EIJB 1CP9A 4HNAA 1IDSA 1QR9A 3ABTA 3UQ8A 4X65O 1FJGO 3OGCC 4DV3B 5LGTA 1WP8A 4RUEA 2ZE5A 4GLXA 4LF5O 1VF7A 1JFFB 2Z5UA 2C2AA 2EINC 3RFRA 2ZDIC 1FFXB 5L3CA 2A0LA 1IX9A 1Y67A 1N4CA 5KHGA 2ARHA 2BTQA 5IDJA 2RNBA 4X62B 1KECA 4GX1A 3AG4C 1MOFA 2QKSA 4MW8A 2Q4PA 1MZFA 2HG5C 1OCZB 3ETDA 1NZ6A 4HBNA 2JK5C 3N2GB 5LGUA 3E8GA 1MNGA 2EIKB 4CZZA 2F1MA 4UB6Z 5B1BB 5C8YB 2CUGA 3RYHA 1KU9A 4H33A 4DUYO 2QJ1A 2OCCB 2RQ6A 3EHBB 3K0GA 2ZE7A 1WB7A 3ZMTA 3FB8C 1YJ9V 5B3SC 3TCUA 1Y74B 1I94B 4MVUA 4Z2WA 4QJFB 2DYRC 2HJFC 2ZM6B 2AZ0A 4RUFA 4X66B 1E1QG 1I7FA 3KG2A 2F43G 2AHZA 5KLVH 4DV7O 4FMTA 1AJPA 4LF7O 4JTDB 3OMAB 1NTMH 4KXRA 5L3GA 3T4ZA 1VQ7V 3RYCA 3OUSA 2P06A 3JAWB 3JALA 3OD4A 3QG5A 4ZBMA 5LMUB 2Q5ZA 2XAHA 2BSKA 4DV5B 4IIJB 5AG2A 2QTOA 1O9GA 4K8XA 1S5JA 1RPOA 4YHHO 1NVPD 1YTFD 5B66Z 2E5LO 2UXDB 4LF6O 4LR3A 2RCVA 3GVMA 2LFRA 2ZDIA 1XQ8A 3K57A 1TGOA 2M7WA 4LF5B 4P2ZA 3ABLC 3CWBH 1YHQV 4DXWA 2YS8A 2ZE6A 3ZRWA 1BCCH 5JCOC 2GDSA 1HDJA 2DOSA 1SS3A 1AB3A 3T1YO 3E89A 1RSOA 4I9WA 3DTUB 2EILB 4L8JA 1WA8A 3QF7A 1PNLA 1FAFA 1Z5VA 1TVKB 4MVSA 2HHHB 3SJCC 2X6AA 2Q68A 2JJ1G 3UM7A 4EEQA 3FYEB 5EYPA 4WFFA 4FIPC 4U3FH 2WLLB 4JI0O 3AG2B 4JASA 2UUCO 5EZYB 3MAQA 3RBZA 2L6LA 2A7WA 3VQXA 2JEXA 2G38A 3G4SV 4QPKA 3LSUA 2YXLA 3BY6A 5LOVB 2ZQMA 3ZIAG 3NR7A 3QNEA 1QCEA 1M4UA 2IJHA 2ILMA 4PJ0Z 4TWKA 1YITV 2KB1A 4YY3O 1XMQO 2R9RB 3N2KB 4LF8B 3KKYA 1R3JC 2X7RB 1EN4A 1DF5A 3C3SA 1SA0B 3JCUZ 3OTOO 2WA3A 3L74H 4UCTA 4F4LA 1Q7YW 1VQ5V 1V55B 1NKDA 1SETA 4H44B 5KMGA 1GO3F 5CA3A 4TUYB 4J9YB 4JI7B 3CHXA 1M57B 3E22A 2QR4A 1JQ0A 1FXKB 1N36B 1R3LC 4LFCO 2QWQB 3L71H 3CC7V 4LF6B 3JYCA 2Y0PA 3SPIA 1SRYA 1XMOO 4JAVA 3AK3A 3OMIB 4ZIBA 3OAAG 1IXBA 3HKEA 1SERA 4Z1MG 3OUFA 1K34A 4YJ3A 1D2DA 4DR2O 4TQFA 2NLJC 1Y66A 3X2QC 2FKXA 4X1KB 3JD1A 3OFNG 3OTFA 2IJIA 4AILC 1B6QA 1BHBA 3W7TA 3B09A 4D6TH 2JS5A 3E83A 1VF6C 4LP8A 2VQFB 2Y48A 2IJKA 1YVWA 2DYSC 2ZCEA 1WLEA 4RAIA 4O2AA 1NH2B 4O4JA 3DC6A 3ZX6A 2XOKG 1PNMA 4LWSA 2UXCO 1Q81W 1XBLA 2JVDA 4B3TB 1QVGU 1S76D 3AG7A 2Y4UA 4DR3B 3SDLA 3CS5A 1G8MA 1NQTA 2P6JA 4I5SA 1FYJA 1DLBA 2LGWA 4KUMA 2WLNA 2GTSA 1VQKV 4JYCA 4PDMA 1D5NA 4FM1A 1PV0A 2NR5A 2PGGA 4LNUA 2W6JG 2GV9A 5KUMA 4YJ2A 2VQEB 2X6BA 1EBOA 2QTSA 3T4DA 3JAKA 2GHYA 3SJAC 2YXHA 2QKAA 4JPRA 1UJWB 3CB2A 4NR1A 2EIJC 3K5NA 2OIEA 3DC5A 1OJHA 2K1EA 3RYIB 2KSDA 5LA6A 4N23A 2P22C 5FPRA 3D3IA 4DR1O 4DR5B 1U97A 4WFEA 1U96A 5CA1A 5HFMA 3S3WA 2FMLA 5IY5B 1DF4A 2BOCC 2ODMA 5A2QN 4MVMA 3CRRA 1H2SB 3HR0A 3KCXA 2CGNA 1FXHA 3GB7C 4E2LA 2ZNJA 1PM9A 4WFHA 4DK1A 4GKJO 2D2CB 3RYFA 2EJ7A 4MTFA 1OCZC 5LXTB 5LBQA 2ZIOA 2EZOA 4AHCA 1SKVA 3CRAA 2EIKC 5B1BC 5J2UB 3UO2A 1Q82W 1Q5OA 5LYJA 4RQFA 2HFEC 1AROP 2Y0IA 5K1PA 5KA5A 3SPHA 4X89A 2OCCC 2F66C 1Y76B 1E79G 2UXCB 3K59A 2GUZB 3QVNA 1QLEB 3H1LH 5DEDA 2Q9LA 3PN1A 4ZHQB 1JR9A 1H2KA 2H3OA 5H6RA 2PUSA 1UPGA 2ZINA 1EM1A 3SYAA 2Q73A 5EBWC 5GTIZ 2WLIA 2RDCA 4OXSA 4TV9B 1W0JG 1ZAUA 2IM9A 3U10A 4OPHA 2LGQA 2ZR2A 4RQEA 4R50A 1QBZA 4K35A 2BE3A 3ZMSA 4B3RO 3WG7C 3FX7A 4RO2A 1YJNV 1J95A 1Q43A 3JASB 3L75H 4FLZA 2XASA 2YIBD 5IJ0A 5KX5B 3DGEA 5JQGB 5IYCO 2ITDC 3BABA 1QHTA 2A79B 5BXZA 3QTCA 5BMVB 1FFXA 2KG7B 2P7TC 1FXVA 5CB4A 4A5UB 4WFAV 3I5DA 3T2MA 1H8HG 1P49A 2QGNA 1CEZA 3ETEA 3Q4HA 4EKWA 4L87A 1XUQA
chains in the Genus database with same CATH topology
2EIKB 4CZZA 5B1BB 2DQ0A 1S0VA 1OCRC 4TSFG 1M56C 4H33A 3A0RA 2EILC 2IJJA 2OCCB 4JAUA 3EHBB 4MVOA 3K0GA 1K4DC 4UUJC 1OZ0A 3UKMA 3W7UA 1IXMA 3ZMTA 3FB8C 1YJ9V 5B3SC 3TCUA 1YJWV 1BHAA 4BIZA 4MVUA 1MG1A 3E8HA 2X6CA 1M9NA 5B1AB 2DYRC 3WFVA 4QJFB 2HJFC 4RUFA 1E1QG 1W0KG 1NR7A 3KG2A 1JVMA 3LDDA 2F43G 2AHZA 1AI6A 3ZJZA 2Y69B 1L1FA 3AG2C 3RW0A 4FMTA 1AJPA 2UXNA 3R65A 2JDIG 3OMAB 4JTDB 5L3GA 3T4ZA 2FTKA 4QE7A 3ABLB 4PA4A 1JJ2U 1VQ7V 3OUSA 3CCQV 4UVBA 1GTOA 4DO2A 3CD6V 5LHGA 4H37A 1I5YA 4ZBMA 3LSQA 3FKSG 4KFMA 4ASUG 2JJ2G 3D36A 4HZ3A 3JD4A 2XAHA 3ETGA 2A9HA 1YIJV 3CYOA 5EC1C 3E8BA 3AG1C 2QTOA 2EINB 3ZMZA 3ZMVA 1GKFA 3SPGA 3HPLC 4MTGA 2WWWA 1RPOA 1NVPD 1YTFD 3ABKB 1GM7A 2OT5A 3CCMV 2EBOA 3MHSC 3QO7A 4MW3A 5LHHA 1V55C 2X0LA 3LDCA 2PI5A 2ZXWB 1VQPV 1OCCC 2LFRA 2ZDIA 3AG4B 3VBBA 2P67A 2DWDC 2M7WA 2HKOA 4P9OA 4UV8A 1M57C 2W6IG 4HAMA 3CC2V 4P2ZA 1NBMG 2B5UA 1R73A 3ABLC 1AI4A 3ABMB 1YHQV 3SYOA 3OMNB 1K8AW 4DXWA 1VQLV 1K73W 1FXKC 1K3EA 3ZRWA 2QE7G 1JPXA 1OCRB 1KP3A 2LP7A 1KP2A 2DQ3A 1AJNA 2Z3YA 4BW5A 1M56B 3E89A 4I9WA 3DTUB 2EILB 5FL7G 3ASNC 3K03A 3B77A 2IU0A 1PNLA 3F7YC 2XAGA 4MVSA 1YSCA 2DYRB 2X6AA 4G27B 2Q68A 2JJ1G 3I55V 5GW7A 4G28B 1F4NA 2BOBC 1R3KC 3UM7A 2QM7A 4GX5A 3RVZA 1VQ6V 3FYEB 4N21A 1M1KW 1F4MA 4WFFA 2B1GA 3QO8A 4FIPC 4JTAB 2WLLB 1JOYA 1ROPA 3AG2B 4JASA 2ZXWC 4CBCA 4WCEV 1R3IC 3RBZA 1OCOC 2ZD9A 2JEXA 3SJQC 1ENVA 2GSMB 3G4SV 4QPKA 3CC4V 4MT8A 3CP1A 2EIMC 3IGAC 5J9PC 3BY6A 3G71V 1AI5A 5IYBO 1GMGA 2ZQMA 4MVZA 3ZIAG 1V54C 3QNEA 5CBGA 2PI4A 1QCEA 2IJHA 4HYOA 1M90W 5H9CA 3ZN1A 4TWKA 3TETA 1YITV 2KB1A 1GM8A 4G2KA 3W7SA 2QA4V 2V7QG 5LHIA 2R9RB 1VQMV 2WAMA 1R3JC 3CCRV 2WLJA 1QLNA 1JX9A 3AG1B 2X7RB 4R8CA 3CCEV 1DF5A 1H8EG 3B8MA 1XL6A 3ZMUA 1Q7YW 2HVJC 4F4LA 1LNQA 4R6ZA 1DTOA 4P30A 4MTXA 5L3DA 4BAYA 1V55B 1PD3A 1VQ5V 1NKDA 1SETA 4WFGA 1OCCB 1R6NA 4X88A 2IU3A 1GO3F 3TK1A 4UVCA 5CA3A 4J9YB 2QM8A 3CCVV 1M57B 3BEHA 5KA6A 1JQ0A 1NR1A 2ITCC 3LNMB 3ZCCA 4BIUA 1FXKB 2H8PC 1R3LC 4XDKA 1KC8W 3CC7V 1E1RG 4QE9A 3JYCA 1VQ4V 3G6EV 4X8AA 3VOUA 3ASNB 3ZN0A 3W7WA 2P90A 4UVAA 3SPIA 1SRYA 1R6KA 3CCLV 5EC2C 4JAVA 4JF3A 3ML0A 3K79A 4LCUC 4FJCC 5BZBA 1K33A 3OMIB 3OAAG 3OR6C 4PDLA 1SERA 2YEVB 4Z1MG 1K97A 3ASOB 4TT3G 3OUFA 1H2GA 1K34A 3JD3A 3SYQA 2NLJC 5L3BA 1OCOB 4MSWC 1Y66A 3X2QC 1K7DA 1N8RW 1KKDA 1G4YB 3JD1A 5HFLA 3OFNG 1VQNV 2IJIA 3K08A 1B6QA 2EIMB 3W7TA 1OHHG 4FK5C 1BHBA 5IY5C 3CMEV 1V54B 3E83A 3HB3B 1TUEB 1VQ8V 1AR1B 4LP8A 1F51A 2IH3C 3FYIB 3ZRVA 2Y48A 2IJKA 2WLIB 1K5QA 3M99B 2DYSC 1WLEA 4RAIA 4UXNA 3T1CA 1RM1C 4YXWG 3I56V 4PA9A 1AJQA 1NH2B 1K9MW 1AI7A 2EZPA 1Y4MA 4MS2A 1KD1W 3P32A 5EBLC 2XOKG 4XDJA 2D3OW 1PNMA 3OEHG 4JGSA 1FFTB 5CN0A 4QPJA 3ASOC 1Q81W 1EZJA 3ABUA 4JYBA 5L3FA 3CXCU 4PA7A 1QVGU 1S76D 3EFFK 1S5HC 5L3EA 2W0FC 1BL8A 5EK0A 2ZR3A 4U7OA 1G8MA 1NQTA 2P6JA 3LUTB 4I5SA 4PDRA 1DLBA 4QNHB 5E1AC 4KUMA 2WLNA 2WLLA 1VQKV 4JYCA 4PDMA 3AG3B 1BMFG 3F7VC 1WPXA 2XNDG 3E35A 2WSSG 1QLEC 2W6JG 4PA3A 5KUMA 3IC7A 3CPWU 3OE7G 1W2BU 2XAFA 4Q20A 2X6BA 1EBOA 3T4DA 1S77D 1PL0A 4GX0A 2GHYA 2WLHA 4PDVA 3JD2A 4JPRA 1UJWB 2DW4A 3MHHC 3GWOA 2EIJC 5KUKA 4MVRA 3K9AA 2K1EA 4GX2A 4N23A 3W7XA 3SPJA 3FB7C 3QO5A 1XL4A 3K04A 4UV9A 1SZTA 3D3IA 3X2QB 3E2EA 3OM3B 2UXXA 1THZA 4WFEA 2H94A 1HWYA 2WLMA 3FB6C 5HFMA 2NNUA 3FB5C 4ZKIA 5CBFA 4WF9V 5IY5B 2ATKC 2Q67A 3P30A 1DF4A 4JTCB 2BOCC 4PA6A 4MVMA 4R7CA 3SPCA 3CCSV 4J9ZB 3AG3C 4P9PA 3CMAV 3H01A 3NXSA 1NH2D 1VQOV 3IFXA 3RVYA 2DYSB 2IH1C 1PKXA 1FXHA 1KQSU 1RM1B 5LGNA 5DN6G 3GB7C 4E2LA 4WFHA 5B1OA 2EJRA 1H38A 3F5WC 1FXKA 2LFSA 2Q6AA 4MTFA 1Q86W 2V1DA 1ZWIC 1OCZC 5LBQA 4U7NA 2EZOA 1PNKA 3SYPA 5CMUA 2MK3A 2EIKC 5B1BC 2HVKC 1Q82W 3CCJV 1P4RA 1MABG 4RQFA 2HFEC 3WG7B 2XAJA 4GT1A 1AROP 1QVFU 3K0DA 3SYCA 4MTOA 5KA5A 1COWG 3SPHA 4X89A 2OCCC 2YEVA 3ZRXA 2XAQA 4PELA 4LC1A 1K4CC 3AEIA 3OEEG 3CCUV 1RPRA 5B1AC 3K06A 1JCHA 4LBEC 1ORQC 3JCZA 1E79G 2B1IA 2CK3G 2OTJV 5B1NA 1GM9A 1QLEB 5DM6V 2WLKA 3B8NA 3MD0A 2Y69C 4MVQA 3ZRWB 5CBHA 1EFRG 5EBMC 4QIWF 2JEUA 2HLDG 5IYDO 1YI2V 4XBFA 5H6RA 3OW2U 3SYAA 1F23A 4WFBV 1QR8A 2EIJB 5EBWC 2WLIA 1CP9A 3STZC 4OXSA 1MSWD 1W0JG 2JIZG 1K5SA 1QR9A 3PJSK 3ABTA 2ZR2A 4RQEA 4R50A 4FPPA 1QBZA 3ZMSA 3OGCC 3WG7C 1CPYA 2AHYA 4RO2A 5LGTA 1YJNV 2IW5A 1J95A 4RUEA 2WPDG 1P7BA 2XASA 5B3SB 3OR7C 4XDLA 2Q69A 2C2AA 2EINC 2YSUB 2Z5UA 3K3WA 1FS0G 3LSSA 5C93A 3DGEA 2ZDIC 5IYCO 5H6QA 4KP4A 5L3CA 1S3JA 2ITDC 3ZRSA 2A0LA 3ABKC 4GCZA 2OTLV 1VQ9V 2A79B 1SESA 3E8FA 1S72V 1NJIW 1GK9A 5IDJA 2QEXV 2P7TC 1NVPB 1FXVA 1KECA 4GX1A 1YTFB 3AG4C 3LDEA 1MOFA 1K92A 2QKSA 4WFAV 4MW8A 3T2MA 1H8HG 2HR3A 3E86A 3JD0A 2HG5C 1OCZB 3ETDA 1CEZA 2JK5C 3ETEA 2DWEC 2R9IA 3STLC 4EKWA 3ABMC 4L87A 5LGUA 3E8GA 1I5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KD1 W;  1N8R W;  1YIJ V;  1KQS U;  1M90 W;  3I55 V;  3CC2 V;  3CCL V;  3OW2 U;  2D3O W;  1VQN V;  4WFB V;  1R73 A;  2OTL V;  1VQ9 V;  1YIT V;  1K8A W;  1YHQ V;  1S72 V;  1NJI W;  1VQ6 V;  2QA4 V;  3CCV V;  1Q81 W;  3CME V;  1VQL V;  1VQM V;  1M1K W;  1K73 W;  3CPW U;  3CCR V;  3CCU V;  1W2B U;  1Q86 W;  1VQ8 V;  3CXC U;  1JJ2 U;  1VQ7 V;  4WCE V;  3CCQ V;  2QEX V;  1QVG U;  2OTJ V;  3CD6 V;  3CCE V;  1YJ9 V;  3CCM V;  1YJW V;  4WF9 V;  4WFA V;  5DM6 V;  1VQ5 V;  1YJN V;  3CCS V;  1VQP V;  1KC8 W;  1Q7Y W;  1Q82 W;  3CMA V;  3CCJ V;  3G4S V;  3CC7 V;  3I56 V;  3CC4 V;  1VQO V;  1VQ4 V;  3G71 V;  1QVF U;  1K9M W;  3G6E V;  1VQK V;  1YI2 V; 
#chains in the Genus database with same CATH topology
 1S0V A;  2FB5 A;  1SF9 A;  4TSF G;  2EIL C;  2IJJ A;  4JAU A;  1JJO A;  1K4D C;  2VRZ A;  3W7U A;  1HNZ O;  1YJW V;  2DMX A;  2XUM A;  1MG1 A;  5JJJ B;  1W0K G;  2YC0 A;  2OCH A;  4DR6 B;  4DW0 A;  1L0N H;  4DV2 O;  3ZJZ A;  2Y69 B;  1L1F A;  4DV0 B;  3AG2 C;  4LFB O;  4U3J A;  2JDI G;  1VF5 B;  1HNW O;  2FTK A;  1GRJ A;  2CGO A;  1XNR O;  2YIB A;  4DV6 O;  3CRC A;  1SQB H;  4H37 A;  3UO3 A;  1Z5W A;  2UU9 O;  1KKC A;  3FKS G;  1LUW A;  4O4H B;  3ETG A;  2ADP A;  3CJH B;  3L73 H;  3SPG A;  2DN9 A;  4I0X B;  3HPL C;  4I55 A;  3ABK B;  2F93 B;  3MHS C;  1V55 C;  4JI2 O;  2CDY A;  2PI5 A;  1VQP V;  4ZOL A;  4JI5 O;  4JI3 O;  1AR5 A;  2UXB B;  2CH7 A;  2F23 A;  2P67 A;  2DWD C;  4UV8 A;  2HKO A;  1M57 C;  2W6I G;  4NTW A;  2B5U A;  5BR8 B;  1K8A W;  3ABM B;  3SYO A;  2Z0A A;  5LMN B;  2VWK A;  1FXK C;  1K3E A;  3BA9 A;  5FNV B;  1OCR B;  1AJN A;  4DYL A;  2Z3Y A;  1M56 B;  4X9Q A;  3K03 A;  5JJN B;  3A0H Z;  3IJ4 A;  1MSD A;  1GH6 A;  4X1I B;  5H5N A;  4LF4 B;  5KHJ A;  4G27 B;  4JI1 O;  5LP6 B;  3I55 V;  5J2T A;  4JYA O;  2CE4 A;  1N33 B;  3RVZ A;  3JSL A;  4GZR B;  3O65 A;  4D7T A;  2AXT Z;  2QDO A;  1M93 A;  2E76 B;  1ROP A;  2ZXW C;  3R66 A;  1XHZ A;  3SJQ C;  3HKC B;  4BR6 A;  4I9Q A;  4MT8 A;  3CP1 A;  3IGA C;  3JAT B;  1HNZ B;  3UT5 A;  1HR0 B;  5CBG A;  1Q6H A;  3FAV B;  1M90 W;  4LFA B;  5H9C A;  1R6T A;  2F4V O;  4I50 B;  2WAM A;  1TUB A;  4LFB B;  4DV4 O;  2CTQ A;  4NTY A;  1H8E G;  4F6E A;  3ZMU A;  2L35 A;  5JH7 B;  1X4T A;  3U0Z A;  4P30 A;  1KMI Z;  2UUB O;  3ZHU A;  4X88 A;  4GKK O;  4J42 A;  2JGD A;  1JA8 A;  3L9D A;  1ZL8 A;  3LNM B;  3T1H B;  5IJ9 A;  3MDS A;  4BIU A;  4X1Y B;  2H8P C;  2Q7H A;  3VQV A;  1AP5 A;  3B4S A;  5ITZ B;  3K58 A;  4WBN B;  3ASN B;  3ZHT A;  4UVA A;  4TOI A;  4DRX B;  2PF4 E;  4LCU C;  3C90 A;  2CTW A;  5BZB A;  4PDL A;  4I4T B;  3BRC A;  3ASO B;  2PYJ A;  3BA8 A;  4X65 B;  5CA0 A;  1FJG B;  1OCO B;  5IYZ B;  1KKD A;  3HKD B;  3K08 A;  1J5E O;  1OHH G;  1N0J A;  5IY5 C;  1V54 B;  3A0B Z;  4DV1 O;  2RN9 A;  5JWP A;  1F51 A;  2IH3 C;  3ZBH A;  3FYI B;  3ZRV A;  1MA1 A;  4HNA B;  4YXW G;  2LO1 A;  2EUL A;  3K5O A;  1AJQ A;  1K9M W;  1Y4M A;  1NT2 B;  3D36 C;  5FPO A;  2Q7G A;  2QWP B;  4GUN A;  4XDJ A;  2D3O W;  1B04 A;  3D8C A;  1FFT B;  1BSM A;  4QPJ A;  3ABU A;  4B08 A;  1N34 O;  4KHP O;  4FLU A;  4PA7 A;  2Q0A A;  1NU1 H;  2W0F C;  2F4V B;  4UCV A;  5EK0 A;  4B3M O;  4DUY B;  4FLY A;  4U7O A;  3WB1 A;  1BQ0 A;  2BTQ B;  2QWN B;  3K5L A;  4J7J A;  1QLE C;  5GON A;  4PA3 A;  5H2F Z;  4DV7 B;  2XAF A;  4OX9 O;  4PV1 B;  3H1K H;  3FD9 A;  4LF7 B;  1S77 D;  1BZK A;  4CS3 A;  4GX0 A;  3RYH B;  4FFB A;  3CXH F;  4MVR A;  4NXN O;  1NTZ H;  1M5I A;  5IT9 N;  3H1J H;  5JVD A;  5BY1 A;  4F6R A;  4Q6G A;  4JI4 O;  1WAZ A;  4O4L A;  3FB5 C;  5CBF A;  3RT3 C;  3H1H H;  2Q67 A;  3P30 A;  1I08 A;  2ZIM A;  4PA6 A;  5FLX N;  4YHH B;  3AG3 C;  3H01 A;  3NXS A;  2E5L B;  3RYC B;  3HKB A;  2IH1 C;  3JAL B;  1RM1 B;  5LGN A;  4DK0 A;  1H38 A;  4PD4 F;  1VEW A;  2LFS A;  2Q6A A;  4W4L A;  5JCO A;  2BSK B;  1IBL O;  4X64 O;  4TV8 A;  1PNK A;  3TXQ A;  3SYP A;  2MK3 A;  2A3Q A;  1VMG A;  3CCJ V;  1NS1 A;  4X20 A;  1MAB G;  1Q3E A;  3K0D A;  3T1Y B;  4MTO A;  3ZRX A;  2YEV A;  2XAQ A;  1IBK O;  1GN4 A;  1K4C C;  3AEI A;  5B5E Z;  3K06 A;  1P7G A;  2CK3 G;  5B1N A;  3OGI B;  1YZB A;  3CEI A;  2WLK A;  5DM6 V;  1N34 B;  3MD0 A;  2Y69 C;  4JI0 B;  3ZRW B;  3WU2 Z;  5CBH A;  2UUC B;  2N04 A;  3BCC H;  4XBF A;  1RSO B;  2YUA A;  1YCI A;  3OW2 U;  1WA8 B;  2NN4 A;  1MSW D;  2JIZ G;  1K5S A;  4ZHQ A;  3PJS K;  4FLT A;  4DUZ O;  1FD9 A;  4NTX A;  1MMM A;  4FPP A;  4YY3 B;  1XMQ B;  4AQY O;  4OX9 B;  1N0N A;  5EYP B;  2WPD G;  5B3S B;  3OR7 C;  2Q69 A;  3LSS A;  2YSU B;  2DE0 X;  2Q8V A;  1S3J A;  3ZHQ A;  3OTO B;  1TAE A;  3ABK C;  1XNQ O;  1VQ9 V;  1LR1 A;  3E8F A;  1S72 V;  4TQD A;  4UCO A;  1IVS A;  1SQQ H;  3L72 H;  4FLV A;  2AGA A;  2QSA A;  4NXM O;  2QEX V;  1NVP B;  1BQZ A;  1YTF B;  2QKC A;  3E86 A;  1GN2 A;  1GN3 A;  1YXB A;  3STL C;  2P5O A;  3SR2 C;  3ABM C;  3A2F A;  4EB6 B;  4UUJ C;  1I5X A;  3VQY A;  1VIB A;  4O4I A;  2DQ0 A;  4LFC B;  3BHP A;  1OCR C;  1BE3 H;  1M56 C;  4IHJ A;  5DEC A;  1QU7 A;  3A0R A;  4MVO A;  1MZE A;  3CE2 A;  1URF A;  1XMO B;  5KMG B;  1BHA A;  2W0X A;  4UCU A;  5B1A B;  3WFV A;  5LP6 C;  3E22 B;  2JGU A;  1JVM A;  1AI6 A;  2CAZ C;  4DR2 B;  3RW0 A;  3APO A;  3U11 A;  1SC5 B;  1VF6 A;  4FM0 A;  4GYC B;  4ZI7 B;  4O2B A;  3ABL B;  1JJ2 U;  4UVB A;  4IGG A;  1GTO A;  4DO2 A;  5LHG A;  2UUA O;  1I5Y A;  1GN6 A;  3LSQ A;  3HKE B;  4KFM A;  2JJ2 G;  1Q90 D;  5JJE B;  3CYO A;  4PI2 A;  3S3X A;  2E75 B;  3E8B A;  1WJZ A;  4UFZ A;  3F5T A;  3DSQ A;  4MTG A;  3N27 A;  4J41 A;  4FLX A;  4NYK A;  1PL4 A;  1GM7 A;  3ZHR A;  3QO7 A;  4IL6 Z;  4MW3 A;  1G6U A;  2RJZ A;  3BAA A;  3DXR B;  3CC2 V;  4IYI A;  1R73 A;  4O2A B;  4LF9 O;  1AI4 A;  3OMN B;  1SQV H;  4AI8 A;  1HNX O;  2QE7 G;  1JPX A;  4O4J B;  1KP3 A;  1XNQ B;  4J10 A;  2DQ3 A;  1NTK H;  4LWS B;  4JV5 O;  3D3Q A;  3ASN C;  5FL7 G;  3EVK A;  3F7Y C;  2XAG A;  2VS0 A;  4G28 B;  1F4N A;  2BOB C;  1R3K C;  4GX5 A;  1JMK C;  1VQ6 V;  1M1K W;  1AR4 A;  4B7E A;  1FPO A;  1F4M A;  3QO8 A;  4JTA B;  1JFF A;  1JOY A;  4K0K O;  4WCE V;  4DW1 A;  1R3I C;  4PI0 A;  4DR7 O;  4DR1 B;  1OCO C;  4CS2 A;  4FM2 A;  2ZD9 A;  2YIA A;  4LNU B;  2FYU H;  4PHZ A;  1ENV A;  2GSM B;  2M6Y A;  4YJ2 B;  1YDX A;  1NI8 A;  3CC4 V;  2XHB A;  3G71 V;  3TGU H;  3P3P A;  1GMG A;  4OGQ B;  4MVZ A;  1V54 C;  4K8Z A;  4UCR A;  2CTP A;  1QNM A;  2FL4 A;  1S5L Z;  2QA4 V;  4DV3 O;  1VQM V;  1XI1 A;  2OIG A;  3N2G A;  3AG1 B;  4R8C A;  5LA6 B;  4GKJ B;  3CCE V;  2V4D A;  3B8M A;  5C8Y A;  1I0H A;  2KQX A;  2HVJ C;  1LNQ A;  1O9H A;  4R6Z A;  5CA1 B;  5L3D A;  4FLW A;  1OCC B;  3TK1 A;  4LH6 A;  4H0L B;  4X62 O;  1Y74 A;  2AZ2 A;  2IBZ H;  2BCC H;  2QM8 A;  3CCV V;  2PZS A;  3BEH A;  5KA6 A;  1ZSP A;  1V9P A;  4K3A A;  3K9S A;  3BVO A;  4B3S O;  3RYF B;  1KC8 W;  1EN6 A;  2QWO B;  5A9G A;  1E1R G;  4FVM A;  4QE9 A;  1Q8I A;  2BTO A;  1VQ4 V;  3VOU A;  2P90 A;  1R6K A;  3JAW A;  3B40 A;  2VWJ A;  4JF3 A;  3ML0 A;  3M8A A;  5LYJ B;  2HEP A;  1I94 O;  4FJC C;  1K33 A;  3GWK C;  2ZM6 O;  4X66 O;  1K97 A;  3JAR B;  4IIJ A;  1FKA O;  1H2G A;  4CH3 A;  2YIC A;  4JZ2 A;  3JD3 A;  1KBH A;  4JV5 B;  4B3R B;  1K7D A;  2R70 A;  4I4T A;  1N8R W;  5HFL A;  2EIM B;  1IBM O;  3CME V;  1IUR A;  3OT7 A;  2WA4 A;  1TUE B;  5LMU O;  1AR1 B;  2Q7E A;  2WLI B;  2XT9 A;  2ZNI A;  4DV5 O;  1RM1 C;  3I56 V;  4PA9 A;  1Q6I A;  1WNS A;  4MS2 A;  1KD1 W;  3P32 A;  2XTA A;  5EBL C;  1P84 F;  3OEH G;  2YI8 A;  2UXD O;  3APQ A;  5IJ0 B;  4JYB A;  5L3F A;  5LL6 Y;  3RWR D;  5KHI A;  1TVK A;  3SGI A;  3EFF K;  1S5H C;  5L3E A;  3LUT B;  2LQT A;  2ETN A;  4PDR A;  4QNH B;  1PPJ H;  5E1A C;  1W59 A;  1Z2G A;  5CB4 B;  2WLL A;  3G80 A;  1BMF G;  5EZY A;  3F7V C;  2XND G;  3E35 A;  2WSS G;  3Q4H B;  4NB5 A;  4DV2 B;  3IC7 A;  1W2B U;  1ZUQ A;  2E74 B;  2R9A A;  4Q20 A;  5LOV A;  5K1X A;  1PL0 A;  5IE9 A;  2HHH O;  3JD2 A;  1HNW B;  2QWR B;  3MHH C;  1XNR B;  3GWO A;  5KUK A;  4CC5 A;  3N2K A;  4DV6 B;  4B3S B;  2ZE8 A;  4GX2 A;  1AP6 A;  2UU9 B;  3SPJ A;  3FB7 C;  3QO5 A;  3K04 A;  4UV9 A;  1SA0 A;  3E2E A;  1VP7 A;  2N74 A;  1THZ A;  2H94 A;  3FB6 C;  4ZKI A;  2ATK C;  2MW2 B;  2KKW A;  3ICX A;  4U3J B;  3SPC A;  1OV9 A;  3CMA V;  1NH2 D;  4TUY A;  4LF8 O;  2YXY A;  1KQS U;  2ZT9 B;  5DN6 G;  4JI2 B;  3TJT A;  4JI5 B;  5B1O A;  2EJR A;  4JI3 B;  3F5W C;  1FXK A;  2GBO A;  4YIO A;  1HP8 A;  1SZX A;  1Q86 W;  1SQF A;  2V1D A;  1KB9 F;  1IBM B;  4ABM A;  4JI8 O;  1DGS A;  3C3T A;  2QM4 A;  5CMU A;  2DJV A;  4EFE A;  1EN5 A;  4I55 B;  1P4R A;  3CSX A;  3WG7 B;  4GT1 A;  4JI7 O;  4Z1V A;  1COW G;  3WB2 A;  3CRM A;  4JI6 O;  2N05 A;  4ZOL B;  5IWA O;  2CH7 B;  1N36 O;  3CCU V;  5B1A C;  1JCH A;  4JI1 B;  4LBE C;  2B1I A;  4JYA B;  3CRQ A;  4X1K A;  3TXS A;  3H9V A;  4MVQ A;  2ZKO A;  2HLD G;  3B2E E;  1VAR A;  4IYH A;  1QR8 A;  4J11 A;  3STZ C;  3KZI Z;  3J80 N;  2PYL A;  2Q0O C;  2LJ2 A;  1EZV H;  4IT5 A;  3UCS C;  5J2T B;  1CPY A;  2AHY A;  2IW5 A;  2LW1 A;  1P7B A;  4DV4 B;  4XDL A;  1D5A A;  3K3W A;  1FS0 G;  5C93 A;  5H6Q A;  4KP4 A;  1XDC A;  3ZRS A;  4GCZ A;  2OTL V;  3RN4 A;  2VQF O;  1SES A;  4OPA A;  1NJI W;  4CH6 A;  3J81 N;  1KUQ A;  2UUB B;  3UT5 B;  1GK9 A;  1WP7 A;  4GKK B;  3LDE A;  1K92 A;  3EXA A;  2HR3 A;  4D7S A;  3JD0 A;  5KHH A;  1TUB B;  2DWE C;  2R9I A;  5EIB C;  2P4V A;  4FZ1 A;  4FFK A;  3WB0 A;  4J7K A;  4BW9 A;  4B3T O;  2K9P A;  4DR3 O;  1L8D A;  5KAF Z;  2OYQ A;  4EB6 A;  1OZ0 A;  3UKM A;  1IXM A;  1SQP H;  4YIP A;  4DR4 O;  4KL1 A;  3RYI A;  4BIZ A;  3E8H A;  2X6C A;  1M9N A;  2JGD B;  3ETQ A;  1US6 A;  4JI8 B;  1NR7 A;  1ZL8 B;  3LDD A;  4UCS A;  5IJ9 B;  5EIB D;  2VQE O;  2UXN A;  3R65 A;  2RMK B;  1WPB A;  1WN7 A;  3G67 A;  3JSN A;  4QE7 A;  4PA4 A;  4JI6 B;  3CCQ V;  3CD6 V;  4BIO A;  1J5E B;  5IWA B;  2O57 A;  1T5E A;  3L70 H;  4DV1 B;  2JRI A;  4ASU G;  4ZI7 A;  2CTR A;  3D36 A;  4DR5 O;  4HZ3 A;  3JD4 A;  2A9H A;  3A8T A;  1YIJ V;  5EC1 C;  5LXT A;  3AG1 C;  1X59 A;  1RP3 B;  3ZMZ A;  2EIN B;  3ZMV A;  1GKF A;  1DK1 A;  5CA0 B;  5J2U A;  2WWW A;  2OT5 A;  2YID A;  3CCM V;  1BS3 A;  2EBO A;  1H2L A;  1G1X B;  5LHH A;  2X0L A;  3LDC A;  4KHP B;  2ZXW B;  1OCC C;  4UB8 Z;  4JAA A;  2LW7 A;  3AG4 B;  3VBB A;  1Y76 A;  4P9O A;  4B3M B;  1A32 A;  1L0L H;  4HAM A;  2GUZ A;  1NBM G;  1YEW A;  1VQL V;  1BT8 A;  2ADQ B;  1XEQ A;  2JS3 A;  1K73 W;  1XHX A;  2LP7 A;  1KP2 A;  3DXR A;  4BW5 A;  4H13 B;  2E3C A;  3B77 A;  2IU0 A;  4TV9 A;  3AK1 A;  1B3Q A;  1YSC A;  2DYR B;  5GW7 A;  5KHK A;  3ZS8 C;  2QM7 A;  4N21 A;  3JAS A;  5TIS Z;  4NXN B;  2B1G A;  1H2M A;  2Y4T A;  4B7K A;  4CBC A;  5JQG A;  5KX5 A;  4J80 A;  1AIL A;  4JI4 B;  5GON B;  1XRE A;  4DR4 B;  2EIM C;  5J9P C;  2HJD A;  1AI5 A;  3P3N A;  5IYB O;  5BMV A;  4CC6 A;  2PI4 A;  2KG7 A;  3FFQ A;  4HYO A;  1XOU A;  1LUV A;  4FFB B;  3ZN1 A;  3TET A;  1GM8 A;  4G2K A;  3W7S A;  2V7Q G;  5LHI A;  1HW7 A;  5GTH Z;  3CCR V;  2WLJ A;  2YDE A;  1QLN A;  1JX9 A;  5JVD B;  1XL6 A;  3K5M A;  4E4E A;  4F6R B;  1R1B A;  1IBL B;  4X64 B;  3G6B A;  4O4L B;  1DTO A;  2EX3 A;  4MTX A;  4BAY A;  1PD3 A;  1TA8 A;  4WFG A;  1R6N A;  2IU3 A;  3VQW A;  4UVC A;  1WB8 A;  4CH5 A;  3ZHV A;  3HKB B;  1H2N A;  2A06 H;  5KAI Z;  1IBK B;  2HP8 A;  2R72 A;  1NR1 A;  2ITC C;  3ZCC A;  4XDK A;  4NKG B;  4JYY A;  4CS4 A;  3G6E V;  4X8A A;  4TV8 B;  3ZED A;  3W7W A;  3IC9 A;  3ZN0 A;  1F7Y A;  4QGP A;  3CCL V;  5EC2 C;  3K79 A;  4YJ3 B;  1B06 A;  2PY5 A;  4X20 B;  3OR6 C;  1Q6U A;  1ZTE A;  2YEV B;  4O4H A;  4DR6 O;  1ZLZ A;  1RFY A;  4TT3 G;  3CJH A;  4DV0 O;  4DUZ B;  4JZG A;  3SYQ A;  1UFI A;  1GAX A;  4I0X A;  5D5Q A;  5L3B A;  4MSW C;  3IAY A;  3BPZ A;  4LH7 A;  4I7Z B;  4AQY B;  1G4Y B;  3JAR A;  1VQN V;  4FK5 C;  1N32 O;  3HB3 B;  3CX5 F;  1VQ8 V;  4NVP A;  1K5Q A;  3M99 B;  4J7Z A;  4UXN A;  3T1C A;  4NXM B;  2GTA A;  2AW9 A;  1AI7 A;  3THO A;  2EZP A;  5FNV A;  1PP9 H;  2YI9 A;  1SQX H;  4JGS A;  5CN0 A;  3ASO C;  1EZJ A;  4C7U A;  3CXC U;  2UXB O;  4X1I A;  1BL8 A;  5LP6 A;  2ZR3 A;  4EFB A;  5BR8 O;  5LMN O;  4ICG A;  3AG3 B;  3JAK B;  1WPX A;  1AVM A;  1Y6X A;  3HKC A;  1IZ3 A;  3CPW U;  3OE7 G;  3ZHS A;  3JAT A;  4O4I B;  4CH4 A;  3FAV A;  4PDV A;  2WLH A;  4LF4 O;  1YF2 A;  4IHJ B;  2DW4 A;  1N33 O;  4I50 A;  3K9A A;  2UUA B;  4W4K A;  3W7X A;  3AK2 A;  3JAM N;  1XL4 A;  1SZT A;  3X2Q B;  3OM3 B;  2UXX A;  3H1I H;  5D5P A;  5JH7 A;  1HWY A;  2WLM A;  2NNU A;  1ZX3 A;  3RGB A;  1HR0 O;  4WF9 V;  4BWA A;  4JTC B;  1XIL A;  4R7C A;  3CCS V;  4LFA O;  4J9Z B;  4P9P A;  1QQC A;  3LNN A;  3M7M X;  4O2B B;  3BFR A;  1VQO V;  2F95 B;  3IFX A;  3RVY A;  2DYS B;  1PKX A;  4X1Y A;  2PTM A;  1BGY H;  1ZWI C;  5ITZ A;  4U7N A;  4LF9 B;  4WBN A;  1N32 B;  3J7A U;  1SQG A;  4DRX A;  1HNX B;  3O9O A;  2HVK C;  2P4K A;  2XAJ A;  1QVF U;  3SYC A;  3SJB C;  4PEL A;  4LC1 A;  3T1H O;  3OEE G;  1RPR A;  5F2V O;  1ORQ C;  3JCZ A;  3KCY A;  4FZ0 A;  2OTJ V;  1GM9 A;  5IYZ A;  3B8N A;  3HKD A;  5E79 Z;  2OWO A;  2B9Z A;  4K0K B;  1CXZ B;  1EFR G;  1KYO F;  5EBM C;  4QIW F;  2JEU A;  4RWU A;  4DR7 B;  5IYD O;  1YI2 V;  1F23 A;  4WFB V;  2EIJ B;  1CP9 A;  4HNA A;  1IDS A;  1QR9 A;  3ABT A;  3UQ8 A;  4X65 O;  1FJG O;  3OGC C;  4DV3 B;  5LGT A;  1WP8 A;  4RUE A;  2ZE5 A;  4GLX A;  4LF5 O;  1VF7 A;  1JFF B;  2Z5U A;  2C2A A;  2EIN C;  3RFR A;  2ZDI C;  1FFX B;  5L3C A;  2A0L A;  1IX9 A;  1Y67 A;  1N4C A;  5KHG A;  2ARH A;  2BTQ A;  5IDJ A;  2RNB A;  4X62 B;  1KEC A;  4GX1 A;  3AG4 C;  1MOF A;  2QKS A;  4MW8 A;  2Q4P A;  1MZF A;  2HG5 C;  1OCZ B;  3ETD A;  1NZ6 A;  4HBN A;  2JK5 C;  3N2G B;  5LGU A;  3E8G A;  1MNG A;  2EIK B;  4CZZ A;  2F1M A;  4UB6 Z;  5B1B B;  5C8Y B;  2CUG A;  3RYH A;  1KU9 A;  4H33 A;  4DUY O;  2QJ1 A;  2OCC B;  2RQ6 A;  3EHB B;  3K0G A;  2ZE7 A;  1WB7 A;  3ZMT A;  3FB8 C;  1YJ9 V;  5B3S C;  3TCU A;  1Y74 B;  1I94 B;  4MVU A;  4Z2W A;  4QJF B;  2DYR C;  2HJF C;  2ZM6 B;  2AZ0 A;  4RUF A;  4X66 B;  1E1Q G;  1I7F A;  3KG2 A;  2F43 G;  2AHZ A;  5KLV H;  4DV7 O;  4FMT A;  1AJP A;  4LF7 O;  4JTD B;  3OMA B;  1NTM H;  4KXR A;  5L3G A;  3T4Z A;  1VQ7 V;  3RYC A;  3OUS A;  2P06 A;  3JAW B;  3JAL A;  3OD4 A;  3QG5 A;  4ZBM A;  5LMU B;  2Q5Z A;  2XAH A;  2BSK A;  4DV5 B;  4IIJ B;  5AG2 A;  2QTO A;  1O9G A;  4K8X A;  1S5J A;  1RPO A;  4YHH O;  1NVP D;  1YTF D;  5B66 Z;  2E5L O;  2UXD B;  4LF6 O;  4LR3 A;  2RCV A;  3GVM A;  2LFR A;  2ZDI A;  1XQ8 A;  3K57 A;  1TGO A;  2M7W A;  4LF5 B;  4P2Z A;  3ABL C;  3CWB H;  1YHQ V;  4DXW A;  2YS8 A;  2ZE6 A;  3ZRW A;  1BCC H;  5JCO C;  2GDS A;  1HDJ A;  2DOS A;  1SS3 A;  1AB3 A;  3T1Y O;  3E89 A;  1RSO A;  4I9W A;  3DTU B;  2EIL B;  4L8J A;  1WA8 A;  3QF7 A;  1PNL A;  1FAF A;  1Z5V A;  1TVK B;  4MVS A;  2HHH B;  3SJC C;  2X6A A;  2Q68 A;  2JJ1 G;  3UM7 A;  4EEQ A;  3FYE B;  5EYP A;  4WFF A;  4FIP C;  4U3F H;  2WLL B;  4JI0 O;  3AG2 B;  4JAS A;  2UUC O;  5EZY B;  3MAQ A;  3RBZ A;  2L6L A;  2A7W A;  3VQX A;  2JEX A;  2G38 A;  3G4S V;  4QPK A;  3LSU A;  2YXL A;  3BY6 A;  5LOV B;  2ZQM A;  3ZIA G;  3NR7 A;  3QNE A;  1QCE A;  1M4U A;  2IJH A;  2ILM A;  4PJ0 Z;  4TWK A;  1YIT V;  2KB1 A;  4YY3 O;  1XMQ O;  2R9R B;  3N2K B;  4LF8 B;  3KKY A;  1R3J C;  2X7R B;  1EN4 A;  1DF5 A;  3C3S A;  1SA0 B;  3JCU Z;  3OTO O;  2WA3 A;  3L74 H;  4UCT A;  4F4L A;  1Q7Y W;  1VQ5 V;  1V55 B;  1NKD A;  1SET A;  4H44 B;  5KMG A;  1GO3 F;  5CA3 A;  4TUY B;  4J9Y B;  4JI7 B;  3CHX A;  1M57 B;  3E22 A;  2QR4 A;  1JQ0 A;  1FXK B;  1N36 B;  1R3L C;  4LFC O;  2QWQ B;  3L71 H;  3CC7 V;  4LF6 B;  3JYC A;  2Y0P A;  3SPI A;  1SRY A;  1XMO O;  4JAV A;  3AK3 A;  3OMI B;  4ZIB A;  3OAA G;  1IXB A;  3HKE A;  1SER A;  4Z1M G;  3OUF A;  1K34 A;  4YJ3 A;  1D2D A;  4DR2 O;  4TQF A;  2NLJ C;  1Y66 A;  3X2Q C;  2FKX A;  4X1K B;  3JD1 A;  3OFN G;  3OTF A;  2IJI A;  4AIL C;  1B6Q A;  1BHB A;  3W7T A;  3B09 A;  4D6T H;  2JS5 A;  3E83 A;  1VF6 C;  4LP8 A;  2VQF B;  2Y48 A;  2IJK A;  1YVW A;  2DYS C;  2ZCE A;  1WLE A;  4RAI A;  4O2A A;  1NH2 B;  4O4J A;  3DC6 A;  3ZX6 A;  2XOK G;  1PNM A;  4LWS A;  2UXC O;  1Q81 W;  1XBL A;  2JVD A;  4B3T B;  1QVG U;  1S76 D;  3AG7 A;  2Y4U A;  4DR3 B;  3SDL A;  3CS5 A;  1G8M A;  1NQT A;  2P6J A;  4I5S A;  1FYJ A;  1DLB A;  2LGW A;  4KUM A;  2WLN A;  2GTS A;  1VQK V;  4JYC A;  4PDM A;  1D5N A;  4FM1 A;  1PV0 A;  2NR5 A;  2PGG A;  4LNU A;  2W6J G;  2GV9 A;  5KUM A;  4YJ2 A;  2VQE B;  2X6B A;  1EBO A;  2QTS A;  3T4D A;  3JAK A;  2GHY A;  3SJA C;  2YXH A;  2QKA A;  4JPR A;  1UJW B;  3CB2 A;  4NR1 A;  2EIJ C;  3K5N A;  2OIE A;  3DC5 A;  1OJH A;  2K1E A;  3RYI B;  2KSD A;  5LA6 A;  4N23 A;  2P22 C;  5FPR A;  3D3I A;  4DR1 O;  4DR5 B;  1U97 A;  4WFE A;  1U96 A;  5CA1 A;  5HFM A;  3S3W A;  2FML A;  5IY5 B;  1DF4 A;  2BOC C;  2ODM A;  5A2Q N;  4MVM A;  3CRR A;  1H2S B;  3HR0 A;  3KCX A;  2CGN A;  1FXH A;  3GB7 C;  4E2L A;  2ZNJ A;  1PM9 A;  4WFH A;  4DK1 A;  4GKJ O;  2D2C B;  3RYF A;  2EJ7 A;  4MTF A;  1OCZ C;  5LXT B;  5LBQ A;  2ZIO A;  2EZO A;  4AHC A;  1SKV A;  3CRA A;  2EIK C;  5B1B C;  5J2U B;  3UO2 A;  1Q82 W;  1Q5O A;  5LYJ A;  4RQF A;  2HFE C;  1ARO P;  2Y0I A;  5K1P A;  5KA5 A;  3SPH A;  4X89 A;  2OCC C;  2F66 C;  1Y76 B;  1E79 G;  2UXC B;  3K59 A;  2GUZ B;  3QVN A;  1QLE B;  3H1L H;  5DED A;  2Q9L A;  3PN1 A;  4ZHQ B;  1JR9 A;  1H2K A;  2H3O A;  5H6R A;  2PUS A;  1UPG A;  2ZIN A;  1EM1 A;  3SYA A;  2Q73 A;  5EBW C;  5GTI Z;  2WLI A;  2RDC A;  4OXS A;  4TV9 B;  1W0J G;  1ZAU A;  2IM9 A;  3U10 A;  4OPH A;  2LGQ A;  2ZR2 A;  4RQE A;  4R50 A;  1QBZ A;  4K35 A;  2BE3 A;  3ZMS A;  4B3R O;  3WG7 C;  3FX7 A;  4RO2 A;  1YJN V;  1J95 A;  1Q43 A;  3JAS B;  3L75 H;  4FLZ A;  2XAS A;  2YIB D;  5IJ0 A;  5KX5 B;  3DGE A;  5JQG B;  5IYC O;  2ITD C;  3BAB A;  1QHT A;  2A79 B;  5BXZ A;  3QTC A;  5BMV B;  1FFX A;  2KG7 B;  2P7T C;  1FXV A;  5CB4 A;  4A5U B;  4WFA V;  3I5D A;  3T2M A;  1H8H G;  1P49 A;  2QGN A;  1CEZ A;  3ETE A;  3Q4H A;  4EKW A;  4L87 A;  1XUQ A; 
#chains in the Genus database with same CATH homology
 2EIK B;  4CZZ A;  5B1B B;  2DQ0 A;  1S0V A;  1OCR C;  4TSF G;  1M56 C;  4H33 A;  3A0R A;  2EIL C;  2IJJ A;  2OCC B;  4JAU A;  3EHB B;  4MVO A;  3K0G A;  1K4D C;  4UUJ C;  1OZ0 A;  3UKM A;  3W7U A;  1IXM A;  3ZMT A;  3FB8 C;  1YJ9 V;  5B3S C;  3TCU A;  1YJW V;  1BHA A;  4BIZ A;  4MVU A;  1MG1 A;  3E8H A;  2X6C A;  1M9N A;  5B1A B;  2DYR C;  3WFV A;  4QJF B;  2HJF C;  4RUF A;  1E1Q G;  1W0K G;  1NR7 A;  3KG2 A;  1JVM A;  3LDD A;  2F43 G;  2AHZ A;  1AI6 A;  3ZJZ A;  2Y69 B;  1L1F A;  3AG2 C;  3RW0 A;  4FMT A;  1AJP A;  2UXN A;  3R65 A;  2JDI G;  3OMA B;  4JTD B;  5L3G A;  3T4Z A;  2FTK A;  4QE7 A;  3ABL B;  4PA4 A;  1JJ2 U;  1VQ7 V;  3OUS A;  3CCQ V;  4UVB A;  1GTO A;  4DO2 A;  3CD6 V;  5LHG A;  4H37 A;  1I5Y A;  4ZBM A;  3LSQ A;  3FKS G;  4KFM A;  4ASU G;  2JJ2 G;  3D36 A;  4HZ3 A;  3JD4 A;  2XAH A;  3ETG A;  2A9H A;  1YIJ V;  3CYO A;  5EC1 C;  3E8B A;  3AG1 C;  2QTO A;  2EIN B;  3ZMZ A;  3ZMV A;  1GKF A;  3SPG A;  3HPL C;  4MTG A;  2WWW A;  1RPO A;  1NVP D;  1YTF D;  3ABK B;  1GM7 A;  2OT5 A;  3CCM V;  2EBO A;  3MHS C;  3QO7 A;  4MW3 A;  5LHH A;  1V55 C;  2X0L A;  3LDC A;  2PI5 A;  2ZXW B;  1VQP V;  1OCC C;  2LFR A;  2ZDI A;  3AG4 B;  3VBB A;  2P67 A;  2DWD C;  2M7W A;  2HKO A;  4P9O A;  4UV8 A;  1M57 C;  2W6I G;  4HAM A;  3CC2 V;  4P2Z A;  1NBM G;  2B5U A;  1R73 A;  3ABL C;  1AI4 A;  3ABM B;  1YHQ V;  3SYO A;  3OMN B;  1K8A W;  4DXW A;  1VQL V;  1K73 W;  1FXK C;  1K3E A;  3ZRW A;  2QE7 G;  1JPX A;  1OCR B;  1KP3 A;  2LP7 A;  1KP2 A;  2DQ3 A;  1AJN A;  2Z3Y A;  4BW5 A;  1M56 B;  3E89 A;  4I9W A;  3DTU B;  2EIL B;  5FL7 G;  3ASN C;  3K03 A;  3B77 A;  2IU0 A;  1PNL A;  3F7Y C;  2XAG A;  4MVS A;  1YSC A;  2DYR B;  2X6A A;  4G27 B;  2Q68 A;  2JJ1 G;  3I55 V;  5GW7 A;  4G28 B;  1F4N A;  2BOB C;  1R3K C;  3UM7 A;  2QM7 A;  4GX5 A;  3RVZ A;  1VQ6 V;  3FYE B;  4N21 A;  1M1K W;  1F4M A;  4WFF A;  2B1G A;  3QO8 A;  4FIP C;  4JTA B;  2WLL B;  1JOY A;  1ROP A;  3AG2 B;  4JAS A;  2ZXW C;  4CBC A;  4WCE V;  1R3I C;  3RBZ A;  1OCO C;  2ZD9 A;  2JEX A;  3SJQ C;  1ENV A;  2GSM B;  3G4S V;  4QPK A;  3CC4 V;  4MT8 A;  3CP1 A;  2EIM C;  3IGA C;  5J9P C;  3BY6 A;  3G71 V;  1AI5 A;  5IYB O;  1GMG A;  2ZQM A;  4MVZ A;  3ZIA G;  1V54 C;  3QNE A;  5CBG A;  2PI4 A;  1QCE A;  2IJH A;  4HYO A;  1M90 W;  5H9C A;  3ZN1 A;  4TWK A;  3TET A;  1YIT V;  2KB1 A;  1GM8 A;  4G2K A;  3W7S A;  2QA4 V;  2V7Q G;  5LHI A;  2R9R B;  1VQM V;  2WAM A;  1R3J C;  3CCR V;  2WLJ A;  1QLN A;  1JX9 A;  3AG1 B;  2X7R B;  4R8C A;  3CCE V;  1DF5 A;  1H8E G;  3B8M A;  1XL6 A;  3ZMU A;  1Q7Y W;  2HVJ C;  4F4L A;  1LNQ A;  4R6Z A;  1DTO A;  4P30 A;  4MTX A;  5L3D A;  4BAY A;  1V55 B;  1PD3 A;  1VQ5 V;  1NKD A;  1SET A;  4WFG A;  1OCC B;  1R6N A;  4X88 A;  2IU3 A;  1GO3 F;  3TK1 A;  4UVC A;  5CA3 A;  4J9Y B;  2QM8 A;  3CCV V;  1M57 B;  3BEH A;  5KA6 A;  1JQ0 A;  1NR1 A;  2ITC C;  3LNM B;  3ZCC A;  4BIU A;  1FXK B;  2H8P C;  1R3L C;  4XDK A;  1KC8 W;  3CC7 V;  1E1R G;  4QE9 A;  3JYC A;  1VQ4 V;  3G6E V;  4X8A A;  3VOU A;  3ASN B;  3ZN0 A;  3W7W A;  2P90 A;  4UVA A;  3SPI A;  1SRY A;  1R6K A;  3CCL V;  5EC2 C;  4JAV A;  4JF3 A;  3ML0 A;  3K79 A;  4LCU C;  4FJC C;  5BZB A;  1K33 A;  3OMI B;  3OAA G;  3OR6 C;  4PDL A;  1SER A;  2YEV B;  4Z1M G;  1K97 A;  3ASO B;  4TT3 G;  3OUF A;  1H2G A;  1K34 A;  3JD3 A;  3SYQ A;  2NLJ C;  5L3B A;  1OCO B;  4MSW C;  1Y66 A;  3X2Q C;  1K7D A;  1N8R W;  1KKD A;  1G4Y B;  3JD1 A;  5HFL A;  3OFN G;  1VQN V;  2IJI A;  3K08 A;  1B6Q A;  2EIM B;  3W7T A;  1OHH G;  4FK5 C;  1BHB A;  5IY5 C;  3CME V;  1V54 B;  3E83 A;  3HB3 B;  1TUE B;  1VQ8 V;  1AR1 B;  4LP8 A;  1F51 A;  2IH3 C;  3FYI B;  3ZRV A;  2Y48 A;  2IJK A;  2WLI B;  1K5Q A;  3M99 B;  2DYS C;  1WLE A;  4RAI A;  4UXN A;  3T1C A;  1RM1 C;  4YXW G;  3I56 V;  4PA9 A;  1AJQ A;  1NH2 B;  1K9M W;  1AI7 A;  2EZP A;  1Y4M A;  4MS2 A;  1KD1 W;  3P32 A;  5EBL C;  2XOK G;  4XDJ A;  2D3O W;  1PNM A;  3OEH G;  4JGS A;  1FFT B;  5CN0 A;  4QPJ A;  3ASO C;  1Q81 W;  1EZJ A;  3ABU A;  4JYB A;  5L3F A;  3CXC U;  4PA7 A;  1QVG U;  1S76 D;  3EFF K;  1S5H C;  5L3E A;  2W0F C;  1BL8 A;  5EK0 A;  2ZR3 A;  4U7O A;  1G8M A;  1NQT A;  2P6J A;  3LUT B;  4I5S A;  4PDR A;  1DLB A;  4QNH B;  5E1A C;  4KUM A;  2WLN A;  2WLL A;  1VQK V;  4JYC A;  4PDM A;  3AG3 B;  1BMF G;  3F7V C;  1WPX A;  2XND G;  3E35 A;  2WSS G;  1QLE C;  2W6J G;  4PA3 A;  5KUM A;  3IC7 A;  3CPW U;  3OE7 G;  1W2B U;  2XAF A;  4Q20 A;  2X6B A;  1EBO A;  3T4D A;  1S77 D;  1PL0 A;  4GX0 A;  2GHY A;  2WLH A;  4PDV A;  3JD2 A;  4JPR A;  1UJW B;  2DW4 A;  3MHH C;  3GWO A;  2EIJ C;  5KUK A;  4MVR A;  3K9A A;  2K1E A;  4GX2 A;  4N23 A;  3W7X A;  3SPJ A;  3FB7 C;  3QO5 A;  1XL4 A;  3K04 A;  4UV9 A;  1SZT A;  3D3I A;  3X2Q B;  3E2E A;  3OM3 B;  2UXX A;  1THZ A;  4WFE A;  2H94 A;  1HWY A;  2WLM A;  3FB6 C;  5HFM A;  2NNU A;  3FB5 C;  4ZKI A;  5CBF A;  4WF9 V;  5IY5 B;  2ATK C;  2Q67 A;  3P30 A;  1DF4 A;  4JTC B;  2BOC C;  4PA6 A;  4MVM A;  4R7C A;  3SPC A;  3CCS V;  4J9Z B;  3AG3 C;  4P9P A;  3CMA V;  3H01 A;  3NXS A;  1NH2 D;  1VQO V;  3IFX A;  3RVY A;  2DYS B;  2IH1 C;  1PKX A;  1FXH A;  1KQS U;  1RM1 B;  5LGN A;  5DN6 G;  3GB7 C;  4E2L A;  4WFH A;  5B1O A;  2EJR A;  1H38 A;  3F5W C;  1FXK A;  2LFS A;  2Q6A A;  4MTF A;  1Q86 W;  2V1D A;  1ZWI C;  1OCZ C;  5LBQ A;  4U7N A;  2EZO A;  1PNK A;  3SYP A;  5CMU A;  2MK3 A;  2EIK C;  5B1B C;  2HVK C;  1Q82 W;  3CCJ V;  1P4R A;  1MAB G;  4RQF A;  2HFE C;  3WG7 B;  2XAJ A;  4GT1 A;  1ARO P;  1QVF U;  3K0D A;  3SYC A;  4MTO A;  5KA5 A;  1COW G;  3SPH A;  4X89 A;  2OCC C;  2YEV A;  3ZRX A;  2XAQ A;  4PEL A;  4LC1 A;  1K4C C;  3AEI A;  3OEE G;  3CCU V;  1RPR A;  5B1A C;  3K06 A;  1JCH A;  4LBE C;  1ORQ C;  3JCZ A;  1E79 G;  2B1I A;  2CK3 G;  2OTJ V;  5B1N A;  1GM9 A;  1QLE B;  5DM6 V;  2WLK A;  3B8N A;  3MD0 A;  2Y69 C;  4MVQ A;  3ZRW B;  5CBH A;  1EFR G;  5EBM C;  4QIW F;  2JEU A;  2HLD G;  5IYD O;  1YI2 V;  4XBF A;  5H6R A;  3OW2 U;  3SYA A;  1F23 A;  4WFB V;  1QR8 A;  2EIJ B;  5EBW C;  2WLI A;  1CP9 A;  3STZ C;  4OXS A;  1MSW D;  1W0J G;  2JIZ G;  1K5S A;  1QR9 A;  3PJS K;  3ABT A;  2ZR2 A;  4RQE A;  4R50 A;  4FPP A;  1QBZ A;  3ZMS A;  3OGC C;  3WG7 C;  1CPY A;  2AHY A;  4RO2 A;  5LGT A;  1YJN V;  2IW5 A;  1J95 A;  4RUE A;  2WPD G;  1P7B A;  2XAS A;  5B3S B;  3OR7 C;  4XDL A;  2Q69 A;  2C2A A;  2EIN C;  2YSU B;  2Z5U A;  3K3W A;  1FS0 G;  3LSS A;  5C93 A;  3DGE A;  2ZDI C;  5IYC O;  5H6Q A;  4KP4 A;  5L3C A;  1S3J A;  2ITD C;  3ZRS A;  2A0L A;  3ABK C;  4GCZ A;  2OTL V;  1VQ9 V;  2A79 B;  1SES A;  3E8F A;  1S72 V;  1NJI W;  1GK9 A;  5IDJ A;  2QEX V;  2P7T C;  1NVP B;  1FXV A;  1KEC A;  4GX1 A;  1YTF B;  3AG4 C;  3LDE A;  1MOF A;  1K92 A;  2QKS A;  4WFA V;  4MW8 A;  3T2M A;  1H8H G;  2HR3 A;  3E86 A;  3JD0 A;  2HG5 C;  1OCZ B;  3ETD A;  1CEZ A;  2JK5 C;  3ETE A;  2DWE C;  2R9I A;  3STL C;  4EKW A;  3ABM C;  4L87 A;  5LGU A;  3E8G A;  1I5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...