1KD1W

Co-crystal structure of spiramycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
65
structure length
65
Chain Sequence
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 24
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF00831 Ribosomal_L29 Ribosomal L29 protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.310 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1kd1W00
3CCSV 1YIJV 2D3OW 3I56V 1KD1W 4WF9V 1QVFU 1KQSU 1Q7YW 1M90W 3OW2U 1NJIW 4WFBV 3CCJV 3CCMV 1YI2V 1Q81W 1W2BU 3I55V 1VQMV 1JJ2U 2OTLV 3CXCU 3G71V 3CCLV 3CCRV 1QVGU 3CC7V 1VQ8V 3CMEV 3G6EV 2QEXV 4WCEV 1YITV 3CC2V 5DM6V 3G4SV 1K9MW 1VQNV 1M1KW 1N8RW 1VQ4V 3CMAV 1VQLV 1Q82W 3CPWU 1VQ9V 1Q86W 1R73A 1KC8W 1YJ9V 4WFAV 1YJNV 1YJWV 1S72V 2OTJV 1VQOV 1VQPV 3CD6V 1K73W 3CC4V 3CCUV 3CCVV 1VQ6V 1VQKV 1YHQV 3CCQV 2QA4V 1K8AW 1VQ5V 3CCEV 1VQ7V
chains in the Genus database with same CATH superfamily
4H37A 4D7TA 3OR7C 1EN4A 3D8CA 3WU2Z 5BR8B 3ZMTA 1R6KA 5K1PA 2QE7G 4DV2B 4RQFA 1R1BA 3L75H 4MTFA 2IU0A 2F4VO 1M1KW 1BQ0A 1PKXA 2YXYA 1FAFA 3AK2A 1OHHG 4NTWA 1H2LA 3RYHB 4JAUA 4DV5B 4O4IA 3ZRXA 3Q4HB 4FZ0A 5LP6B 1ZX3A 4FM2A 3BY6A 2VS0A 2ODMA 5JWPA 2PUSA 3OTFA 1IBLB 4IT5A 5LHHA 4JI3O 5LGUA 1XL4A 2IM9A 2JIZG 4J11A 1SZTA 1Q82W 3NR7A 1GN3A 1SKVA 4TV9B 4I0XB 3HR0A 1PL0A 4X8AA 2VRZA 3RFRA 5IJ9B 1XNQO 4HNAA 2P7TC 5CA1B 2CE4A 3G71V 1RPRA 3JAWB 1MMMA 2N74A 2Y0IA 1MZEA 2D2CB 3L73H 3K08A 1XNQB 4GT1A 5FPOA 2O57A 4FLZA 1FFXB 1G4YB 2GBOA 1BL8A 4MTOA 3E89A 1ZLZA 3IAYA 3W7SA 4RAIA 1GMGA 5E79Z 2WLLA 3CXHF 3FFQA 3LSQA 2ZR2A 2ADQB 1F7YA 5IYDO 3J80N 1QR9A 3EFFK 3L70H 3B40A 5LGNA 3OD4A 3K9AA 3L71H 2EIKC 1LUWA 3ICXA 2QA4V 5TISZ 4BIOA 2GV9A 4TQDA 2R9RB 1N36B 2OCHA 1BS3A 2OCCC 3OUFA 1Q6UA 1AVMA 1F51A 1GAXA 4WFFA 2MK3A 1NKDA 4L87A 4G28B 2YIBD 3NXSA 5KHJA 4UXNA 1WPBA 1BCCH 2IJJA 3OTOO 3WFVA 1JFFA 1M56B 1BSMA 3RYCA 1VQNV 4J7ZA 1PNMA 4K8XA 2ITCC 1NH2B 2UXBB 2F95B 4JTDB 5IYBO 5LXTA 3ZHVA 2HR3A 3RVZA 2AHYA 2WLMA 4XBFA 2ZT9B 1Q8IA 1HNWB 2A79B 2NR5A 2YICA 2ZM6O 4NTYA 2ZD9A 4BW9A 4H44B 1NVPD 3E8FA 4X9QA 1KECA 1Q3EA 4TQFA 3K57A 2LP7A 4FMTA 4LFBB 1I5XA 1F23A 2BTQA 3QNEA 3RVYA 4LF7B 5LHIA 1O9GA 3W7WA 1QBZA 1NTKH 2EINC 3RN4A 5J2TA 2HVKC 4HNAB 4UVBA 3K58A 1QLNA 3HPLC 3UM7A 1WB7A 1VEWA 3CC2V 3OMIB 1Q43A 2DN9A 5GONB 4R7CA 1EN6A 2UUBO 3ASNB 4LP8A 2HJDA 3A2FA 1YIJV 4FJCC 2AZ0A 4UCTA 3STLC 1WN7A 1XMQB 1KUQA 1EBOA 3CC7V 2BE3A 2UU9O 4DR3B 5EC2C 1GN4A 1B06A 4UVAA 3ZHRA 1SA0A 5LA6A 3OM3B 4MVSA 4CH6A 4TOIA 2XOKG 1JA8A 5B1OA 5LL6Y 4YIOA 1D5AA 2JEXA 4QNHB 3LNNA 3H1IH 4C7UA 1VIBA 4JYAB 2W0XA 3E8BA 4FLVA 3ABLC 1VQ6V 5CN0A 3TK1A 4LH6A 4PD4F 1XQ8A 5B1NA 5CA0B 3A8TA 2KQXA 4BIZA 4UB6Z 3QVNA 1HWYA 4JPRA 2XTAA 4O4HB 3E22B 3N2GA 1EZJA 1XI1A 1HR0B 3E2EA 5LMNB 1Y6XA 1ENVA 4DUZB 3JD1A 2PGGA 1B04A 4AILC 4J10A 4PA7A 4PV1B 2UU9B 3T4DA 3CMAV 1XDCA 4R8CA 1GM7A 4DV7O 4DR5B 2FYUH 1YVWA 1YF2A 1NI8A 3BRCA 1GH6A 3AK1A 1H38A 2OYQA 1S76D 3BPZA 2GSMB 1GN6A 4CBCA 2K9PA 1X59A 3K0GA 4DV6B 1IVSA 2VQFO 1VMGA 2CTQA 4IL6Z 3GB7C 1EN5A 5B1AB 4YHHB 2DYSC 3IFXA 3JD0A 3VBBA 3JAKB 4CC5A 5ITZA 1DF4A 2B9ZA 2JEUA 1G8MA 2Q6AA 3BEHA 3LDCA 2EILC 2PYJA 4MSWC 1GTOA 2CTRA 4TWKA 2QM7A 3G80A 1GK9A 2UXDB 2GUZB 1FYJA 1VF5B 4LF6B 1ZL8A 4LFAO 3AG4B 3B2EE 5KX5B 3JALB 3FB5C 4DRXA 2CGNA 3RGBA 4B3RO 4DR1B 1GM9A 1IBLO 3MDSA 4XDLA 1QVGU 4IIJA 3CRCA 5H6RA 2ZIOA 3SPGA 3ASOC 2Q7GA 3FYEB 5C8YB 4UCVA 1FXKB 3SGIA 4UB8Z 4DUYB 4JI0O 4X20B 1W59A 2XASA 4I55A 4D6TH 1VF6C 5E1AC 1YHQV 2IJIA 1BMFG 3KCXA 2EZPA 3ZHUA 4DV1O 2B1GA 3ETDA 1IDSA 4QIWF 1IBKB 4O4IB 1ZTEA 2X6CA 4DW1A 2GTAA 2V7QG 4KP4A 4UUJC 4RUEA 5JVDA 4AHCA 3B8NA 4F6RB 1PNKA 4HAMA 3OGCC 4DK0A 4K0KO 3FAVB 3TGUH 1SQVH 2GDSA 3HKBA 1SERA 1ZSPA 1SF9A 4B3TO 4TV8B 3T1HO 2LFSA 3SPHA 2H94A 3FB6C 1ZWIC 3UO3A 1PNLA 1NU1H 1WPXA 2ZE7A 5J9PC 2L35A 2OTJV 3CJHB 3J7AU 1TVKB 4MVZA 4WF9V 1V55C 1LNQA 3RYIB 3JD4A 4I50A 1AR5A 2UXNA 5FNVB 3K0DA 5KUMA 4MVMA 4J7KA 4QPJA 2Q67A 1WB8A 3IC9A 2ZR3A 2JJ2G 4MVUA 3ZJZA 3IJ4A 4LC1A 4CH5A 2JK5C 3K79A 4B7EA 2FL4A 3CP1A 2Q0OC 4O4JA 3L72H 4X64B 4PA3A 1JPXA 3ZRWB 2UXBO 1Y74A 3RYFA 1MNGA 4OPAA 1E79G 3K5OA 3BCCH 1AJPA 1GO3F 4EEQA 1K8AW 3JAWA 4PELA 3JATA 2R72A 4GYCB 1ORQC 4NVPA 4YJ2A 2QWNB 3APOA 4CH3A 2WLIA 4QJFB 1XNRO 2IH3C 4B3MB 2BTQB 1KYOF 4LF9B 4F4LA 3SYCA 1VQPV 3STZC 4TUYA 4X20A 4X64O 5A2QN 4DV3O 5B3SC 1W0KG 1PP9H 4B3SB 2EULA 2OIEA 4OGQB 2ARHA 2A9HA 3CMEV 2RJZA 3S3WA 4RUFA 4KUMA 4ABMA 3E35A 1PM9A 1PL4A 1KKDA 3OMAB 2ITDC 5LYJB 4CZZA 5L3DA 5JCOA 4DV2O 1M93A 4FM1A 2P6JA 3DGEA 4JI7O 4JF3A 3OFNG 5JQGB 4PDVA 1D2DA 5B66Z 1MSWD 2IJHA 3K04A 3SYOA 4WBNB 3HKDA 1YEWA 1XEQA 4FIPC 1Q86W 5CBHA 2JS5A 5IDJA 3F5WC 4HZ3A 1ZAUA 4J7JA 4ZHQA 4UV8A 3TETA 3JCUZ 4ZKIA 3PJSK 4BAYA 3SJCC 3U0ZA 2LO1A 3WG7B 2R9IA 1TAEA 2QKSA 3X2QC 3P32A 2QWQB 1PD3A 4CS2A 3MD0A 4DV5O 4UCSA 2R70A 2WA3A 4I4TA 1THZA 4GKJO 2XAGA 1YJ9V 1R6TA 4X66B 3BA9A 3M7MX 2PI4A 3A0BZ 1CXZB 1X4TA 2D3OW 1M90W 5EBLC 1FJGB 1H2MA 2XAJA 1AP5A 3BHPA 1CP9A 4X1IA 5H2FZ 3OAAG 5CB4A 4GKKB 1N33B 3D36A 1JVMA 1NVPB 5C8YA 2UUCB 1FJGO 2BSKA 2PTMA 3JASB 4Z1VA 4H13B 3ABUA 3ABLB 4O2BB 2K1EA 3UCSC 1WAZA 2WAMA 2Y69C 3AG3B 4JYBA 1ROPA 3B09A 4LFCO 2YEVB 1NR7A 2WA4A 2JRIA 2N04A 2YUAA 2WLIB 4R6ZA 4XDKA 2M7WA 1VQ4V 2P90A 4ICGA 2PF4E 4IIJB 5KHKA 4H0LB 3G6EV 4DV6O 3N2KB 2ZE6A 1MA1A 1L1FA 1K3EA 3H01A 5LOVA 2GHYA 2Z5UA 1OCOC 2YIAA 4ASUG 3HKEA 3ZHSA 5L3CA 3OR6C 5LP6A 4X65B 5KHHA 2Q0AA 5BXZA 2Z3YA 1XHZA 3CRMA 1AJQA 5EBWC 1KB9F 4BIUA 3H1HH 4X65O 1WNSA 4LFBO 1NS1A 1P4RA 2UUAB 4ZHQB 4L8JA 3ZN1A 2BOCC 1V9PA 4IHJA 2YIDA 4DR3O 4JI0B 1M5IA 2UXCB 1N0JA 3HKCA 4J9ZB 4OX9B 4I9QA 4LR3A 4JYCA 1VF6A 4Q20A 1Q81W 2P5OA 1HW7A 3D3IA 3AG7A 4LNUA 4U7OA 1V55B 2EJ7A 1R6NA 4FVMA 4JI8B 4A5UB 5JVDB 4X1IB 2QWRB 4I5SA 4FFBA 3SDLA 3CCQV 2LQTA 1A32A 1VF7A 2DQ0A 2X0LA 3SJBC 4QPKA 1QVFU 2CH7A 4B3RB 4UCOA 1AI7A 4DV0O 2QWOB 1QLEB 1K5QA 4B7KA 1OJHA 4H33A 5DM6V 3ABMB 3JARA 4JTCB 4MW8A 1KC8W 3LSUA 2AGAA 3UT5A 3CD6V 1HNZB 1MSDA 1NR1A 1L0LH 2HVJC 3ZRVA 4B08A 5DECA 4DV4B 2E76B 5BMVB 3JSNA 5KUKA 2KG7A 3CRRA 3CCJV 4JI3B 2RQ6A 4JI6O 2Y4UA 1US6A 4DR7O 2UXDO 2JDIG 4TV9A 2ZDIA 4I0XA 2IBZH 3OMNB 2DMXA 2QDOA 3N2KA 3GVMA 3DTUB 4G27B 1K97A 5KA5A 2KG7B 4LCUC 4U3JA 4RQEA 4K8ZA 4Q6GA 3G6BA 3ABMC 3N2GB 4QE9A 1EZVH 3ABKB 4K3AA 5GTHZ 3CB2A 4JYAO 1XREA 3Q4HA 1P84F 1R3KC 3T1CA 2JGUA 4MVRA 5GW7A 2IH1C 5JH7A 3MHSC 1SC5B 4O4LB 4LFCB 4I50B 4U3FH 5FNVA 4HBNA 2AXTZ 3SYQA 1OCZB 3TXQA 2F4VB 1XMOO 2E74B 4MS2A 1IURA 4DV1B 1W0JG 2AZ2A 4GX2A 1NJIW 5IJ9A 3IGAC 5KLVH 3CCLV 2QEXV 3KKYA 4KL1A 1KP2A 2E3CA 3E8GA 2V4DA 5L3GA 3K5MA 4FM0A 2DWEC 1Y74B 1R3LC 3U11A 4EFBA 2PY5A 4DV4O 2ADPA 1JCHA 3AK3A 5H9CA 4HYOA 2QWPB 5IY5B 4PA4A 5LHGA 1VQLV 2PYLA 3EHBB 1MZFA 3X2QB 4DUYO 4JYYA 1H2SB 2BTOA 5EC1C 1HP8A 2YXLA 1HNXB 1DLBA 2QR4A 3RYIA 1B6QA 1YTFD 2ETNA 4X1KB 3SPIA 1VQMV 1YDXA 1GM8A 4WBNA 3W7UA 1XOUA 2DE0X 2ZIMA 2M6YA 3CEIA 1AILA 1K4CC 2QKCA 5KMGA 4GZRB 4O4JB 1IBMB 2EBOA 2DWDC 1BE3H 2AW9A 4X1YA 1Y76A 1SQPH 1URFA 2ZXWC 4LFAB 1XBLA 5KAFZ 3C3SA 3CPWU 3O9OA 4JI1O 1WA8B 3K3WA 5JCOC 1Y76B 4NXMB 3CWBH 4DUZO 5FLXN 2WLLB 2HG5C 3ZMZA 3CE2A 3ETEA 1XL6A 3ZX6A 4CS4A 1XILA 2F43G 3HB3B 3DC6A 5EYPA 1N4CA 3ZN0A 1OZ0A 2ILMA 2ZM6B 3AG1C 4B3MO 1UJWB 3RYCB 3K5NA 4MTXA 3SYAA 2DOSA 2IJKA 2LW7A 1BQZA 3HKDB 3K5LA 1JMKC 1AI6A 3UKMA 5B1AC 3B77A 4NB5A 1S77D 1GN2A 1OCZC 3I56V 1XMQO 4X62B 2FTKA 2EIMC 3SYPA 1Q5OA 3CJHA 3JASA 2XT9A 4NYKA 2WPDG 3QO7A 1VQ8V 3SR2C 5LYJA 2HHHB 3R66A 5J2UA 1J5EB 4EKWA 5B3SB 1SETA 1J95A 3A0HZ 5LA6B 1AI4A 1IZ3A 4P2ZA 1P7GA 1KMIZ 2G38A 1RM1C 1JR9A 1QQCA 1RSOA 3K06A 4LF8B 4LH7A 4O4HA 5IYCO 2HLDG 4DR2O 3BABA 3JAMN 1TA8A 3CX5F 3FB7C 1OCRC 3MHHC 2QTSA 4JI1B 3JARB 4MTGA 5KA6A 5KHGA 2Q9LA 2YEVA 5L3BA 4IYIA 2E5LB 1COWG 5H5NA 2CK3G 2F1MA 3TCUA 1UFIA 2LGQA 5CA0A 3I55V 2EINB 4LF7O 3W7XA 5HFMA 1MG1A 3JATB 1AR1B 3CYOA 5IYZB 3F7YC 4KHPO 3GWKC 2Q7HA 4ZOLB 5IWAO 1RFYA 3FX7A 3TJTA 1GKFA 4X66O 4U7NA 2XAFA 1QU7A 4Z1MG 1H8EG 2ATKC 3VQXA 1Z5VA 3CCSV 1FXHA 3AG3C 4PDMA 4RWUA 5EIBC 5EZYA 1JJOA 2XHBA 2ZNIA 4GUNA 3ZMSA 5BY1A 4JASA 5F2VO 4FLWA 2E5LO 2P06A 2DYRB 1AJNA 1VARA 4JI2O 3ZHQA 3JCZA 4DV0B 1B3QA 2IU3A 1Q90D 2YIBA 5IT9N 1BHAA 4NR1A 3WG7C 1RP3B 4GLXA 1N34O 3AG1B 1BHBA 3TXSA 3CCMV 3BA8A 5CA3A 5HFLA 2VQFB 2ZCEA 4DW0A 4JI4B 1Q6HA 2JVDA 2DYSB 2YC0A 1E1QG 4DRXB 1F4NA 5DN6G 4DR2B 1H2KA 4PDRA 3CCUV 2C2AA 4PI0A 2Y4TA 1IBMO 1Q7YW 5J2TB 1KBHA 1FPOA 1HR0O 2YI9A 2EIKB 2JGDB 3JD2A 1NH2D 3D36C 3SPCA 2FKXA 2EX3A 5B1BC 2Y69B 1TUEB 1YSCA 2WSSG 1G1XB 2P4KA 4NTXA 5B1BB 2YS8A 1EM1A 1K73W 4LWSA 4IGGA 2A7WA 2FB5A 5L3FA 3R65A 3CCEV 1SESA 4FZ1A 1N32B 1K34A 1NT2B 4F6RA 5ITZB 2H3OA 2EIJC 1FXVA 3E8HA 2Q7EA 4I55B 2WWWA 4LWSB 2OIGA 2OT5A 5FPRA 4W4KA 1N32O 4I9WA 4P9OA 1S0VA 3QO5A 3ZMUA 4BR6A 4K35A 1P49A 2NNUA 2RN9A 3LSSA 1N34B 4WFBV 4E4EA 4ZIBA 3DSQA 4CS3A 1OCOB 1SQGA 4JGSA 2F66C 1AROP 4AQYO 5AG2A 5H6QA 2P67A 1H8HG 2CGOA 2Z0AA 1J5EO 4O2BA 4P30A 2GUZA 3OE7G 3P3PA 3A0RA 3AG2C 1ZL8B 1FXKA 2KB1A 3ZMVA 5IJ0B 4TV8A 4JI5B 4DXWA 5BR8O 2A0LA 4J80A 3O65A 5KAIZ 1YI2V 1PV0A 2EIMB 1K33A 4FK5C 2UUCO 1OCCB 1YTFB 2WLJA 3G4SV 1SQBH 3JSLA 4LF5B 1NQTA 2LJ2A 3H1LH 4MVOA 4JI8O 1QHTA 3QTCA 3H1KH 1VQOV 2YDEA 2QTOA 2ZINA 3CSXA 4AQYB 1P7BA 1LUVA 3H9VA 1TVKA 1K4DC 2ZKOA 3K59A 3HKBB 3F7VC 3RWRD 2UUAO 2X6AA 4DR4B 1RM1B 1FFXA 1CPYA 3ZS8C 2UXXA 1R73A 1Y66A 5J2UB 3VOUA 1GRJA 3VQYA 4PJ0Z 4PI2A 3QF7A 1IXBA 2ZQMA 1VP7A 5CMUA 3EXAA 3N27A 3EVKA 3DXRA 3I5DA 1M9NA 3G67A 2CDYA 2Q5ZA 4WFGA 1K9MW 1YXBA 1M57C 3THOA 3JALA 4UV9A 4X62O 2WLHA 3OUSA 1WP7A 1I0HA 1SA0B 2XAQA 1S5JA 4J41A 2NN4A 2HFEC 1DTOA 1TUBB 2YSUB 1NBMG 1KQSU 2P22C 2W0FC 1I08A 3FB8C 4JI5O 2DJVA 3CXCU 4X1YB 5EIBD 3RT3C 1DF5A 1WP8A 5LBQA 4CH4A 1Q6IA 2QJ1A 4EB6A 4N21A 1I7FA 5IYZA 3UQ8A 1K92A 4P9PA 3T1HB 4ZOLA 4F6EA 3K03A 1HNXO 1KD1W 3UO2A 2YXHA 2IW5A 5CBGA 2EIJB 1JJ2U 2HEPA 3H1JH 4LF4O 4FPPA 4D7SA 4EB6B 4X1KA 2YI8A 1LR1A 4WCEV 3ABKC 2A06H 4O2AA 1VQ9V 4PHZA 4B3TB 3E22A 3T2MA 1S3JA 3FKSG 3ASOB 3ZRWA 4MT8A 4N23A 3E86A 3RYFB 1H2GA 4JI7B 4JAVA 1YITV 3JYCA 2JS3A 5FL7G 4BWAA 5JJJB 3LUTB 1OCRB 3OW2U 5KMGB 4PDLA 4IYHA 4XDJA 1M4UA 3CCRV 1KP3A 1U97A 3RBZA 1AI5A 4YY3B 3AG4C 3F5TA 4TT3G 3C90A 1M56C 3ETGA 2F93B 4UFZA 3WB0A 2RDCA 3T4ZA 2Q68A 1YJNV 2V1DA 4NKGB 1BZKA 4WFHA 2EJRA 3OT7A 3CHXA 4JZGA 1L8DA 1K7DA 2XAHA 1OCCC 4LF8O 1N36O 4J42A 3W7TA 2ZE5A 3DC5A 4PA6A 3GWOA 1T5EA 1SS3A 2PZSA 1SQFA 1DK1A 3ZRSA 5CA1A 4JI4O 4JI6B 3CRAA 1V54B 1I94O 2RNBA 1VQ5V 3ZEDA 2GTSA 4UCRA 2X7RB 4FLUA 2E75B 4YXWG 1EFRG 3LDEA 1W2BU 4JV5B 2Y48A 1JX9A 3BAAA 1N33O 1MOFA 4GKKO 4KHPB 3L74H 2OCCB 3OEHG 4UVCA 2ZXWB 3WB1A 1O9HA 1K5SA 5CB4B 4LF6O 1QNMA 5IY5C 3LNMB 3CCVV 1AR4A 2EILB 4DR6B 2JGDA 3APQA 1F4MA 2WLKA 4KFMA 4GCZA 1IXMA 3AEIA 2L6LA 2VWJA 2H8PC 1WJZA 5LMNO 1U96A 5JJNB 1XMOB 2DW4A 2A3QA 4DV3B 5CBFA 4I4TB 4PA9A 3KZIZ 2LFRA 5K1XA 1ZUQA 3KG2A 1AP6A 2NLJC 4GKJB 2PI5A 1R3IC 3OGIB 3T1YB 1MABG 2MW2B 1XHXA 5IE9A 5L3EA 2HP8A 4YJ2B 3SJAC 1XNRB 1YJWV 3ETQA 3L9DA 1WA8A 4OXSA 3KCYA 4FLTA 4GX1A 1S5HC 2F23A 2VWKA 3HKEB 1RSOB 1QR8A 3ZHTA 2OTLV 2Q8VA 3OEEG 1FKAO 1KU9A 1KKCA 4UCUA 2R9AA 1L0NH 1N8RW 4OPHA 3RYHA 3C3TA 3ML0A 2Q69A 3BVOA 4ZBMA 1AB3A 3P30A 5GTIZ 1VQ7V 1SQQH 3JD3A 5C93A 4DR6O 1Z2GA 1NZ6A 3RW0A 4LBEC 3QG5A 1HDJA 1QCEA 2QKAA 2HHHO 4FFBB 1N0NA 4FLYA 1I5YA 5EK0A 2QSAA 3ZCCA 4X88A 5BZBA 5JH7B 4QE7A 1Y67A 4Z2WA 2RCVA 4W4LA 4R50A 2RMKB 5EZYB 1HNWO 5LOVB 1SRYA 3CRQA 2XUMA 5DEDA 3T1YO 5D5PA 4NXMO 4CC6A 4YY3O 3E83A 4JI2B 3VQWA 3K9SA 1IBKO 3ABTA 4GX0A 1V54C 2QM8A 4IHJB 2HKOA 1D5NA 1TGOA 5A9GA 4DO2A 1VQKV 2Y0PA 1NTZH 2N05A 3SPJA 5B5EZ 2BCCH 4GX5A 3S3XA 4FLXA 1XUQA 4OX9O 2B1IA 2ZNJA 2DQ3A 1G6UA 2W6IG 1QLEC 1Z5WA 1UPGA 2ZE8A 4JTAB 4DK1A 1JOYA 4JZ2A 3ZBHA 1M57B 1Y4MA 1R3JC 4WFEA 3D3QA 2KKWA 4DR7B 3IC7A 4DR4O 4AI8A 4B3SO 4J9YB 3J81N 3LDDA 4BW5A 1FD9A 4G2KA 2CUGA 4LNUB 2OWOA 1FXKC 1SQXH 3CS5A 2LGWA 5JQGA 2JJ1G 1OV9A 3P3NA 3U10A 4U3JB 1IX9A 3WB2A 2FMLA 5IJ0A 3JAKA 5IWAB 2X6BA 1SZXA 3SJQC 5LXTB 5LGTA 4JAAA 3FAVA 3B4SA 4YIPA 3AG2B 4DV7B 4DR5O 4LF5O 5D5QA 1FS0G 4ZI7A 4LF4B 4WFAV 5LMUB 1DGSA 4O4LA 5GONA 5JJEB 1YCIA 2HJFC 2Q73A 3FD9A 3PN1A 2EZOA 4RO2A 3B8MA 4I7ZB 1RPOA 3QO8A 2CAZC 5BMVA 3DXRB 4YJ3A 4QGPA 4ZI7B 2UUBB 1H2NA 1CEZA 2LW1A 2WLNA 1JQ0A 2VQEB 2DYRC 1E1RG 1YZBA 2B5UA 4DYLA 4YJ3B 3OTOB 2KSDA 3VQVA 1WLEA 4EFEA 3CC4V 2VQEO 1TUBA 4NXNB 4TSFG 4MVQA 1S5LZ 4KXRA 5KX5A 3M8AA 3HKCB 3ZIAG 2BSKB 2XNDG 2P4VA 3BFRA 4O2AB 2UXCO 5KHIA 2QGNA 4X89A 4K0KB 4NXNO 2QM4A 2AHZA 4DR1O 1BT8A 3FYIB 4LF9O 2W6JG 4FFKA 1I94B 4MW3A 1HNZO 1PPJH 2Q4PA 3UT5B 3ASNC 4TUYB 5LP6C 1FFTB 2CTPA 3M99B 2CTWA 2BOBC 1NTMH 4JV5O 1S72V 4E2LA 5EBMC 4YHHO 5LMUO 1BGYH 2ZDIC 3MAQA 2CH7B 1JFFB 5EYPB
chains in the Genus database with same CATH topology
1W0JG 4H37A 3OR7C 1NBMG 4GX2A 1KQSU 2W0FC 3FB8C 3ZMTA 1NJIW 2LFSA 3IGAC 3SPHA 1R6KA 2H94A 3CXCU 2QE7G 3CCLV 3FB6C 4RQFA 1ZWIC 2QEXV 4MTFA 2IU0A 1M1KW 1DF5A 5LBQA 1PKXA 1PNLA 1WPXA 1OHHG 5J9PC 4N21A 1KP2A 1K92A 4P9PA 2OTJV 3E8GA 5L3GA 4JAUA 2DWEC 1R3LC 3K03A 3ZRXA 4MVZA 1KD1W 4WF9V 1V55C 3BY6A 2IW5A 5CBGA 1LNQA 2EIJB 1JJ2U 1JCHA 5LHHA 3JD4A 4FPPA 4HYOA 5H9CA 5LGUA 2UXNA 4WCEV 3ABKC 1XL4A 2JIZG 5IY5B 4PA4A 5LHGA 3K0DA 1SZTA 5KUMA 1VQLV 4MVMA 1Q82W 3EHBB 1VQ9V 3X2QB 3T2MA 1S3JA 3FKSG 4QPJA 3ASOB 2Q67A 3ZRWA 2ZR3A 2JJ2G 4MT8A 1PL0A 4MVUA 4N23A 3E86A 5EC1C 4X8AA 3ZJZA 1H2GA 1DLBA 4LC1A 4JAVA 1YITV 2P7TC 3JYCA 1B6QA 2JK5C 5FL7G 1YTFD 3K79A 3LUTB 1OCRB 3OW2U 4PDLA 4XDJA 3CP1A 3SPIA 1VQMV 3G71V 1RPRA 3CCRV 1KP3A 4PA3A 3RBZA 1AI5A 3AG4C 1JPXA 4TT3G 3ZRWB 3K08A 1M56C 4GT1A 3ETGA 1GM8A 3T4ZA 3W7UA 2Q68A 1YJNV 2V1DA 1E79G 1G4YB 1AJPA 4WFHA 1BL8A 1GO3F 1K4CC 4MTOA 1K8AW 2EJRA 3E89A 2EBOA 2DWDC 4PELA 3W7SA 4RAIA 1K7DA 2XAHA 1GMGA 1OCCC 2ZXWC 2WLLA 3LSQA 2ZR2A 1ORQC 3W7TA 5IYDO 4PA6A 3GWOA 2WLIA 4QJFB 3CPWU 1QR9A 3EFFK 2IH3C 5LGNA 3K9AA 4F4LA 3SYCA 2EIKC 3K3WA 3ZRSA 1VQPV 3STZC 1V54B 1VQ5V 2QA4V 2WLLB 2HG5C 2X7RB 5B3SC 3ZMZA 3ETEA 1XL6A 2R9RB 1W0KG 3LDEA 1EFRG 4YXWG 2OCCC 3OUFA 1W2BU 2F43G 3HB3B 3CMEV 2A9HA 1JX9A 2Y48A 4RUFA 4KUMA 1F51A 1MOFA 3ZN0A 1OZ0A 3E35A 3AG1C 4WFFA 1UJWB 2OCCB 3OEHG 4MTXA 3SYAA 1KKDA 2MK3A 1NKDA 2ITDC 2ZXWB 3OMAB 2IJKA 4L87A 1K5SA 4G28B 4UVCA 4CZZA 1AI6A 3NXSA 5L3DA 3UKMA 5B1AC 5IY5C 3LNMB 3CCVV 3B77A 1S77D 2EILB 4UXNA 2P6JA 3DGEA 1OCZC 3I56V 2FTKA 2EIMC 4JF3A 3SYPA 2IJJA 3OFNG 1F4MA 2WLKA 4KFMA 4GCZA 1IXMA 3WFVA 4PDVA 3AEIA 2WPDG 3QO7A 1M56B 2H8PC 1VQ8V 2DW4A 1VQNV 2IJHA 3K04A 1MSWD 3SYOA 1PNMA 2ITCC 4EKWA 5B3SB 5CBFA 1NH2B 1SETA 4FIPC 1Q86W 1J95A 5CBHA 1AI4A 4JTDB 4PA9A 5IYBO 3F5WC 5IDJA 2HR3A 2LFRA 3RVZA 2AHYA 4HZ3A 2WLMA 4XBFA 3KG2A 2NLJC 4UV8A 3TETA 4P2ZA 2A79B 2PI5A 4ZKIA 3PJSK 1R3IC 4BAYA 2ZD9A 3WG7B 1RM1C 2R9IA 2QKSA 1NVPD 1MABG 3E8FA 3X2QC 3K06A 3P32A 1KECA 1PD3A 3MD0A 2LP7A 4FMTA 5L3EA 1I5XA 5IYCO 1F23A 1THZA 3QNEA 2HLDG 3RVYA 2XAGA 3FB7C 1OCRC 1YJ9V 1YJWV 3MHHC 5LHIA 3W7WA 4MTGA 2PI4A 1QBZA 4OXSA 5KA6A 2EINC 1S5HC 4GX1A 2YEVA 5L3BA 1COWG 1QR8A 2D3OW 2CK3G 3TCUA 1M90W 5EBLC 2HVKC 3I55V 2EINB 4UVBA 2OTLV 1QLNA 2XAJA 3HPLC 3UM7A 3OEEG 3W7XA 5HFMA 3CC2V 1MG1A 1CP9A 3OMIB 1AR1B 3OAAG 1N8RW 3CYOA 3F7YC 3D36A 1JVMA 1NVPB 4R7CA 3ML0A 1GKFA 4U7NA 2Q69A 2XAFA 4ZBMA 3ASNB 3P30A 4LP8A 4Z1MG 1H8EG 2ATKC 1VQ7V 3CCSV 1YIJV 4FJCC 1FXHA 3AG3C 3JD3A 4PDMA 5C93A 3STLC 1EBOA 3ABUA 3ABLB 3RW0A 4LBEC 3CC7V 1QCEA 2K1EA 3ZMSA 2WAMA 2Y69C 3AG3B 4JASA 4JYBA 1ROPA 2DYRB 1AJNA 1I5YA 2YEVB 5EK0A 5EC2C 3JCZA 1NR7A 2IU3A 3ZCCA 2WLIB 4X88A 4UVAA 5BZBA 3OM3B 4MVSA 4R6ZA 1BHAA 4QE7A 4XDKA 2M7WA 3WG7C 1VQ4V 2P90A 4R50A 2XOKG 5B1OA 3AG1B 1BHBA 1SRYA 3CCMV 5CA3A 2JEXA 5HFLA 3G6EV 3E83A 4QNHB 2DYSB 1E1QG 1F4NA 5DN6G 1L1FA 3ABTA 4GX0A 1K3EA 3H01A 1V54C 2QM8A 2HKOA 3E8BA 3ABLC 4PDRA 3CCUV 1VQ6V 4DO2A 1VQKV 5CN0A 2GHYA 3TK1A 5B1NA 2Z5UA 2C2AA 1OCOC 3SPJA 4ASUG 1Q7YW 4BIZA 5L3CA 4GX5A 3OR6C 2B1IA 2EIKB 3JD2A 1HWYA 1NH2D 2DQ3A 3SPCA 2W6IG 1QLEC 5B1BC 4JPRA 2Y69B 1TUEB 2Z3YA 1YSCA 2WSSG 4JTAB 5B1BB 1AJQA 5EBWC 4BIUA 1EZJA 1JOYA 1K73W 3E2EA 1M57B 1Y4MA 5L3FA 3R65A 3CCEV 1R3JC 1SESA 1ENVA 3JD1A 1P4RA 4WFEA 1K34A 3IC7A 3ZN1A 2BOCC 4J9YB 4PA7A 2EIJC 1FXVA 3E8HA 3LDDA 3T4DA 3CMAV 4BW5A 2WWWA 4G2KA 4R8CA 1GM7A 2OT5A 1FXKC 4J9ZB 4I9WA 1H38A 4P9OA 1S0VA 3QO5A 3ZMUA 2JJ1G 4JYCA 1S76D 4Q20A 2NNUA 3LSSA 4WFBV 2GSMB 1Q81W 4CBCA 1OCOB 4JGSA 3D3IA 2X6BA 1AROP 3K0GA 3SJQC 5H6QA 2P67A 1H8HG 4U7OA 1V55B 5LGTA 3AG2B 1FS0G 1R6NA 3GB7C 4P30A 5B1AB 4WFAV 3OE7G 3A0RA 3AG2C 4I5SA 2DYSC 3IFXA 1FXKA 3JD0A 3VBBA 2KB1A 3ZMVA 3CCQV 2HJFC 2DQ0A 2X0LA 1DF4A 2EZOA 4QPKA 4RO2A 4DXWA 2JEUA 2A0LA 1G8MA 2Q6AA 3B8MA 3BEHA 2EILC 3LDCA 1RPOA 1YI2V 4MSWC 1GTOA 3QO8A 2EIMB 1AI7A 4TWKA 1QLEB 1K33A 2QM7A 4FK5C 1OCCB 1YTFB 1K5QA 2WLJA 4H33A 5DM6V 3G4SV 1GK9A 1CEZA 3ABMB 1NQTA 4MVOA 2WLNA 4JTCB 1JQ0A 4MW8A 3AG4B 1KC8W 1VQOV 2DYRC 3CD6V 2QTOA 1E1RG 3FB5C 3ZRVA 1NR1A 2HVJC 2B5UA 1P7BA 1K4DC 5KUKA 1GM9A 1WLEA 3F7VC 3CCJV 3CC4V 4XDLA 1QVFU 1QVGU 4TSFG 2X6AA 4MVQA 5H6RA 3SPGA 1RM1B 2JDIG 3ASOC 3FYEB 1CPYA 2ZDIA 1FXKB 2UXXA 3ZIAG 1R73A 3OMNB 1Y66A 2XASA 2XNDG 3VOUA 5E1AC 4X89A 3DTUB 4G27B 1K97A 2ZQMA 4LCUC 5CMUA 5KA5A 4RQEA 1YHQV 2IJIA 2AHZA 1BMFG 2EZPA 2B1GA 1M9NA 3ETDA 3FYIB 4QIWF 3ABMC 4QE9A 3ABKB 2W6JG 4WFGA 2X6CA 4MW3A 1R3KC 1K9MW 1M57C 2V7QG 3ASNC 4KP4A 4UUJC 4MVRA 4UV9A 3T1CA 5GW7A 2IH1C 2WLHA 3OUSA 1FFTB 4RUEA 3MHSC 3B8NA 2XAQA 3M99B 2BOBC 1PNKA 4HAMA 3OGCC 1S72V 3SYQA 1OCZB 4E2LA 5EBMC 4MS2A 2HFEC 2ZDIC 1DTOA 1SERA 2YSUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS V;  1YIJ V;  2D3O W;  3I56 V;  1KD1 W;  4WF9 V;  1QVF U;  1KQS U;  1Q7Y W;  1M90 W;  3OW2 U;  1NJI W;  4WFB V;  3CCJ V;  3CCM V;  1YI2 V;  1Q81 W;  1W2B U;  3I55 V;  1VQM V;  1JJ2 U;  2OTL V;  3CXC U;  3G71 V;  3CCL V;  3CCR V;  1QVG U;  3CC7 V;  1VQ8 V;  3CME V;  3G6E V;  2QEX V;  4WCE V;  1YIT V;  3CC2 V;  5DM6 V;  3G4S V;  1K9M W;  1VQN V;  1M1K W;  1N8R W;  1VQ4 V;  3CMA V;  1VQL V;  1Q82 W;  3CPW U;  1VQ9 V;  1Q86 W;  1R73 A;  1KC8 W;  1YJ9 V;  4WFA V;  1YJN V;  1YJW V;  1S72 V;  2OTJ V;  1VQO V;  1VQP V;  3CD6 V;  1K73 W;  3CC4 V;  3CCU V;  3CCV V;  1VQ6 V;  1VQK V;  1YHQ V;  3CCQ V;  2QA4 V;  1K8A W;  1VQ5 V;  3CCE V;  1VQ7 V; 
#chains in the Genus database with same CATH topology
 4H37 A;  4D7T A;  3OR7 C;  1EN4 A;  3D8C A;  3WU2 Z;  5BR8 B;  3ZMT A;  1R6K A;  5K1P A;  2QE7 G;  4DV2 B;  4RQF A;  1R1B A;  3L75 H;  4MTF A;  2IU0 A;  2F4V O;  1M1K W;  1BQ0 A;  1PKX A;  2YXY A;  1FAF A;  3AK2 A;  1OHH G;  4NTW A;  1H2L A;  3RYH B;  4JAU A;  4DV5 B;  4O4I A;  3ZRX A;  3Q4H B;  4FZ0 A;  5LP6 B;  1ZX3 A;  4FM2 A;  3BY6 A;  2VS0 A;  2ODM A;  5JWP A;  2PUS A;  3OTF A;  1IBL B;  4IT5 A;  5LHH A;  4JI3 O;  5LGU A;  1XL4 A;  2IM9 A;  2JIZ G;  4J11 A;  1SZT A;  1Q82 W;  3NR7 A;  1GN3 A;  1SKV A;  4TV9 B;  4I0X B;  3HR0 A;  1PL0 A;  4X8A A;  2VRZ A;  3RFR A;  5IJ9 B;  1XNQ O;  4HNA A;  2P7T C;  5CA1 B;  2CE4 A;  3G71 V;  1RPR A;  3JAW B;  1MMM A;  2N74 A;  2Y0I A;  1MZE A;  2D2C B;  3L73 H;  3K08 A;  1XNQ B;  4GT1 A;  5FPO A;  2O57 A;  4FLZ A;  1FFX B;  1G4Y B;  2GBO A;  1BL8 A;  4MTO A;  3E89 A;  1ZLZ A;  3IAY A;  3W7S A;  4RAI A;  1GMG A;  5E79 Z;  2WLL A;  3CXH F;  3FFQ A;  3LSQ A;  2ZR2 A;  2ADQ B;  1F7Y A;  5IYD O;  3J80 N;  1QR9 A;  3EFF K;  3L70 H;  3B40 A;  5LGN A;  3OD4 A;  3K9A A;  3L71 H;  2EIK C;  1LUW A;  3ICX A;  2QA4 V;  5TIS Z;  4BIO A;  2GV9 A;  4TQD A;  2R9R B;  1N36 B;  2OCH A;  1BS3 A;  2OCC C;  3OUF A;  1Q6U A;  1AVM A;  1F51 A;  1GAX A;  4WFF A;  2MK3 A;  1NKD A;  4L87 A;  4G28 B;  2YIB D;  3NXS A;  5KHJ A;  4UXN A;  1WPB A;  1BCC H;  2IJJ A;  3OTO O;  3WFV A;  1JFF A;  1M56 B;  1BSM A;  3RYC A;  1VQN V;  4J7Z A;  1PNM A;  4K8X A;  2ITC C;  1NH2 B;  2UXB B;  2F95 B;  4JTD B;  5IYB O;  5LXT A;  3ZHV A;  2HR3 A;  3RVZ A;  2AHY A;  2WLM A;  4XBF A;  2ZT9 B;  1Q8I A;  1HNW B;  2A79 B;  2NR5 A;  2YIC A;  2ZM6 O;  4NTY A;  2ZD9 A;  4BW9 A;  4H44 B;  1NVP D;  3E8F A;  4X9Q A;  1KEC A;  1Q3E A;  4TQF A;  3K57 A;  2LP7 A;  4FMT A;  4LFB B;  1I5X A;  1F23 A;  2BTQ A;  3QNE A;  3RVY A;  4LF7 B;  5LHI A;  1O9G A;  3W7W A;  1QBZ A;  1NTK H;  2EIN C;  3RN4 A;  5J2T A;  2HVK C;  4HNA B;  4UVB A;  3K58 A;  1QLN A;  3HPL C;  3UM7 A;  1WB7 A;  1VEW A;  3CC2 V;  3OMI B;  1Q43 A;  2DN9 A;  5GON B;  4R7C A;  1EN6 A;  2UUB O;  3ASN B;  4LP8 A;  2HJD A;  3A2F A;  1YIJ V;  4FJC C;  2AZ0 A;  4UCT A;  3STL C;  1WN7 A;  1XMQ B;  1KUQ A;  1EBO A;  3CC7 V;  2BE3 A;  2UU9 O;  4DR3 B;  5EC2 C;  1GN4 A;  1B06 A;  4UVA A;  3ZHR A;  1SA0 A;  5LA6 A;  3OM3 B;  4MVS A;  4CH6 A;  4TOI A;  2XOK G;  1JA8 A;  5B1O A;  5LL6 Y;  4YIO A;  1D5A A;  2JEX A;  4QNH B;  3LNN A;  3H1I H;  4C7U A;  1VIB A;  4JYA B;  2W0X A;  3E8B A;  4FLV A;  3ABL C;  1VQ6 V;  5CN0 A;  3TK1 A;  4LH6 A;  4PD4 F;  1XQ8 A;  5B1N A;  5CA0 B;  3A8T A;  2KQX A;  4BIZ A;  4UB6 Z;  3QVN A;  1HWY A;  4JPR A;  2XTA A;  4O4H B;  3E22 B;  3N2G A;  1EZJ A;  1XI1 A;  1HR0 B;  3E2E A;  5LMN B;  1Y6X A;  1ENV A;  4DUZ B;  3JD1 A;  2PGG A;  1B04 A;  4AIL C;  4J10 A;  4PA7 A;  4PV1 B;  2UU9 B;  3T4D A;  3CMA V;  1XDC A;  4R8C A;  1GM7 A;  4DV7 O;  4DR5 B;  2FYU H;  1YVW A;  1YF2 A;  1NI8 A;  3BRC A;  1GH6 A;  3AK1 A;  1H38 A;  2OYQ A;  1S76 D;  3BPZ A;  2GSM B;  1GN6 A;  4CBC A;  2K9P A;  1X59 A;  3K0G A;  4DV6 B;  1IVS A;  2VQF O;  1VMG A;  2CTQ A;  4IL6 Z;  3GB7 C;  1EN5 A;  5B1A B;  4YHH B;  2DYS C;  3IFX A;  3JD0 A;  3VBB A;  3JAK B;  4CC5 A;  5ITZ A;  1DF4 A;  2B9Z A;  2JEU A;  1G8M A;  2Q6A A;  3BEH A;  3LDC A;  2EIL C;  2PYJ A;  4MSW C;  1GTO A;  2CTR A;  4TWK A;  2QM7 A;  3G80 A;  1GK9 A;  2UXD B;  2GUZ B;  1FYJ A;  1VF5 B;  4LF6 B;  1ZL8 A;  4LFA O;  3AG4 B;  3B2E E;  5KX5 B;  3JAL B;  3FB5 C;  4DRX A;  2CGN A;  3RGB A;  4B3R O;  4DR1 B;  1GM9 A;  1IBL O;  3MDS A;  4XDL A;  1QVG U;  4IIJ A;  3CRC A;  5H6R A;  2ZIO A;  3SPG A;  3ASO C;  2Q7G A;  3FYE B;  5C8Y B;  4UCV A;  1FXK B;  3SGI A;  4UB8 Z;  4DUY B;  4JI0 O;  4X20 B;  1W59 A;  2XAS A;  4I55 A;  4D6T H;  1VF6 C;  5E1A C;  1YHQ V;  2IJI A;  1BMF G;  3KCX A;  2EZP A;  3ZHU A;  4DV1 O;  2B1G A;  3ETD A;  1IDS A;  4QIW F;  1IBK B;  4O4I B;  1ZTE A;  2X6C A;  4DW1 A;  2GTA A;  2V7Q G;  4KP4 A;  4UUJ C;  4RUE A;  5JVD A;  4AHC A;  3B8N A;  4F6R B;  1PNK A;  4HAM A;  3OGC C;  4DK0 A;  4K0K O;  3FAV B;  3TGU H;  1SQV H;  2GDS A;  3HKB A;  1SER A;  1ZSP A;  1SF9 A;  4B3T O;  4TV8 B;  3T1H O;  2LFS A;  3SPH A;  2H94 A;  3FB6 C;  1ZWI C;  3UO3 A;  1PNL A;  1NU1 H;  1WPX A;  2ZE7 A;  5J9P C;  2L35 A;  2OTJ V;  3CJH B;  3J7A U;  1TVK B;  4MVZ A;  4WF9 V;  1V55 C;  1LNQ A;  3RYI B;  3JD4 A;  4I50 A;  1AR5 A;  2UXN A;  5FNV B;  3K0D A;  5KUM A;  4MVM A;  4J7K A;  4QPJ A;  2Q67 A;  1WB8 A;  3IC9 A;  2ZR3 A;  2JJ2 G;  4MVU A;  3ZJZ A;  3IJ4 A;  4LC1 A;  4CH5 A;  2JK5 C;  3K79 A;  4B7E A;  2FL4 A;  3CP1 A;  2Q0O C;  4O4J A;  3L72 H;  4X64 B;  4PA3 A;  1JPX A;  3ZRW B;  2UXB O;  1Y74 A;  3RYF A;  1MNG A;  4OPA A;  1E79 G;  3K5O A;  3BCC H;  1AJP A;  1GO3 F;  4EEQ A;  1K8A W;  3JAW A;  4PEL A;  3JAT A;  2R72 A;  4GYC B;  1ORQ C;  4NVP A;  4YJ2 A;  2QWN B;  3APO A;  4CH3 A;  2WLI A;  4QJF B;  1XNR O;  2IH3 C;  4B3M B;  2BTQ B;  1KYO F;  4LF9 B;  4F4L A;  3SYC A;  1VQP V;  3STZ C;  4TUY A;  4X20 A;  4X64 O;  5A2Q N;  4DV3 O;  5B3S C;  1W0K G;  1PP9 H;  4B3S B;  2EUL A;  2OIE A;  4OGQ B;  2ARH A;  2A9H A;  3CME V;  2RJZ A;  3S3W A;  4RUF A;  4KUM A;  4ABM A;  3E35 A;  1PM9 A;  1PL4 A;  1KKD A;  3OMA B;  2ITD C;  5LYJ B;  4CZZ A;  5L3D A;  5JCO A;  4DV2 O;  1M93 A;  4FM1 A;  2P6J A;  3DGE A;  4JI7 O;  4JF3 A;  3OFN G;  5JQG B;  4PDV A;  1D2D A;  5B66 Z;  1MSW D;  2IJH A;  3K04 A;  3SYO A;  4WBN B;  3HKD A;  1YEW A;  1XEQ A;  4FIP C;  1Q86 W;  5CBH A;  2JS5 A;  5IDJ A;  3F5W C;  4HZ3 A;  1ZAU A;  4J7J A;  4ZHQ A;  4UV8 A;  3TET A;  3JCU Z;  4ZKI A;  3PJS K;  4BAY A;  3SJC C;  3U0Z A;  2LO1 A;  3WG7 B;  2R9I A;  1TAE A;  2QKS A;  3X2Q C;  3P32 A;  2QWQ B;  1PD3 A;  4CS2 A;  3MD0 A;  4DV5 O;  4UCS A;  2R70 A;  2WA3 A;  4I4T A;  1THZ A;  4GKJ O;  2XAG A;  1YJ9 V;  1R6T A;  4X66 B;  3BA9 A;  3M7M X;  2PI4 A;  3A0B Z;  1CXZ B;  1X4T A;  2D3O W;  1M90 W;  5EBL C;  1FJG B;  1H2M A;  2XAJ A;  1AP5 A;  3BHP A;  1CP9 A;  4X1I A;  5H2F Z;  3OAA G;  5CB4 A;  4GKK B;  1N33 B;  3D36 A;  1JVM A;  1NVP B;  5C8Y A;  2UUC B;  1FJG O;  2BSK A;  2PTM A;  3JAS B;  4Z1V A;  4H13 B;  3ABU A;  3ABL B;  4O2B B;  2K1E A;  3UCS C;  1WAZ A;  2WAM A;  2Y69 C;  3AG3 B;  4JYB A;  1ROP A;  3B09 A;  4LFC O;  2YEV B;  1NR7 A;  2WA4 A;  2JRI A;  2N04 A;  2YUA A;  2WLI B;  4R6Z A;  4XDK A;  2M7W A;  1VQ4 V;  2P90 A;  4ICG A;  2PF4 E;  4IIJ B;  5KHK A;  4H0L B;  3G6E V;  4DV6 O;  3N2K B;  2ZE6 A;  1MA1 A;  1L1F A;  1K3E A;  3H01 A;  5LOV A;  2GHY A;  2Z5U A;  1OCO C;  2YIA A;  4ASU G;  3HKE A;  3ZHS A;  5L3C A;  3OR6 C;  5LP6 A;  4X65 B;  5KHH A;  2Q0A A;  5BXZ A;  2Z3Y A;  1XHZ A;  3CRM A;  1AJQ A;  5EBW C;  1KB9 F;  4BIU A;  3H1H H;  4X65 O;  1WNS A;  4LFB O;  1NS1 A;  1P4R A;  2UUA B;  4ZHQ B;  4L8J A;  3ZN1 A;  2BOC C;  1V9P A;  4IHJ A;  2YID A;  4DR3 O;  4JI0 B;  1M5I A;  2UXC B;  1N0J A;  3HKC A;  4J9Z B;  4OX9 B;  4I9Q A;  4LR3 A;  4JYC A;  1VF6 A;  4Q20 A;  1Q81 W;  2P5O A;  1HW7 A;  3D3I A;  3AG7 A;  4LNU A;  4U7O A;  1V55 B;  2EJ7 A;  1R6N A;  4FVM A;  4JI8 B;  4A5U B;  5JVD B;  4X1I B;  2QWR B;  4I5S A;  4FFB A;  3SDL A;  3CCQ V;  2LQT A;  1A32 A;  1VF7 A;  2DQ0 A;  2X0L A;  3SJB C;  4QPK A;  1QVF U;  2CH7 A;  4B3R B;  4UCO A;  1AI7 A;  4DV0 O;  2QWO B;  1QLE B;  1K5Q A;  4B7K A;  1OJH A;  4H33 A;  5DM6 V;  3ABM B;  3JAR A;  4JTC B;  4MW8 A;  1KC8 W;  3LSU A;  2AGA A;  3UT5 A;  3CD6 V;  1HNZ B;  1MSD A;  1NR1 A;  1L0L H;  2HVJ C;  3ZRV A;  4B08 A;  5DEC A;  4DV4 B;  2E76 B;  5BMV B;  3JSN A;  5KUK A;  2KG7 A;  3CRR A;  3CCJ V;  4JI3 B;  2RQ6 A;  4JI6 O;  2Y4U A;  1US6 A;  4DR7 O;  2UXD O;  2JDI G;  4TV9 A;  2ZDI A;  4I0X A;  2IBZ H;  3OMN B;  2DMX A;  2QDO A;  3N2K A;  3GVM A;  3DTU B;  4G27 B;  1K97 A;  5KA5 A;  2KG7 B;  4LCU C;  4U3J A;  4RQE A;  4K8Z A;  4Q6G A;  3G6B A;  3ABM C;  3N2G B;  4QE9 A;  1EZV H;  3ABK B;  4K3A A;  5GTH Z;  3CB2 A;  4JYA O;  1XRE A;  3Q4H A;  1P84 F;  1R3K C;  3T1C A;  2JGU A;  4MVR A;  5GW7 A;  2IH1 C;  5JH7 A;  3MHS C;  1SC5 B;  4O4L B;  4LFC B;  4I50 B;  4U3F H;  5FNV A;  4HBN A;  2AXT Z;  3SYQ A;  1OCZ B;  3TXQ A;  2F4V B;  1XMO O;  2E74 B;  4MS2 A;  1IUR A;  4DV1 B;  1W0J G;  2AZ2 A;  4GX2 A;  1NJI W;  5IJ9 A;  3IGA C;  5KLV H;  3CCL V;  2QEX V;  3KKY A;  4KL1 A;  1KP2 A;  2E3C A;  3E8G A;  2V4D A;  5L3G A;  3K5M A;  4FM0 A;  2DWE C;  1Y74 B;  1R3L C;  3U11 A;  4EFB A;  2PY5 A;  4DV4 O;  2ADP A;  1JCH A;  3AK3 A;  5H9C A;  4HYO A;  2QWP B;  5IY5 B;  4PA4 A;  5LHG A;  1VQL V;  2PYL A;  3EHB B;  1MZF A;  3X2Q B;  4DUY O;  4JYY A;  1H2S B;  2BTO A;  5EC1 C;  1HP8 A;  2YXL A;  1HNX B;  1DLB A;  2QR4 A;  3RYI A;  1B6Q A;  1YTF D;  2ETN A;  4X1K B;  3SPI A;  1VQM V;  1YDX A;  1GM8 A;  4WBN A;  3W7U A;  1XOU A;  2DE0 X;  2ZIM A;  2M6Y A;  3CEI A;  1AIL A;  1K4C C;  2QKC A;  5KMG A;  4GZR B;  4O4J B;  1IBM B;  2EBO A;  2DWD C;  1BE3 H;  2AW9 A;  4X1Y A;  1Y76 A;  1SQP H;  1URF A;  2ZXW C;  4LFA B;  1XBL A;  5KAF Z;  3C3S A;  3CPW U;  3O9O A;  4JI1 O;  1WA8 B;  3K3W A;  5JCO C;  1Y76 B;  4NXM B;  3CWB H;  4DUZ O;  5FLX N;  2WLL B;  2HG5 C;  3ZMZ A;  3CE2 A;  3ETE A;  1XL6 A;  3ZX6 A;  4CS4 A;  1XIL A;  2F43 G;  3HB3 B;  3DC6 A;  5EYP A;  1N4C A;  3ZN0 A;  1OZ0 A;  2ILM A;  2ZM6 B;  3AG1 C;  4B3M O;  1UJW B;  3RYC B;  3K5N A;  4MTX A;  3SYA A;  2DOS A;  2IJK A;  2LW7 A;  1BQZ A;  3HKD B;  3K5L A;  1JMK C;  1AI6 A;  3UKM A;  5B1A C;  3B77 A;  4NB5 A;  1S77 D;  1GN2 A;  1OCZ C;  3I56 V;  1XMQ O;  4X62 B;  2FTK A;  2EIM C;  3SYP A;  1Q5O A;  3CJH A;  3JAS A;  2XT9 A;  4NYK A;  2WPD G;  3QO7 A;  1VQ8 V;  3SR2 C;  5LYJ A;  2HHH B;  3R66 A;  5J2U A;  1J5E B;  4EKW A;  5B3S B;  1SET A;  1J95 A;  3A0H Z;  5LA6 B;  1AI4 A;  1IZ3 A;  4P2Z A;  1P7G A;  1KMI Z;  2G38 A;  1RM1 C;  1JR9 A;  1QQC A;  1RSO A;  3K06 A;  4LF8 B;  4LH7 A;  4O4H A;  5IYC O;  2HLD G;  4DR2 O;  3BAB A;  3JAM N;  1TA8 A;  3CX5 F;  3FB7 C;  1OCR C;  3MHH C;  2QTS A;  4JI1 B;  3JAR B;  4MTG A;  5KA6 A;  5KHG A;  2Q9L A;  2YEV A;  5L3B A;  4IYI A;  2E5L B;  1COW G;  5H5N A;  2CK3 G;  2F1M A;  3TCU A;  1UFI A;  2LGQ A;  5CA0 A;  3I55 V;  2EIN B;  4LF7 O;  3W7X A;  5HFM A;  1MG1 A;  3JAT B;  1AR1 B;  3CYO A;  5IYZ B;  3F7Y C;  4KHP O;  3GWK C;  2Q7H A;  4ZOL B;  5IWA O;  1RFY A;  3FX7 A;  3TJT A;  1GKF A;  4X66 O;  4U7N A;  2XAF A;  1QU7 A;  4Z1M G;  1H8E G;  2ATK C;  3VQX A;  1Z5V A;  3CCS V;  1FXH A;  3AG3 C;  4PDM A;  4RWU A;  5EIB C;  5EZY A;  1JJO A;  2XHB A;  2ZNI A;  4GUN A;  3ZMS A;  5BY1 A;  4JAS A;  5F2V O;  4FLW A;  2E5L O;  2P06 A;  2DYR B;  1AJN A;  1VAR A;  4JI2 O;  3ZHQ A;  3JCZ A;  4DV0 B;  1B3Q A;  2IU3 A;  1Q90 D;  2YIB A;  5IT9 N;  1BHA A;  4NR1 A;  3WG7 C;  1RP3 B;  4GLX A;  1N34 O;  3AG1 B;  1BHB A;  3TXS A;  3CCM V;  3BA8 A;  5CA3 A;  5HFL A;  2VQF B;  2ZCE A;  4DW0 A;  4JI4 B;  1Q6H A;  2JVD A;  2DYS B;  2YC0 A;  1E1Q G;  4DRX B;  1F4N A;  5DN6 G;  4DR2 B;  1H2K A;  4PDR A;  3CCU V;  2C2A A;  4PI0 A;  2Y4T A;  1IBM O;  1Q7Y W;  5J2T B;  1KBH A;  1FPO A;  1HR0 O;  2YI9 A;  2EIK B;  2JGD B;  3JD2 A;  1NH2 D;  3D36 C;  3SPC A;  2FKX A;  2EX3 A;  5B1B C;  2Y69 B;  1TUE B;  1YSC A;  2WSS G;  1G1X B;  2P4K A;  4NTX A;  5B1B B;  2YS8 A;  1EM1 A;  1K73 W;  4LWS A;  4IGG A;  2A7W A;  2FB5 A;  5L3F A;  3R65 A;  3CCE V;  1SES A;  4FZ1 A;  1N32 B;  1K34 A;  1NT2 B;  4F6R A;  5ITZ B;  2H3O A;  2EIJ C;  1FXV A;  3E8H A;  2Q7E A;  4I55 B;  2WWW A;  4LWS B;  2OIG A;  2OT5 A;  5FPR A;  4W4K A;  1N32 O;  4I9W A;  4P9O A;  1S0V A;  3QO5 A;  3ZMU A;  4BR6 A;  4K35 A;  1P49 A;  2NNU A;  2RN9 A;  3LSS A;  1N34 B;  4WFB V;  4E4E A;  4ZIB A;  3DSQ A;  4CS3 A;  1OCO B;  1SQG A;  4JGS A;  2F66 C;  1ARO P;  4AQY O;  5AG2 A;  5H6Q A;  2P67 A;  1H8H G;  2CGO A;  2Z0A A;  1J5E O;  4O2B A;  4P30 A;  2GUZ A;  3OE7 G;  3P3P A;  3A0R A;  3AG2 C;  1ZL8 B;  1FXK A;  2KB1 A;  3ZMV A;  5IJ0 B;  4TV8 A;  4JI5 B;  4DXW A;  5BR8 O;  2A0L A;  4J80 A;  3O65 A;  5KAI Z;  1YI2 V;  1PV0 A;  2EIM B;  1K33 A;  4FK5 C;  2UUC O;  1OCC B;  1YTF B;  2WLJ A;  3G4S V;  1SQB H;  3JSL A;  4LF5 B;  1NQT A;  2LJ2 A;  3H1L H;  4MVO A;  4JI8 O;  1QHT A;  3QTC A;  3H1K H;  1VQO V;  2YDE A;  2QTO A;  2ZIN A;  3CSX A;  4AQY B;  1P7B A;  1LUV A;  3H9V A;  1TVK A;  1K4D C;  2ZKO A;  3K59 A;  3HKB B;  3F7V C;  3RWR D;  2UUA O;  2X6A A;  4DR4 B;  1RM1 B;  1FFX A;  1CPY A;  3ZS8 C;  2UXX A;  1R73 A;  1Y66 A;  5J2U B;  3VOU A;  1GRJ A;  3VQY A;  4PJ0 Z;  4PI2 A;  3QF7 A;  1IXB A;  2ZQM A;  1VP7 A;  5CMU A;  3EXA A;  3N27 A;  3EVK A;  3DXR A;  3I5D A;  1M9N A;  3G67 A;  2CDY A;  2Q5Z A;  4WFG A;  1K9M W;  1YXB A;  1M57 C;  3THO A;  3JAL A;  4UV9 A;  4X62 O;  2WLH A;  3OUS A;  1WP7 A;  1I0H A;  1SA0 B;  2XAQ A;  1S5J A;  4J41 A;  2NN4 A;  2HFE C;  1DTO A;  1TUB B;  2YSU B;  1NBM G;  1KQS U;  2P22 C;  2W0F C;  1I08 A;  3FB8 C;  4JI5 O;  2DJV A;  3CXC U;  4X1Y B;  5EIB D;  3RT3 C;  1DF5 A;  1WP8 A;  5LBQ A;  4CH4 A;  1Q6I A;  2QJ1 A;  4EB6 A;  4N21 A;  1I7F A;  5IYZ A;  3UQ8 A;  1K92 A;  4P9P A;  3T1H B;  4ZOL A;  4F6E A;  3K03 A;  1HNX O;  1KD1 W;  3UO2 A;  2YXH A;  2IW5 A;  5CBG A;  2EIJ B;  1JJ2 U;  2HEP A;  3H1J H;  4LF4 O;  4FPP A;  4D7S A;  4EB6 B;  4X1K A;  2YI8 A;  1LR1 A;  4WCE V;  3ABK C;  2A06 H;  4O2A A;  1VQ9 V;  4PHZ A;  4B3T B;  3E22 A;  3T2M A;  1S3J A;  3FKS G;  3ASO B;  3ZRW A;  4MT8 A;  4N23 A;  3E86 A;  3RYF B;  1H2G A;  4JI7 B;  4JAV A;  1YIT V;  3JYC A;  2JS3 A;  5FL7 G;  4BWA A;  5JJJ B;  3LUT B;  1OCR B;  3OW2 U;  5KMG B;  4PDL A;  4IYH A;  4XDJ A;  1M4U A;  3CCR V;  1KP3 A;  1U97 A;  3RBZ A;  1AI5 A;  4YY3 B;  3AG4 C;  3F5T A;  4TT3 G;  3C90 A;  1M56 C;  3ETG A;  2F93 B;  4UFZ A;  3WB0 A;  2RDC A;  3T4Z A;  2Q68 A;  1YJN V;  2V1D A;  4NKG B;  1BZK A;  4WFH A;  2EJR A;  3OT7 A;  3CHX A;  4JZG A;  1L8D A;  1K7D A;  2XAH A;  1OCC C;  4LF8 O;  1N36 O;  4J42 A;  3W7T A;  2ZE5 A;  3DC5 A;  4PA6 A;  3GWO A;  1T5E A;  1SS3 A;  2PZS A;  1SQF A;  1DK1 A;  3ZRS A;  5CA1 A;  4JI4 O;  4JI6 B;  3CRA A;  1V54 B;  1I94 O;  2RNB A;  1VQ5 V;  3ZED A;  2GTS A;  4UCR A;  2X7R B;  4FLU A;  2E75 B;  4YXW G;  1EFR G;  3LDE A;  1W2B U;  4JV5 B;  2Y48 A;  1JX9 A;  3BAA A;  1N33 O;  1MOF A;  4GKK O;  4KHP B;  3L74 H;  2OCC B;  3OEH G;  4UVC A;  2ZXW B;  3WB1 A;  1O9H A;  1K5S A;  5CB4 B;  4LF6 O;  1QNM A;  5IY5 C;  3LNM B;  3CCV V;  1AR4 A;  2EIL B;  4DR6 B;  2JGD A;  3APQ A;  1F4M A;  2WLK A;  4KFM A;  4GCZ A;  1IXM A;  3AEI A;  2L6L A;  2VWJ A;  2H8P C;  1WJZ A;  5LMN O;  1U96 A;  5JJN B;  1XMO B;  2DW4 A;  2A3Q A;  4DV3 B;  5CBF A;  4I4T B;  4PA9 A;  3KZI Z;  2LFR A;  5K1X A;  1ZUQ A;  3KG2 A;  1AP6 A;  2NLJ C;  4GKJ B;  2PI5 A;  1R3I C;  3OGI B;  3T1Y B;  1MAB G;  2MW2 B;  1XHX A;  5IE9 A;  5L3E A;  2HP8 A;  4YJ2 B;  3SJA C;  1XNR B;  1YJW V;  3ETQ A;  3L9D A;  1WA8 A;  4OXS A;  3KCY A;  4FLT A;  4GX1 A;  1S5H C;  2F23 A;  2VWK A;  3HKE B;  1RSO B;  1QR8 A;  3ZHT A;  2OTL V;  2Q8V A;  3OEE G;  1FKA O;  1KU9 A;  1KKC A;  4UCU A;  2R9A A;  1L0N H;  1N8R W;  4OPH A;  3RYH A;  3C3T A;  3ML0 A;  2Q69 A;  3BVO A;  4ZBM A;  1AB3 A;  3P30 A;  5GTI Z;  1VQ7 V;  1SQQ H;  3JD3 A;  5C93 A;  4DR6 O;  1Z2G A;  1NZ6 A;  3RW0 A;  4LBE C;  3QG5 A;  1HDJ A;  1QCE A;  2QKA A;  2HHH O;  4FFB B;  1N0N A;  4FLY A;  1I5Y A;  5EK0 A;  2QSA A;  3ZCC A;  4X88 A;  5BZB A;  5JH7 B;  4QE7 A;  1Y67 A;  4Z2W A;  2RCV A;  4W4L A;  4R50 A;  2RMK B;  5EZY B;  1HNW O;  5LOV B;  1SRY A;  3CRQ A;  2XUM A;  5DED A;  3T1Y O;  5D5P A;  4NXM O;  4CC6 A;  4YY3 O;  3E83 A;  4JI2 B;  3VQW A;  3K9S A;  1IBK O;  3ABT A;  4GX0 A;  1V54 C;  2QM8 A;  4IHJ B;  2HKO A;  1D5N A;  1TGO A;  5A9G A;  4DO2 A;  1VQK V;  2Y0P A;  1NTZ H;  2N05 A;  3SPJ A;  5B5E Z;  2BCC H;  4GX5 A;  3S3X A;  4FLX A;  1XUQ A;  4OX9 O;  2B1I A;  2ZNJ A;  2DQ3 A;  1G6U A;  2W6I G;  1QLE C;  1Z5W A;  1UPG A;  2ZE8 A;  4JTA B;  4DK1 A;  1JOY A;  4JZ2 A;  3ZBH A;  1M57 B;  1Y4M A;  1R3J C;  4WFE A;  3D3Q A;  2KKW A;  4DR7 B;  3IC7 A;  4DR4 O;  4AI8 A;  4B3S O;  4J9Y B;  3J81 N;  3LDD A;  4BW5 A;  1FD9 A;  4G2K A;  2CUG A;  4LNU B;  2OWO A;  1FXK C;  1SQX H;  3CS5 A;  2LGW A;  5JQG A;  2JJ1 G;  1OV9 A;  3P3N A;  3U10 A;  4U3J B;  1IX9 A;  3WB2 A;  2FML A;  5IJ0 A;  3JAK A;  5IWA B;  2X6B A;  1SZX A;  3SJQ C;  5LXT B;  5LGT A;  4JAA A;  3FAV A;  3B4S A;  4YIP A;  3AG2 B;  4DV7 B;  4DR5 O;  4LF5 O;  5D5Q A;  1FS0 G;  4ZI7 A;  4LF4 B;  4WFA V;  5LMU B;  1DGS A;  4O4L A;  5GON A;  5JJE B;  1YCI A;  2HJF C;  2Q73 A;  3FD9 A;  3PN1 A;  2EZO A;  4RO2 A;  3B8M A;  4I7Z B;  1RPO A;  3QO8 A;  2CAZ C;  5BMV A;  3DXR B;  4YJ3 A;  4QGP A;  4ZI7 B;  2UUB B;  1H2N A;  1CEZ A;  2LW1 A;  2WLN A;  1JQ0 A;  2VQE B;  2DYR C;  1E1R G;  1YZB A;  2B5U A;  4DYL A;  4YJ3 B;  3OTO B;  2KSD A;  3VQV A;  1WLE A;  4EFE A;  3CC4 V;  2VQE O;  1TUB A;  4NXN B;  4TSF G;  4MVQ A;  1S5L Z;  4KXR A;  5KX5 A;  3M8A A;  3HKC B;  3ZIA G;  2BSK B;  2XND G;  2P4V A;  3BFR A;  4O2A B;  2UXC O;  5KHI A;  2QGN A;  4X89 A;  4K0K B;  4NXN O;  2QM4 A;  2AHZ A;  4DR1 O;  1BT8 A;  3FYI B;  4LF9 O;  2W6J G;  4FFK A;  1I94 B;  4MW3 A;  1HNZ O;  1PPJ H;  2Q4P A;  3UT5 B;  3ASN C;  4TUY B;  5LP6 C;  1FFT B;  2CTP A;  3M99 B;  2CTW A;  2BOB C;  1NTM H;  4JV5 O;  1S72 V;  4E2L A;  5EBM C;  4YHH O;  5LMU O;  1BGY H;  2ZDI C;  3MAQ A;  2CH7 B;  1JFF B;  5EYP B; 
#chains in the Genus database with same CATH homology
 1W0J G;  4H37 A;  3OR7 C;  1NBM G;  4GX2 A;  1KQS U;  2W0F C;  3FB8 C;  3ZMT A;  1NJI W;  2LFS A;  3IGA C;  3SPH A;  1R6K A;  2H94 A;  3CXC U;  2QE7 G;  3CCL V;  3FB6 C;  4RQF A;  1ZWI C;  2QEX V;  4MTF A;  2IU0 A;  1M1K W;  1DF5 A;  5LBQ A;  1PKX A;  1PNL A;  1WPX A;  1OHH G;  5J9P C;  4N21 A;  1KP2 A;  1K92 A;  4P9P A;  2OTJ V;  3E8G A;  5L3G A;  4JAU A;  2DWE C;  1R3L C;  3K03 A;  3ZRX A;  4MVZ A;  1KD1 W;  4WF9 V;  1V55 C;  3BY6 A;  2IW5 A;  5CBG A;  1LNQ A;  2EIJ B;  1JJ2 U;  1JCH A;  5LHH A;  3JD4 A;  4FPP A;  4HYO A;  5H9C A;  5LGU A;  2UXN A;  4WCE V;  3ABK C;  1XL4 A;  2JIZ G;  5IY5 B;  4PA4 A;  5LHG A;  3K0D A;  1SZT A;  5KUM A;  1VQL V;  4MVM A;  1Q82 W;  3EHB B;  1VQ9 V;  3X2Q B;  3T2M A;  1S3J A;  3FKS G;  4QPJ A;  3ASO B;  2Q67 A;  3ZRW A;  2ZR3 A;  2JJ2 G;  4MT8 A;  1PL0 A;  4MVU A;  4N23 A;  3E86 A;  5EC1 C;  4X8A A;  3ZJZ A;  1H2G A;  1DLB A;  4LC1 A;  4JAV A;  1YIT V;  2P7T C;  3JYC A;  1B6Q A;  2JK5 C;  5FL7 G;  1YTF D;  3K79 A;  3LUT B;  1OCR B;  3OW2 U;  4PDL A;  4XDJ A;  3CP1 A;  3SPI A;  1VQM V;  3G71 V;  1RPR A;  3CCR V;  1KP3 A;  4PA3 A;  3RBZ A;  1AI5 A;  3AG4 C;  1JPX A;  4TT3 G;  3ZRW B;  3K08 A;  1M56 C;  4GT1 A;  3ETG A;  1GM8 A;  3T4Z A;  3W7U A;  2Q68 A;  1YJN V;  2V1D A;  1E79 G;  1G4Y B;  1AJP A;  4WFH A;  1BL8 A;  1GO3 F;  1K4C C;  4MTO A;  1K8A W;  2EJR A;  3E89 A;  2EBO A;  2DWD C;  4PEL A;  3W7S A;  4RAI A;  1K7D A;  2XAH A;  1GMG A;  1OCC C;  2ZXW C;  2WLL A;  3LSQ A;  2ZR2 A;  1ORQ C;  3W7T A;  5IYD O;  4PA6 A;  3GWO A;  2WLI A;  4QJF B;  3CPW U;  1QR9 A;  3EFF K;  2IH3 C;  5LGN A;  3K9A A;  4F4L A;  3SYC A;  2EIK C;  3K3W A;  3ZRS A;  1VQP V;  3STZ C;  1V54 B;  1VQ5 V;  2QA4 V;  2WLL B;  2HG5 C;  2X7R B;  5B3S C;  3ZMZ A;  3ETE A;  1XL6 A;  2R9R B;  1W0K G;  3LDE A;  1EFR G;  4YXW G;  2OCC C;  3OUF A;  1W2B U;  2F43 G;  3HB3 B;  3CME V;  2A9H A;  1JX9 A;  2Y48 A;  4RUF A;  4KUM A;  1F51 A;  1MOF A;  3ZN0 A;  1OZ0 A;  3E35 A;  3AG1 C;  4WFF A;  1UJW B;  2OCC B;  3OEH G;  4MTX A;  3SYA A;  1KKD A;  2MK3 A;  1NKD A;  2ITD C;  2ZXW B;  3OMA B;  2IJK A;  4L87 A;  1K5S A;  4G28 B;  4UVC A;  4CZZ A;  1AI6 A;  3NXS A;  5L3D A;  3UKM A;  5B1A C;  5IY5 C;  3LNM B;  3CCV V;  3B77 A;  1S77 D;  2EIL B;  4UXN A;  2P6J A;  3DGE A;  1OCZ C;  3I56 V;  2FTK A;  2EIM C;  4JF3 A;  3SYP A;  2IJJ A;  3OFN G;  1F4M A;  2WLK A;  4KFM A;  4GCZ A;  1IXM A;  3WFV A;  4PDV A;  3AEI A;  2WPD G;  3QO7 A;  1M56 B;  2H8P C;  1VQ8 V;  2DW4 A;  1VQN V;  2IJH A;  3K04 A;  1MSW D;  3SYO A;  1PNM A;  2ITC C;  4EKW A;  5B3S B;  5CBF A;  1NH2 B;  1SET A;  4FIP C;  1Q86 W;  1J95 A;  5CBH A;  1AI4 A;  4JTD B;  4PA9 A;  5IYB O;  3F5W C;  5IDJ A;  2HR3 A;  2LFR A;  3RVZ A;  2AHY A;  4HZ3 A;  2WLM A;  4XBF A;  3KG2 A;  2NLJ C;  4UV8 A;  3TET A;  4P2Z A;  2A79 B;  2PI5 A;  4ZKI A;  3PJS K;  1R3I C;  4BAY A;  2ZD9 A;  3WG7 B;  1RM1 C;  2R9I A;  2QKS A;  1NVP D;  1MAB G;  3E8F A;  3X2Q C;  3K06 A;  3P32 A;  1KEC A;  1PD3 A;  3MD0 A;  2LP7 A;  4FMT A;  5L3E A;  1I5X A;  5IYC O;  1F23 A;  1THZ A;  3QNE A;  2HLD G;  3RVY A;  2XAG A;  3FB7 C;  1OCR C;  1YJ9 V;  1YJW V;  3MHH C;  5LHI A;  3W7W A;  4MTG A;  2PI4 A;  1QBZ A;  4OXS A;  5KA6 A;  2EIN C;  1S5H C;  4GX1 A;  2YEV A;  5L3B A;  1COW G;  1QR8 A;  2D3O W;  2CK3 G;  3TCU A;  1M90 W;  5EBL C;  2HVK C;  3I55 V;  2EIN B;  4UVB A;  2OTL V;  1QLN A;  2XAJ A;  3HPL C;  3UM7 A;  3OEE G;  3W7X A;  5HFM A;  3CC2 V;  1MG1 A;  1CP9 A;  3OMI B;  1AR1 B;  3OAA G;  1N8R W;  3CYO A;  3F7Y C;  3D36 A;  1JVM A;  1NVP B;  4R7C A;  3ML0 A;  1GKF A;  4U7N A;  2Q69 A;  2XAF A;  4ZBM A;  3ASN B;  3P30 A;  4LP8 A;  4Z1M G;  1H8E G;  2ATK C;  1VQ7 V;  3CCS V;  1YIJ V;  4FJC C;  1FXH A;  3AG3 C;  3JD3 A;  4PDM A;  5C93 A;  3STL C;  1EBO A;  3ABU A;  3ABL B;  3RW0 A;  4LBE C;  3CC7 V;  1QCE A;  2K1E A;  3ZMS A;  2WAM A;  2Y69 C;  3AG3 B;  4JAS A;  4JYB A;  1ROP A;  2DYR B;  1AJN A;  1I5Y A;  2YEV B;  5EK0 A;  5EC2 C;  3JCZ A;  1NR7 A;  2IU3 A;  3ZCC A;  2WLI B;  4X88 A;  4UVA A;  5BZB A;  3OM3 B;  4MVS A;  4R6Z A;  1BHA A;  4QE7 A;  4XDK A;  2M7W A;  3WG7 C;  1VQ4 V;  2P90 A;  4R50 A;  2XOK G;  5B1O A;  3AG1 B;  1BHB A;  1SRY A;  3CCM V;  5CA3 A;  2JEX A;  5HFL A;  3G6E V;  3E83 A;  4QNH B;  2DYS B;  1E1Q G;  1F4N A;  5DN6 G;  1L1F A;  3ABT A;  4GX0 A;  1K3E A;  3H01 A;  1V54 C;  2QM8 A;  2HKO A;  3E8B A;  3ABL C;  4PDR A;  3CCU V;  1VQ6 V;  4DO2 A;  1VQK V;  5CN0 A;  2GHY A;  3TK1 A;  5B1N A;  2Z5U A;  2C2A A;  1OCO C;  3SPJ A;  4ASU G;  1Q7Y W;  4BIZ A;  5L3C A;  4GX5 A;  3OR6 C;  2B1I A;  2EIK B;  3JD2 A;  1HWY A;  1NH2 D;  2DQ3 A;  3SPC A;  2W6I G;  1QLE C;  5B1B C;  4JPR A;  2Y69 B;  1TUE B;  2Z3Y A;  1YSC A;  2WSS G;  4JTA B;  5B1B B;  1AJQ A;  5EBW C;  4BIU A;  1EZJ A;  1JOY A;  1K73 W;  3E2E A;  1M57 B;  1Y4M A;  5L3F A;  3R65 A;  3CCE V;  1R3J C;  1SES A;  1ENV A;  3JD1 A;  1P4R A;  4WFE A;  1K34 A;  3IC7 A;  3ZN1 A;  2BOC C;  4J9Y B;  4PA7 A;  2EIJ C;  1FXV A;  3E8H A;  3LDD A;  3T4D A;  3CMA V;  4BW5 A;  2WWW A;  4G2K A;  4R8C A;  1GM7 A;  2OT5 A;  1FXK C;  4J9Z B;  4I9W A;  1H38 A;  4P9O A;  1S0V A;  3QO5 A;  3ZMU A;  2JJ1 G;  4JYC A;  1S76 D;  4Q20 A;  2NNU A;  3LSS A;  4WFB V;  2GSM B;  1Q81 W;  4CBC A;  1OCO B;  4JGS A;  3D3I A;  2X6B A;  1ARO P;  3K0G A;  3SJQ C;  5H6Q A;  2P67 A;  1H8H G;  4U7O A;  1V55 B;  5LGT A;  3AG2 B;  1FS0 G;  1R6N A;  3GB7 C;  4P30 A;  5B1A B;  4WFA V;  3OE7 G;  3A0R A;  3AG2 C;  4I5S A;  2DYS C;  3IFX A;  1FXK A;  3JD0 A;  3VBB A;  2KB1 A;  3ZMV A;  3CCQ V;  2HJF C;  2DQ0 A;  2X0L A;  1DF4 A;  2EZO A;  4QPK A;  4RO2 A;  4DXW A;  2JEU A;  2A0L A;  1G8M A;  2Q6A A;  3B8M A;  3BEH A;  2EIL C;  3LDC A;  1RPO A;  1YI2 V;  4MSW C;  1GTO A;  3QO8 A;  2EIM B;  1AI7 A;  4TWK A;  1QLE B;  1K33 A;  2QM7 A;  4FK5 C;  1OCC B;  1YTF B;  1K5Q A;  2WLJ A;  4H33 A;  5DM6 V;  3G4S V;  1GK9 A;  1CEZ A;  3ABM B;  1NQT A;  4MVO A;  2WLN A;  4JTC B;  1JQ0 A;  4MW8 A;  3AG4 B;  1KC8 W;  1VQO V;  2DYR C;  3CD6 V;  2QTO A;  1E1R G;  3FB5 C;  3ZRV A;  1NR1 A;  2HVJ C;  2B5U A;  1P7B A;  1K4D C;  5KUK A;  1GM9 A;  1WLE A;  3F7V C;  3CCJ V;  3CC4 V;  4XDL A;  1QVF U;  1QVG U;  4TSF G;  2X6A A;  4MVQ A;  5H6R A;  3SPG A;  1RM1 B;  2JDI G;  3ASO C;  3FYE B;  1CPY A;  2ZDI A;  1FXK B;  2UXX A;  3ZIA G;  1R73 A;  3OMN B;  1Y66 A;  2XAS A;  2XND G;  3VOU A;  5E1A C;  4X89 A;  3DTU B;  4G27 B;  1K97 A;  2ZQM A;  4LCU C;  5CMU A;  5KA5 A;  4RQE A;  1YHQ V;  2IJI A;  2AHZ A;  1BMF G;  2EZP A;  2B1G A;  1M9N A;  3ETD A;  3FYI B;  4QIW F;  3ABM C;  4QE9 A;  3ABK B;  2W6J G;  4WFG A;  2X6C A;  4MW3 A;  1R3K C;  1K9M W;  1M57 C;  2V7Q G;  3ASN C;  4KP4 A;  4UUJ C;  4MVR A;  4UV9 A;  3T1C A;  5GW7 A;  2IH1 C;  2WLH A;  3OUS A;  1FFT B;  4RUE A;  3MHS C;  3B8N A;  2XAQ A;  3M99 B;  2BOB C;  1PNK A;  4HAM A;  3OGC C;  1S72 V;  3SYQ A;  1OCZ B;  4E2L A;  5EBM C;  4MS2 A;  2HFE C;  2ZDI C;  1DTO A;  1SER A;  2YSU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...