1KDGA

Crystal structure of the flavin domain of cellobiose dehydrogenase
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
541
structure length
541
Chain Sequence
TPYDYIIVGAGPGGIIAADRLSEAGKKVLLLERGGPSTKQTGGTYVAPWATSSGLTKFDIPGLFESLFTDSNPFWWCKDITVFAGCLVGGGTSVNGALYWYPNDGDFSSSVGWPSSWTNHAPYTSKLSSRLPSTDHPSTDGQRYLEQSFNVVSQLLKGQGYNQATINDNPNYKDHVFGYSAFDFLNGKRAGPVATYLQTALARPNFTFKTNVMVSNVVRNGSQILGVQTNDPTLGPNGFIPVTPKGRVILSAGAFGTSRILFQSGIGPTDMIQTVQSNPTAAAALPPQNQWINLPVGMNAQDNPSINLVFTHPSIDAYENWADVWSNPRPADAAQYLANQSGVFAGASPKLNFWRAYSGSDGFTRYAQGTVRPGAASVNSSLPYNASQIFTITVYLSTGIQSRGRIGIDAALRGTVLTPPWLVNPVDKTVLLQALHDVVSNIGSIPGLTMITPDVTQTLEEYVDAYDPATMNSNHWVSSTTIGSSPQSAVVDSNVKVFGTNNLFIVDAGIIPHLPTGNPQGTLMSAAEQAAAKILALAGGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Flavoprotein Domain of the Extracellular Flavocytochrome Cellobiose Dehydrogenase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords cellobiose dehydrogenase
total genus 190
structure length 541
sequence length 541
chains with identical sequence B
ec nomenclature ec 1.1.99.18: Cellobiose dehydrogenase (acceptor).
pdb deposition date 2001-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00732 GMC_oxred_N GMC oxidoreductase
A PF05199 GMC_oxred_C GMC oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.410.10 Alpha Beta 2-Layer Sandwich Cholesterol Oxidase; domain 2 Cholesterol Oxidase; domain 2 1kdgA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1kdgA01
3AE2A 1ZK7A 2XVHA 2GRTA 5U63A 1KNRA 4M52A 4YSHA 3AECA 4YSYA 4AT0A 1EL9A 3GRSA 3FG2P 2CULA 1VDCA 2BC0A 1FOHA 3SM8A 4REKA 3REDA 1L9DA 2TMDA 1F3PA 5KOXA 1B4VA 2C3DA 1GOSA 2VRMA 3C4AA 4EMIA 2WS3A 1Q9IA 1F8SA 4GF7A 2H88A 4H2QA 1IUTA 3KKJA 1DOEA 3OC4A 4USRA 1GRGA 4EQRA 2AAQA 2GVCA 4NZHA 4CRTA 1RYIA 1H6VA 2YG5A 4CY6A 4AT2A 2GQFA 3M13A 2BK4A 3AE5A 5C3JA 4IV9A 2XYOA 2BXRA 4YKGA 1DOCA 1M64A 5M0ZA 2XLRA 4I58A 4K8DA 2FJAA 1K0JA 1H86A 4TM3A 4C3YA 3AD7B 5JCMA 1QLBA 4LU6A 3NK1X 3G5SA 3P1WA 3DJJA 2YAUA 1EL7A 2R0CA 4C3XA 2EQ6A 2WPCA 3D1CA 3IC9A 1OJDA 1GRFA 2XVEA 4A7AA 3AXBA 2B7RA 2QAEA 1LJ1A 2Y6RA 3QVPA 3QJ4A 3F8DA 3KA7A 2JKCA 3AEAA 4C77A 2OAMA 4Z2TA 2GH5A 4GDEA 3KU9A 1F8WA 3NTAA 5JCIA 4JN9A 2V61A 3AEGA 2QCUA 2RGJA 4USQA 1Q1RA 1NEKA 5KVHA 3CTYA 4MJWA 1CBOA 4GR1A 4TM4A 2VVMA 5HXIA 3VRAA 3WE0A 3LADA 1B5QA 3K30A 1EL5A 3P4RA 3AE7A 4EQXA 2JAEA 1E39A 5J60A 2C7GA 2NVKX 2DKIA 3BI4A 1PJ6A 1IUVA 3AD8B 3H8IA 4H4TA 3AEFA 4E0VA 2GR3A 2VQ7A 4YTNA 1H84A 5BRTA 2R4EA 3UOYA 1CHUA 2JB1A 3PVCA 5KWFA 3F8PA 1H7XA 1KFYA 2YLSA 4OPDA 3O0HA 3SFDA 2FJDA 2XFQA 3LZWA 3NG7X 4H4PA 1JEHA 2Q0LA 4TLXA 4B69A 3CNPA 4A79A 3CPJG 2WPEA 2YLTA 3FPZA 4NTDA 5HY5A 2Z5XA 2H89A 2BABA 2XFPA 2V3AA 3CNDA 1BZLA 4Z2RA 1NG3A 3UCLA 1PXCA 1S2QA 2FBWA 4NTCA 1NG4A 3L1RA 4Y4MA 4H4YA 3DH9A 4H2PA 3GD4A 1E1KA 3GDNA 2FJBA 3GMCA 4NTEA 3NGCX 3PS9A 5FS8A 4IA5A 4JNAA 3NIXA 1ZKQA 1LTXR 2GR1A 3FIMB 3UKHA 3AYIA 2WDVA 4U8PA 4TM1A 2C65A 4DNAA 1CC4A 2ZBWA 1K0IA 1E1NA 3NTDA 3S5WA 4OPIA 3AEDA 3KLJA 1N4WA 2FJEA 4IVMB 3H4KA 2I0ZA 3K7TA 2Y6QA 4Z43A 4U2SA 1DXLA 3NYCA 1LV0A 4X9MA 1D4CA 1CJ2A 2WQYA 4B64A 1CF3A 2VRLA 1E7PA 3IWAA 1K4QA 4UDRA 4Y4LA 1CJ4A 3FMWA 3ISHA 2QA2A 4OPUA 3GSIA 1S3EA 3RHAA 3AE9A 4J56A 3QSSA 3IF9A 2F5ZA 1KSUA 1ZY8A 1GRTA 5J7XA 2X8CA 4WX1A 1H81A 3P4QA 3KD9A 3ALJA 2V5ZA 4B63A 4LA1A 3UTFA 1GESA 3BHKA 1YQ4A 4BJYA 1ONFA 1DJNA 4A6NA 1ELIA 2JK6A 1W4XA 3EPTA 3NNEA 5U1OA 3DGHA 3ZYXA 3AD9B 4EQSA 3FBSA 1DJQA 1UKVG 2GMHA 2E1MA 2B76A 2X50A 3CNJA 3LB8A 2YLWA 5JCLA 3NK0X 1IUWA 3NT6A 3GYJA 1MOKA 4U8KA 4ADWA 3AE3A 5GSNA 1NHPA 3DK4A 4HA6A 4U8MA 5U25A 1GALA 3UP5A 3CGCA 4HB9A 4OPLA 2X8HA 1PBDA 3ABVA 4UDPA 2UZZA 3Q9TA 2GR2A 3UKFA 4B1BA 4LIIA 2XVIA 3SGLA 3NKSA 2WEUA 1GERA 2XDOA 2R45A 3HZLA 2X3NA 1NHQA 1IUSA 4EMWA 2WOWA 1IJHA 4AP1A 4AOXA 4ZCDA 2VQBA 2X99A 3URHA 2GAGB 3CN8A 3LXDA 3QSMA 1VG0A 2BS4A 1MXTA 4JNQA 2GEWA 3ALLA 3I3LA 4UDQA 3KPFA 5CQFA 1F6MA 4BK3A 1DOBA 4NEWA 4ECHA 2BK5A 1FCDA 2R0PA 4YKFA 3EAOA 3UKAA 2R0GA 4BURA 4YTPA 1ZOVA 5KRQA 3K7QX 2WBAA 2BS3A 3M0OA 2B9YA 4TM0A 2BC1A 3KVEA 3SFEA 4C74A 2C66A 3QFAA 2YWLA 3Q6JA 3LJPA 3LOVA 1GRBA 2GB0A 4DSGA 4Z25A 1GXFA 2RGHA 4B66A 4CBQA 3K7MX 2ARDA 4XXGA 1BF3A 1K0LA 1XPQA 2YLRA 4N9XA 3GYIA 2C73A 2Q0KA 1TDNA 2ZZBA 2IIDA 4YWOA 4JQ9A 1OJ9A 1YQ3A 3ADAB 1PBFA 2YVGA 1Z6LA 3GWFA 1NENA 5CKUA 1PXBA 2RABA 5FS9A 3F8RA 1EBDA 1L9CA 3CPIG 2JB3A 3NH3X 5JCKA 4FDCB 4K7ZA 2BK3A 2YG4A 2GF3A 2WHDA 2YG6A 5M10A 1BGNA 2OALA 2BS2A 3AE4A 2WP6A 4PABA 3CNTA 1OJCA 4GDPA 3UP4A 4A9WA 3V76A 4RSLA 1GSNA 1NDAA 1NAAA 3UKKA 3CGDA 1L0VA 4AP3A 3II4A 1BKWA 1QJDA 1S3BA 1ZOYA 2A89A 2EQ7A 4K5RA 4AOSA 1RSGA 4B65A 4D04A 2C75A 3GWDA 4JY2A 1PDHA 3UOVA 4H4WA 1GTHA 1VQWA 1GRHA 3NN6X 4BJZA 5IQ4A 4RG3A 3D8XA 4CY8A 1GNDA 2XLUA 1M6IA 3G5QA 4H4RA 3AEEA 2AQJA 1PHHA 1PS9A 1Y56B 2R46A 3DJDA 5HHFA 3UKLA 3UTHA 1JRZA 1PJ5A 1REOA 3CNSA 3DK8A 1PBEA 1JOAA 2TPRA 1XDIA 3BNMA 2Q7VA 1HYUA 4B67A 3OZ2A 4FX9A 1LQUA 1DNCA 1FL2A 1KSSA 1ZP0A 3V3OA 1B8SA 2XLPA 3ATRA 2GAHB 1D5TA 1GPEA 2BA9A 2R9ZA 1NPXA 4YT0A 3UTGA 4H4VA 3RP8A 3COXA 5EBKA 5FS6A 1E6EA 3VRDB 1N4UA 1GV4A 3RP6A 3GMBA 1PBCA 4KPRA 4Z2UA 1TYTA 2AR8A 1DODA 2YR6A 4EM3A 1TDKA 4Z44A 3V3NA 2XCGA 1O5WA 2A8XA 3E1TA 2YR5A 5L46A 2J3NA 4IA6A 2C76A 3AEBA 1N4VA 1LQTA 4BK2A 2XVFA 2YVJA 1JNRA 2OLNA 2BCPA 3CGBA 3C4NA 4Y4NA 1AOGA 5KOWA 5FMHA 5IQ1A 5EB5A 3CIRA 1JRYA 3VQRA 5HYMA 4H4QA 4RG4A 1GT8A 2YQUA 2B9WA 2EQ8A 2WETA 4FK1A 3BHFA 2WU2A 4XWRA 5ER0A 2OA1A 1GEUA 4GCMA 4I59A 3M12A 2YR4A 1O94A 3SQPA 4A65A 4U8LA 1H7WA 4Z24A 2JBVA 1IUUA 4DSHA 2GQWA 5TR3A 1D7YA 2YG3A 3P9UA 5IPYA 3JSKA 5C2TA 3ALMA 4JY3A 1X31B 1Y56A 1EL8A 3DK9A 1D4EA 4FK1C 3RP7A 1CJCA 2WESA 3IHGA 2YG7A 2C3CA 1PXAA 1FEAA 3L8KA 5GRTA 5BUKA 1GETA 2BCGG 4B68A 2CDUA 4X9NA 1Y0PA 2GV8A 4H4XA 2YLZA 4J36A 4OPTA 1JU2A 4D03A 4OPCA 4CCRA 4YTMA 2VZ2A 2VVLA 4TLZA 1RP0A 4YSZA 2BYBA 2OLOA 1TRBA 2C72A 1P2HA 2WU5A 2XFOA 2ZZ0A 2C64A 1CL0A 3EANA 2PHHA 3GD3A 4U8JA 4CNKA 1QO8A 2V6OA 3NK2X 4APNA 4OCGA 5EB4A 2BXSA 2YLXA 1ZMDA 1TDFA 1NHSA 4DGKA 2O9ZA 1VG9A 1BWCA 3BNUA 5KXJA 4J33A 4BK1A 1JNZA 3AE1A 4CCQA 1TDEA 3GRTA 5EOWA 2DKHA 2GMJA 3IHMA 4YXDA 3BI2A 3B6DA 2BACA 2E5VA 1N1PA 4U2LA 1ZX9A 3PO7A 2IVEA 3VR9A 3NRNA 3EF6A 3NN0X 1LVLA 1E1MA 1KNPA 1OJAA 1E1LA 2W0HA 3UKQA 1YY5A 1PBBA 4H7UA 4CNJA 1F8RA 3UKPA 1YKJA 4P9SA 2XLSA 5FS7A 3DJEA 1V59A 5DBJA 1BGJA 4A6NB 4OVIA 4PAAA 5BULA 4ICYA 2C67A 2PYXA 1JRXA 4H4SA 2WDQA 1S2YA 2Z5YA 3QFBA 3QSEA 1XANA 4J31A 3DMEA 2R4JA 4ZCCA 4YSXA 3ITJA 1NHRA 2GR0A 3B3RA 2Q6UA 4O5UA 2NPXA 4H4ZA 4K22A 2WP9A 4A99A 4GUVA 3AE6A 4JDRA 2RGOA 3CPHG 3ICRA 3DGZA 4WCTA 2VVLG 4A5LA 1ZDLA 2V60A 4EIPA 2QA1A 4UP3A 3UOXA 1ZMCA 2ACZA 2CFYA 4U8IA 1CC2A 4J34A 1IUXA 2WP5A 4Z26A 1D4DA 2A87A 3AB1A 3DJGX 1CC6A 3NHOX 2WPFA 1MO9A 1Q1WA 3AE8A 3UTEA 1SEZA 2APGA 3AWIA 2WDRA 3ZDNA 1CJ3A 2B7SA 1TDOA 1O95A 4XWZA 1PN0A 2E4GA 1TYPA 1GTEA 4EMJA 3H8LA 1LPFA 3QVRA 3UOZA 2XVJA 4O5QA 2XFUA 1YQZA 3I6DA 3GDPA 3P4PA 2JB2A 4ZN0A 5JCNA 1KDGA 1COYA 2C70A 1KF6A 4EM4A 2B9XA 4U8OA 5KVIA 1FECA 2CVJA 5BVAA 1FEBA 2YM2A 3R9UA 1H82A 3VRBA 1D7LA 2YM1A 2VOUA 3VR8A 3C96A 4OPGA 4K2XA 3LZXA 4H4UA 2XFNA 1XHCA 3G5RA 3ICSA 4H50A 4X4JA 2EQ9A 2X8GA 4U8NA 4EQWA 2V3BA 3NYEA 3T37A 4H2RA 4KX6A 4BV6A 1GRAA 2WOIA 1OJTA 4EIQA 4C5OA 1B37A 3DA1A 3NLCA 4H2NA 4GRTA 3P4SA 3NYFA 4K5SA 1GREA 1PJ7A 2XLTA 3ICTA 3AYLA 2HQMA 3AYJA 4J57A 2WOVA 4U2TA 1H83A 3S61A 2YVFA 1P2EA 3ATQA 4IVOB 2IVDA 3CGEA 4J2WA 4NEVA 1L9EA 2ZZCA 3RNMA 5LV9A 1VRQB 3BI5A
chains in the Genus database with same CATH superfamily
3AE2A 1ZK7A 2XVHA 2GRTA 5U63A 1KNRA 4M52A 4YSHA 3AECA 4YSYA 4AT0A 1EL9A 3GRSA 3FG2P 2CULA 1VDCA 2BC0A 1FOHA 3SM8A 4REKA 3REDA 1L9DA 2TMDA 1F3PA 5KOXA 1B4VA 2C3DA 1GOSA 2VRMA 3C4AA 3GYXA 4EMIA 2WS3A 1Q9IA 1F8SA 4GF7A 5KNLA 2H88A 4H2QA 1IUTA 3KKJA 1DOEA 3OC4A 3T2YA 4USRA 1GRGA 4EQRA 2AAQA 2GVCA 4NZHA 4CRTA 1RYIA 1H6VA 2YG5A 4CY6A 4AT2A 2GQFA 3M13A 2BK4A 3AE5A 5C3JA 4IV9A 2XYOA 2BXRA 4YKGA 1DOCA 1M64A 5M0ZA 2XLRA 4I58A 4K8DA 2FJAA 1K0JA 1H86A 4TM3A 4C3YA 3AD7B 5JCMA 1QLBA 4LU6A 3NK1X 3G5SA 3P1WA 3DJJA 2YAUA 1EL7A 2R0CA 4C3XA 2EQ6A 2WPCA 3D1CA 3IC9A 1OJDA 1GRFA 2XVEA 4A7AA 3AXBA 2B7RA 4G6GA 2QAEA 1LJ1A 2Y6RA 3QVPA 3QJ4A 3F8DA 3KA7A 2JKCA 3AEAA 4C77A 2OAMA 4Z2TA 2GH5A 4GDEA 3KU9A 1F8WA 3NTAA 5JCIA 4JN9A 2V61A 3AEGA 3SZWA 2QCUA 2RGJA 4USQA 1Q1RA 1NEKA 5KVHA 3CTYA 4MJWA 1CBOA 4GR1A 4II2A 2VVMA 4TM4A 5HXIA 3VRAA 3WE0A 3LADA 1B5QA 3K30A 1EL5A 3P4RA 3AE7A 4EQXA 2JAEA 1E39A 5J60A 2C7GA 2NVKX 2DKIA 3BI4A 1PJ6A 1IUVA 3AD8B 3H8IA 4H4TA 3AEFA 4E0VA 2GR3A 2VQ7A 4YTNA 1H84A 5BRTA 2R4EA 3UOYA 1CHUA 2JB1A 3PVCA 5KWFA 3F8PA 1H7XA 1KFYA 2YLSA 4G6HA 4OPDA 3O0HA 3SFDA 2FJDA 2XFQA 3LZWA 3NG7X 4H4PA 1JEHA 2Q0LA 4TLXA 4B69A 3CNPA 4A79A 3CPJG 2WPEA 3CMMA 2YLTA 3FPZA 4NTDA 5HY5A 2Z5XA 2H89A 2BABA 2XFPA 2V3AA 3CNDA 1BZLA 4Z2RA 1NG3A 3UCLA 1PXCA 1S2QA 2FBWA 4NTCA 1NG4A 3L1RA 4Y4MA 4H4YA 3DH9A 4H2PA 3GDNA 1E1KA 3GD4A 2FJBA 3GMCA 4NTEA 3NGCX 3PS9A 5FS8A 4IA5A 4JNAA 3NIXA 1ZKQA 1LTXR 2GR1A 3FIMB 3T14A 3UKHA 3AYIA 2WDVA 4U8PA 4TM1A 2C65A 4DNAA 1CC4A 2ZBWA 1K0IA 1E1NA 3NTDA 3S5WA 4OPIA 3AEDA 3KLJA 1N4WA 2FJEA 4IVMB 3H4KA 2I0ZA 3K7TA 2Y6QA 4Z43A 4U2SA 1DXLA 3NYCA 1LV0A 4X9MA 1D4CA 1CJ2A 2WQYA 4B64A 1CF3A 2VRLA 1E7PA 3IWAA 1K4QA 4UDRA 4Y4LA 1CJ4A 3FMWA 3ISHA 2QA2A 4OPUA 3GSIA 1S3EA 3RHAA 3AE9A 4II3A 4J56A 3QSSA 3IF9A 2F5ZA 1KSUA 1ZY8A 1GRTA 5J7XA 2X8CA 4WX1A 1H81A 3P4QA 3KD9A 3ALJA 2V5ZA 4B63A 4LA1A 3UTFA 1GESA 3BHKA 1YQ4A 3T2KA 1ONFA 1DJNA 4BJYA 4A6NA 3NNEA 1ELIA 1W4XA 2JK6A 3EPTA 5U1OA 3DGHA 3ZYXA 3AD9B 4EQSA 3FBSA 1DJQA 1UKVG 2GMHA 2E1MA 2B76A 2X50A 3CNJA 3LB8A 4GAVA 2YLWA 5JCLA 3NK0X 1IUWA 3NT6A 3GYJA 1MOKA 4U8KA 4ADWA 3AE3A 5GSNA 1NHPA 3DK4A 4HA6A 4U8MA 5U25A 1GALA 3UP5A 3CGCA 4HB9A 4OPLA 2X8HA 1PBDA 4UDPA 3ABVA 2UZZA 3Q9TA 2GR2A 3UKFA 4B1BA 4LIIA 2XVIA 3SGLA 3NKSA 2WEUA 1GERA 2XDOA 2R45A 3HZLA 4NNJA 2X3NA 1NHQA 1IUSA 4EMWA 2WOWA 1IJHA 4AP1A 4AOXA 4ZCDA 2VQBA 2X99A 3URHA 2GAGB 3CN8A 3LXDA 3QSMA 1VG0A 2BS4A 1MXTA 4JNQA 2GEWA 3ALLA 4UDQA 3I3LA 3KPFA 5CQFA 1F6MA 4BK3A 1DOBA 4NEWA 4ECHA 2BK5A 1FCDA 2R0PA 4YKFA 3EAOA 3UKAA 2R0GA 4BURA 4YTPA 1ZOVA 5KRQA 3K7QX 2WBAA 2BS3A 3M0OA 2B9YA 4TM0A 2BC1A 3KVEA 3SFEA 4C74A 2C66A 3QFAA 2YWLA 3Q6JA 3LJPA 3LOVA 1GRBA 2GB0A 4DSGA 4Z25A 1GXFA 2RGHA 4B66A 4CBQA 3K7MX 2ARDA 4XXGA 1BF3A 1K0LA 1XPQA 2YLRA 4N9XA 3T2ZA 3GYIA 2C73A 2BRAA 2Q0KA 1TDNA 2ZZBA 2IIDA 4YWOA 4JQ9A 1OJ9A 1YQ3A 3ADAB 1PBFA 3SZ0A 2YVGA 1Z6LA 3GWFA 1NENA 5CKUA 1PXBA 2RABA 5FS9A 3F8RA 1EBDA 1L9CA 3SYIA 3CPIG 2JB3A 3NH3X 5JCKA 4FDCB 4K7ZA 2BK3A 2YG4A 2GF3A 2WHDA 2YG6A 5M10A 1BGNA 2OALA 2BS2A 3AE4A 2WP6A 4PABA 3CNTA 1OJCA 4GDPA 3UP4A 4A9WA 3V76A 4RSLA 1GSNA 1NDAA 1NAAA 3UKKA 3CGDA 1L0VA 4AP3A 3II4A 1BKWA 1QJDA 1S3BA 1ZOYA 2A89A 2EQ7A 4K5RA 4AOSA 1RSGA 4B65A 4D04A 2C75A 3GWDA 4JY2A 1PDHA 3UOVA 4H4WA 1GTHA 1VQWA 1GRHA 3NN6X 4BJZA 5IQ4A 4RG3A 3KPKA 3D8XA 4CY8A 1GNDA 2XLUA 1M6IA 3G5QA 4H4RA 3AEEA 2AQJA 1PHHA 1PS9A 1Y56B 2R46A 3DJDA 5HHFA 3UKLA 3UTHA 1JRZA 1PJ5A 1REOA 3CNSA 3DK8A 1PBEA 1JOAA 2TPRA 1XDIA 3BNMA 2Q7VA 5KMPA 1HYUA 5KMQA 4B67A 3OZ2A 4FX9A 1LQUA 1DNCA 1FL2A 1KSSA 1ZP0A 3V3OA 1B8SA 2XLPA 3ATRA 2GAHB 1D5TA 1GPEA 2BA9A 2R9ZA 1NPXA 4YT0A 3UTGA 4H4VA 3RP8A 3COXA 5EBKA 5FS6A 1E6EA 3VRDB 1N4UA 1GV4A 3RP6A 3GMBA 1PBCA 4KPRA 4Z2UA 1TYTA 3T0KA 2AR8A 1DODA 2YR6A 4EM3A 1TDKA 4Z44A 3V3NA 2XCGA 1O5WA 2A8XA 2C4CA 3E1TA 3HYXA 2YR5A 3HYVA 5L46A 2J3NA 4IA6A 2C76A 3AEBA 1N4VA 1LQTA 4BK2A 2XVFA 2YVJA 1JNRA 2OLNA 2BCPA 3CGBA 3C4NA 4Y4NA 1AOGA 5KOWA 5FMHA 5IQ1A 5EB5A 3CIRA 1JRYA 3VQRA 5HYMA 4H4QA 4RG4A 1GT8A 2YQUA 2B9WA 2EQ8A 2WETA 4FK1A 3BHFA 5KMSA 2WU2A 4XWRA 5ER0A 2OA1A 1GEUA 4GCMA 4I59A 3M12A 2YR4A 1O94A 3SQPA 4A65A 4U8LA 1H7WA 4Z24A 2JBVA 1IUUA 4DSHA 2GQWA 3HYWA 5TR3A 1D7YA 2YG3A 3P9UA 5IPYA 3JSKA 5C2TA 3ALMA 4JY3A 1X31B 1Y56A 1EL8A 3DK9A 1D4EA 4FK1C 3RP7A 1CJCA 2WESA 3SZFA 3IHGA 2YG7A 2BRYA 2C3CA 1PXAA 1FEAA 4G74A 3L8KA 5GRTA 5BUKA 1GETA 2BCGG 4B68A 2CDUA 4X9NA 1Y0PA 2GV8A 4H4XA 2YLZA 4J36A 4OPTA 1JU2A 4D03A 4OPCA 4CCRA 4YTMA 2VZ2A 2VVLA 4TLZA 1RP0A 3SZCA 4YSZA 2BYBA 2OLOA 1TRBA 2C72A 1P2HA 2WU5A 2XFOA 2ZZ0A 2C64A 1CL0A 3EANA 2PHHA 3GD3A 4U8JA 4CNKA 1QO8A 2V6OA 3NK2X 4GAPA 4APNA 4OCGA 5EB4A 2BXSA 2YLXA 1ZMDA 5KMRA 1TDFA 1NHSA 4DGKA 2O9ZA 1VG9A 1BWCA 3BNUA 5KXJA 4J33A 4BK1A 1JNZA 3AE1A 4CCQA 1TDEA 3GRTA 5EOWA 2DKHA 2GMJA 3IHMA 4YXDA 3BI2A 3B6DA 2BACA 2E5VA 1N1PA 4U2LA 1ZX9A 3PO7A 2IVEA 3VR9A 3NRNA 3EF6A 3NN0X 1LVLA 1E1MA 1KNPA 1OJAA 1E1LA 2W0HA 3UKQA 1YY5A 1PBBA 4H7UA 4CNJA 1F8RA 3UKPA 1YKJA 4P9SA 2XLSA 5FS7A 3DJEA 1V59A 4G73A 3SX6A 3SY4A 5DBJA 1BGJA 4G9KA 4A6NB 4OVIA 3SXIA 4PAAA 5BULA 4ICYA 2C67A 2PYXA 1JRXA 4H4SA 2WDQA 1S2YA 2Z5YA 3QFBA 3QSEA 1XANA 4J31A 3DMEA 2R4JA 4ZCCA 4YSXA 3ITJA 1NHRA 2GR0A 3B3RA 2Q6UA 4O5UA 2NPXA 4H4ZA 4K22A 2WP9A 4A99A 4GUVA 3AE6A 4JDRA 2RGOA 3CPHG 3ICRA 3DGZA 4WCTA 2VVLG 4A5LA 1ZDLA 2V60A 4EIPA 2QA1A 4UP3A 3UOXA 1ZMCA 2ACZA 2CFYA 4U8IA 1CC2A 4J34A 1IUXA 2WP5A 4Z26A 1D4DA 2A87A 3AB1A 3DJGX 1CC6A 3NHOX 2WPFA 1MO9A 1Q1WA 3AE8A 3UTEA 1SEZA 2APGA 3AWIA 2WDRA 3ZDNA 1CJ3A 2B7SA 1TDOA 1O95A 4XWZA 1PN0A 2E4GA 1TYPA 1GTEA 4EMJA 3H8LA 1LPFA 3QVRA 3UOZA 2XVJA 4O5QA 2XFUA 1YQZA 3I6DA 3GDPA 3P4PA 2JB2A 4NWZA 4ZN0A 5JCNA 1KDGA 1COYA 2C70A 1KF6A 4EM4A 2B9XA 4U8OA 5KVIA 1FECA 2CVJA 5BVAA 1FEBA 2YM2A 3R9UA 1H82A 3VRBA 1D7LA 2YM1A 2VOUA 3VR8A 3C96A 4OPGA 4K2XA 3LZXA 4H4UA 2XFNA 1XHCA 3G5RA 3ICSA 4H50A 4X4JA 2EQ9A 2X8GA 4U8NA 4EQWA 2V3BA 3NYEA 3T37A 4H2RA 4KX6A 4BV6A 1GRAA 2WOIA 1OJTA 4EIQA 4C5OA 1B37A 3DA1A 3NLCA 4H2NA 3T31A 4GRTA 3P4SA 3NYFA 4K5SA 1GREA 1PJ7A 2XLTA 3ICTA 3AYLA 2HQMA 3AYJA 4J57A 2WOVA 4U2TA 1H83A 3S61A 2YVFA 1P2EA 3ATQA 4IVOB 2IVDA 3CGEA 4J2WA 4NEVA 1L9EA 2ZZCA 3RNMA 5LV9A 1VRQB 3BI5A
chains in the Genus database with same CATH topology
3AE2A 1ZK7A 2XVHA 2GRTA 5U63A 1KNRA 4M52A 4YSHA 3AECA 4YSYA 4AT0A 1EL9A 3GRSA 3FG2P 2CULA 1VDCA 2BC0A 1FOHA 3SM8A 4REKA 3REDA 1L9DA 2TMDA 1F3PA 5KOXA 1B4VA 2C3DA 1GOSA 2VRMA 3C4AA 3GYXA 4EMIA 2WS3A 1Q9IA 1F8SA 4GF7A 5KNLA 2H88A 4H2QA 1IUTA 3KKJA 1DOEA 3OC4A 3T2YA 4USRA 1GRGA 4EQRA 2AAQA 2GVCA 4NZHA 4CRTA 1RYIA 1H6VA 2YG5A 4CY6A 4AT2A 2GQFA 3M13A 2BK4A 3AE5A 5C3JA 4IV9A 2XYOA 2BXRA 4YKGA 1DOCA 1M64A 5M0ZA 2XLRA 4I58A 4K8DA 2FJAA 1K0JA 1H86A 4TM3A 4C3YA 3AD7B 5JCMA 1QLBA 4LU6A 3NK1X 3G5SA 3P1WA 3DJJA 2YAUA 1EL7A 2R0CA 4C3XA 2EQ6A 2WPCA 3D1CA 3IC9A 1OJDA 1GRFA 2XVEA 4A7AA 3AXBA 2B7RA 4G6GA 2QAEA 1LJ1A 2Y6RA 3QVPA 3QJ4A 3F8DA 3KA7A 2JKCA 3AEAA 4C77A 2OAMA 4Z2TA 2GH5A 4GDEA 3KU9A 1F8WA 3NTAA 5JCIA 4JN9A 2V61A 3AEGA 3SZWA 2QCUA 2RGJA 4USQA 1Q1RA 1NEKA 5KVHA 3CTYA 4MJWA 1CBOA 4GR1A 4II2A 2VVMA 4TM4A 5HXIA 3VRAA 3WE0A 3LADA 1B5QA 3K30A 1EL5A 3P4RA 3AE7A 4EQXA 2JAEA 1E39A 5J60A 2C7GA 2NVKX 2DKIA 3BI4A 1PJ6A 1IUVA 3AD8B 3H8IA 4H4TA 3AEFA 4E0VA 2GR3A 2VQ7A 4YTNA 1H84A 5BRTA 2R4EA 3UOYA 1CHUA 2JB1A 3PVCA 5KWFA 3F8PA 1H7XA 1KFYA 2YLSA 4G6HA 4OPDA 3O0HA 3SFDA 2FJDA 2XFQA 3LZWA 3NG7X 4H4PA 1JEHA 2Q0LA 4TLXA 4B69A 3CNPA 4A79A 3CPJG 2WPEA 3CMMA 2YLTA 3FPZA 4NTDA 5HY5A 2Z5XA 2H89A 2BABA 2XFPA 2V3AA 3CNDA 1BZLA 4Z2RA 1NG3A 3UCLA 1PXCA 1S2QA 2FBWA 4NTCA 1NG4A 3L1RA 4Y4MA 4H4YA 3DH9A 4H2PA 3GDNA 1E1KA 3GD4A 2FJBA 3GMCA 4NTEA 3NGCX 3PS9A 5FS8A 4IA5A 4JNAA 3NIXA 1ZKQA 1LTXR 2GR1A 3FIMB 3T14A 3UKHA 3AYIA 2WDVA 4U8PA 4TM1A 2C65A 4DNAA 1CC4A 2ZBWA 1K0IA 1E1NA 3NTDA 3S5WA 4OPIA 3AEDA 3KLJA 1N4WA 2FJEA 4IVMB 3H4KA 2I0ZA 3K7TA 2Y6QA 4Z43A 4U2SA 1DXLA 3NYCA 1LV0A 4X9MA 1D4CA 1CJ2A 2WQYA 4B64A 1CF3A 2VRLA 1E7PA 3IWAA 1K4QA 4UDRA 4Y4LA 1CJ4A 3FMWA 3ISHA 2QA2A 4OPUA 3GSIA 1S3EA 3RHAA 3AE9A 4II3A 4J56A 3QSSA 3IF9A 2F5ZA 1KSUA 1ZY8A 1GRTA 5J7XA 2X8CA 4WX1A 1H81A 3P4QA 3KD9A 3ALJA 2V5ZA 4B63A 4LA1A 3UTFA 1GESA 3BHKA 1YQ4A 3T2KA 1ONFA 1DJNA 4BJYA 4A6NA 3NNEA 1ELIA 1W4XA 2JK6A 3EPTA 5U1OA 3DGHA 3ZYXA 3AD9B 4EQSA 3FBSA 1DJQA 1UKVG 2GMHA 2E1MA 2B76A 2X50A 3CNJA 3LB8A 4GAVA 2YLWA 5JCLA 3NK0X 1IUWA 3NT6A 3GYJA 1MOKA 4U8KA 4ADWA 3AE3A 5GSNA 1NHPA 3DK4A 4HA6A 4U8MA 5U25A 1GALA 3UP5A 3CGCA 4HB9A 4OPLA 2X8HA 1PBDA 4UDPA 3ABVA 2UZZA 3Q9TA 2GR2A 3UKFA 4B1BA 4LIIA 2XVIA 3SGLA 3NKSA 2WEUA 1GERA 2XDOA 2R45A 3HZLA 4NNJA 2X3NA 1NHQA 1IUSA 4EMWA 2WOWA 1IJHA 4AP1A 4AOXA 4ZCDA 2VQBA 2X99A 3URHA 2GAGB 3CN8A 3LXDA 3QSMA 1VG0A 2BS4A 1MXTA 4JNQA 2GEWA 3ALLA 4UDQA 3I3LA 3KPFA 5CQFA 1F6MA 4BK3A 1DOBA 4NEWA 4ECHA 2BK5A 1FCDA 2R0PA 4YKFA 3EAOA 3UKAA 2R0GA 4BURA 4YTPA 1ZOVA 5KRQA 3K7QX 2WBAA 2BS3A 3M0OA 2B9YA 4TM0A 2BC1A 3KVEA 3SFEA 4C74A 2C66A 3QFAA 2YWLA 3Q6JA 3LJPA 3LOVA 1GRBA 2GB0A 4DSGA 4Z25A 1GXFA 2RGHA 4B66A 4CBQA 3K7MX 2ARDA 4XXGA 1BF3A 1K0LA 1XPQA 2YLRA 4N9XA 3T2ZA 3GYIA 2C73A 2BRAA 2Q0KA 1TDNA 2ZZBA 2IIDA 4YWOA 4JQ9A 1OJ9A 1YQ3A 3ADAB 1PBFA 3SZ0A 2YVGA 1Z6LA 3GWFA 1NENA 5CKUA 1PXBA 2RABA 5FS9A 3F8RA 1EBDA 1L9CA 3SYIA 3CPIG 2JB3A 3NH3X 5JCKA 4FDCB 4K7ZA 2BK3A 2YG4A 2GF3A 2WHDA 2YG6A 5M10A 1BGNA 2OALA 2BS2A 3AE4A 2WP6A 4PABA 3CNTA 1OJCA 4GDPA 3UP4A 4A9WA 3V76A 4RSLA 1GSNA 1NDAA 1NAAA 3UKKA 3CGDA 1L0VA 4AP3A 3II4A 1BKWA 1QJDA 1S3BA 1ZOYA 2A89A 2EQ7A 4K5RA 4AOSA 1RSGA 4B65A 4D04A 2C75A 3GWDA 4JY2A 1PDHA 3UOVA 4H4WA 1GTHA 1VQWA 1GRHA 3NN6X 4BJZA 5IQ4A 4RG3A 3KPKA 3D8XA 4CY8A 1GNDA 2XLUA 1M6IA 3G5QA 4H4RA 3AEEA 2AQJA 1PHHA 1PS9A 1Y56B 2R46A 3DJDA 5HHFA 3UKLA 3UTHA 1JRZA 1PJ5A 1REOA 3CNSA 3DK8A 1PBEA 1JOAA 2TPRA 1XDIA 3BNMA 2Q7VA 5KMPA 1HYUA 5KMQA 4B67A 3OZ2A 4FX9A 1LQUA 1DNCA 1FL2A 1KSSA 1ZP0A 3V3OA 1B8SA 2XLPA 3ATRA 2GAHB 1D5TA 1GPEA 2BA9A 2R9ZA 1NPXA 4YT0A 3UTGA 4H4VA 3RP8A 3COXA 5EBKA 5FS6A 1E6EA 3VRDB 1N4UA 1GV4A 3RP6A 3GMBA 1PBCA 4KPRA 4Z2UA 1TYTA 3T0KA 2AR8A 1DODA 2YR6A 4EM3A 1TDKA 4Z44A 3V3NA 2XCGA 1O5WA 2A8XA 2C4CA 3E1TA 3HYXA 2YR5A 3HYVA 5L46A 2J3NA 4IA6A 2C76A 3AEBA 1N4VA 1LQTA 4BK2A 2XVFA 2YVJA 1JNRA 2OLNA 2BCPA 3CGBA 3C4NA 4Y4NA 1AOGA 5KOWA 5FMHA 5IQ1A 5EB5A 3CIRA 1JRYA 3VQRA 5HYMA 4H4QA 4RG4A 1GT8A 2YQUA 2B9WA 2EQ8A 2WETA 4FK1A 3BHFA 5KMSA 2WU2A 4XWRA 5ER0A 2OA1A 1GEUA 4GCMA 4I59A 3M12A 2YR4A 1O94A 3SQPA 4A65A 4U8LA 1H7WA 4Z24A 2JBVA 1IUUA 4DSHA 2GQWA 3HYWA 5TR3A 1D7YA 2YG3A 3P9UA 5IPYA 3JSKA 5C2TA 3ALMA 4JY3A 1X31B 1Y56A 1EL8A 3DK9A 1D4EA 4FK1C 3RP7A 1CJCA 2WESA 3SZFA 3IHGA 2YG7A 2BRYA 2C3CA 1PXAA 1FEAA 4G74A 3L8KA 5GRTA 5BUKA 1GETA 2BCGG 4B68A 2CDUA 4X9NA 1Y0PA 2GV8A 4H4XA 2YLZA 4J36A 4OPTA 1JU2A 4D03A 4OPCA 4CCRA 4YTMA 2VZ2A 2VVLA 4TLZA 1RP0A 3SZCA 4YSZA 2BYBA 2OLOA 1TRBA 2C72A 1P2HA 2WU5A 2XFOA 2ZZ0A 2C64A 1CL0A 3EANA 2PHHA 3GD3A 4U8JA 4CNKA 1QO8A 2V6OA 3NK2X 4GAPA 4APNA 4OCGA 5EB4A 2BXSA 2YLXA 1ZMDA 5KMRA 1TDFA 1NHSA 4DGKA 2O9ZA 1VG9A 1BWCA 3BNUA 5KXJA 4J33A 4BK1A 1JNZA 3AE1A 4CCQA 1TDEA 3GRTA 5EOWA 2DKHA 2GMJA 3IHMA 4YXDA 3BI2A 3B6DA 2BACA 2E5VA 1N1PA 4U2LA 1ZX9A 3PO7A 2IVEA 3VR9A 3NRNA 3EF6A 3NN0X 1LVLA 1E1MA 1KNPA 1OJAA 1E1LA 2W0HA 3UKQA 1YY5A 1PBBA 4H7UA 4CNJA 1F8RA 3UKPA 1YKJA 4P9SA 2XLSA 5FS7A 3DJEA 1V59A 4G73A 3SX6A 3SY4A 5DBJA 1BGJA 4G9KA 4A6NB 4OVIA 3SXIA 4PAAA 5BULA 4ICYA 2C67A 2PYXA 1JRXA 4H4SA 2WDQA 1S2YA 2Z5YA 3QFBA 3QSEA 1XANA 4J31A 3DMEA 2R4JA 4ZCCA 4YSXA 3ITJA 1NHRA 2GR0A 3B3RA 2Q6UA 4O5UA 2NPXA 4H4ZA 4K22A 2WP9A 4A99A 4GUVA 3AE6A 4JDRA 2RGOA 3CPHG 3ICRA 3DGZA 4WCTA 2VVLG 4A5LA 1ZDLA 2V60A 4EIPA 2QA1A 4UP3A 3UOXA 1ZMCA 2ACZA 2CFYA 4U8IA 1CC2A 4J34A 1IUXA 2WP5A 4Z26A 1D4DA 2A87A 3AB1A 3DJGX 1CC6A 3NHOX 2WPFA 1MO9A 1Q1WA 3AE8A 3UTEA 1SEZA 2APGA 3AWIA 2WDRA 3ZDNA 1CJ3A 2B7SA 1TDOA 1O95A 4XWZA 1PN0A 2E4GA 1TYPA 1GTEA 4EMJA 3H8LA 1LPFA 3QVRA 3UOZA 2XVJA 4O5QA 2XFUA 1YQZA 3I6DA 3GDPA 3P4PA 2JB2A 4NWZA 4ZN0A 5JCNA 1KDGA 1COYA 2C70A 1KF6A 4EM4A 2B9XA 4U8OA 5KVIA 1FECA 2CVJA 5BVAA 1FEBA 2YM2A 3R9UA 1H82A 3VRBA 1D7LA 2YM1A 2VOUA 3VR8A 3C96A 4OPGA 4K2XA 3LZXA 4H4UA 2XFNA 1XHCA 3G5RA 3ICSA 4H50A 4X4JA 2EQ9A 2X8GA 4U8NA 4EQWA 2V3BA 3NYEA 3T37A 4H2RA 4KX6A 4BV6A 1GRAA 2WOIA 1OJTA 4EIQA 4C5OA 1B37A 3DA1A 3NLCA 4H2NA 3T31A 4GRTA 3P4SA 3NYFA 4K5SA 1GREA 1PJ7A 2XLTA 3ICTA 3AYLA 2HQMA 3AYJA 4J57A 2WOVA 4U2TA 1H83A 3S61A 2YVFA 1P2EA 3ATQA 4IVOB 2IVDA 3CGEA 4J2WA 4NEVA 1L9EA 2ZZCA 3RNMA 5LV9A 1VRQB 3BI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE2 A;  1ZK7 A;  2XVH A;  2GRT A;  5U63 A;  1KNR A;  4M52 A;  4YSH A;  3AEC A;  4YSY A;  4AT0 A;  1EL9 A;  3GRS A;  3FG2 P;  2CUL A;  1VDC A;  2BC0 A;  1FOH A;  3SM8 A;  4REK A;  3RED A;  1L9D A;  2TMD A;  1F3P A;  5KOX A;  1B4V A;  2C3D A;  1GOS A;  2VRM A;  3C4A A;  4EMI A;  2WS3 A;  1Q9I A;  1F8S A;  4GF7 A;  2H88 A;  4H2Q A;  1IUT A;  3KKJ A;  1DOE A;  3OC4 A;  4USR A;  1GRG A;  4EQR A;  2AAQ A;  2GVC A;  4NZH A;  4CRT A;  1RYI A;  1H6V A;  2YG5 A;  4CY6 A;  4AT2 A;  2GQF A;  3M13 A;  2BK4 A;  3AE5 A;  5C3J A;  4IV9 A;  2XYO A;  2BXR A;  4YKG A;  1DOC A;  1M64 A;  5M0Z A;  2XLR A;  4I58 A;  4K8D A;  2FJA A;  1K0J A;  1H86 A;  4TM3 A;  4C3Y A;  3AD7 B;  5JCM A;  1QLB A;  4LU6 A;  3NK1 X;  3G5S A;  3P1W A;  3DJJ A;  2YAU A;  1EL7 A;  2R0C A;  4C3X A;  2EQ6 A;  2WPC A;  3D1C A;  3IC9 A;  1OJD A;  1GRF A;  2XVE A;  4A7A A;  3AXB A;  2B7R A;  2QAE A;  1LJ1 A;  2Y6R A;  3QVP A;  3QJ4 A;  3F8D A;  3KA7 A;  2JKC A;  3AEA A;  4C77 A;  2OAM A;  4Z2T A;  2GH5 A;  4GDE A;  3KU9 A;  1F8W A;  3NTA A;  5JCI A;  4JN9 A;  2V61 A;  3AEG A;  2QCU A;  2RGJ A;  4USQ A;  1Q1R A;  1NEK A;  5KVH A;  3CTY A;  4MJW A;  1CBO A;  4GR1 A;  4TM4 A;  2VVM A;  5HXI A;  3VRA A;  3WE0 A;  3LAD A;  1B5Q A;  3K30 A;  1EL5 A;  3P4R A;  3AE7 A;  4EQX A;  2JAE A;  1E39 A;  5J60 A;  2C7G A;  2NVK X;  2DKI A;  3BI4 A;  1PJ6 A;  1IUV A;  3AD8 B;  3H8I A;  4H4T A;  3AEF A;  4E0V A;  2GR3 A;  2VQ7 A;  4YTN A;  1H84 A;  5BRT A;  2R4E A;  3UOY A;  1CHU A;  2JB1 A;  3PVC A;  5KWF A;  3F8P A;  1H7X A;  1KFY A;  2YLS A;  4OPD A;  3O0H A;  3SFD A;  2FJD A;  2XFQ A;  3LZW A;  3NG7 X;  4H4P A;  1JEH A;  2Q0L A;  4TLX A;  4B69 A;  3CNP A;  4A79 A;  3CPJ G;  2WPE A;  2YLT A;  3FPZ A;  4NTD A;  5HY5 A;  2Z5X A;  2H89 A;  2BAB A;  2XFP A;  2V3A A;  3CND A;  1BZL A;  4Z2R A;  1NG3 A;  3UCL A;  1PXC A;  1S2Q A;  2FBW A;  4NTC A;  1NG4 A;  3L1R A;  4Y4M A;  4H4Y A;  3DH9 A;  4H2P A;  3GD4 A;  1E1K A;  3GDN A;  2FJB A;  3GMC A;  4NTE A;  3NGC X;  3PS9 A;  5FS8 A;  4IA5 A;  4JNA A;  3NIX A;  1ZKQ A;  1LTX R;  2GR1 A;  3FIM B;  3UKH A;  3AYI A;  2WDV A;  4U8P A;  4TM1 A;  2C65 A;  4DNA A;  1CC4 A;  2ZBW A;  1K0I A;  1E1N A;  3NTD A;  3S5W A;  4OPI A;  3AED A;  3KLJ A;  1N4W A;  2FJE A;  4IVM B;  3H4K A;  2I0Z A;  3K7T A;  2Y6Q A;  4Z43 A;  4U2S A;  1DXL A;  3NYC A;  1LV0 A;  4X9M A;  1D4C A;  1CJ2 A;  2WQY A;  4B64 A;  1CF3 A;  2VRL A;  1E7P A;  3IWA A;  1K4Q A;  4UDR A;  4Y4L A;  1CJ4 A;  3FMW A;  3ISH A;  2QA2 A;  4OPU A;  3GSI A;  1S3E A;  3RHA A;  3AE9 A;  4J56 A;  3QSS A;  3IF9 A;  2F5Z A;  1KSU A;  1ZY8 A;  1GRT A;  5J7X A;  2X8C A;  4WX1 A;  1H81 A;  3P4Q A;  3KD9 A;  3ALJ A;  2V5Z A;  4B63 A;  4LA1 A;  3UTF A;  1GES A;  3BHK A;  1YQ4 A;  4BJY A;  1ONF A;  1DJN A;  4A6N A;  1ELI A;  2JK6 A;  1W4X A;  3EPT A;  3NNE A;  5U1O A;  3DGH A;  3ZYX A;  3AD9 B;  4EQS A;  3FBS A;  1DJQ A;  1UKV G;  2GMH A;  2E1M A;  2B76 A;  2X50 A;  3CNJ A;  3LB8 A;  2YLW A;  5JCL A;  3NK0 X;  1IUW A;  3NT6 A;  3GYJ A;  1MOK A;  4U8K A;  4ADW A;  3AE3 A;  5GSN A;  1NHP A;  3DK4 A;  4HA6 A;  4U8M A;  5U25 A;  1GAL A;  3UP5 A;  3CGC A;  4HB9 A;  4OPL A;  2X8H A;  1PBD A;  3ABV A;  4UDP A;  2UZZ A;  3Q9T A;  2GR2 A;  3UKF A;  4B1B A;  4LII A;  2XVI A;  3SGL A;  3NKS A;  2WEU A;  1GER A;  2XDO A;  2R45 A;  3HZL A;  2X3N A;  1NHQ A;  1IUS A;  4EMW A;  2WOW A;  1IJH A;  4AP1 A;  4AOX A;  4ZCD A;  2VQB A;  2X99 A;  3URH A;  2GAG B;  3CN8 A;  3LXD A;  3QSM A;  1VG0 A;  2BS4 A;  1MXT A;  4JNQ A;  2GEW A;  3ALL A;  3I3L A;  4UDQ A;  3KPF A;  5CQF A;  1F6M A;  4BK3 A;  1DOB A;  4NEW A;  4ECH A;  2BK5 A;  1FCD A;  2R0P A;  4YKF A;  3EAO A;  3UKA A;  2R0G A;  4BUR A;  4YTP A;  1ZOV A;  5KRQ A;  3K7Q X;  2WBA A;  2BS3 A;  3M0O A;  2B9Y A;  4TM0 A;  2BC1 A;  3KVE A;  3SFE A;  4C74 A;  2C66 A;  3QFA A;  2YWL A;  3Q6J A;  3LJP A;  3LOV A;  1GRB A;  2GB0 A;  4DSG A;  4Z25 A;  1GXF A;  2RGH A;  4B66 A;  4CBQ A;  3K7M X;  2ARD A;  4XXG A;  1BF3 A;  1K0L A;  1XPQ A;  2YLR A;  4N9X A;  3GYI A;  2C73 A;  2Q0K A;  1TDN A;  2ZZB A;  2IID A;  4YWO A;  4JQ9 A;  1OJ9 A;  1YQ3 A;  3ADA B;  1PBF A;  2YVG A;  1Z6L A;  3GWF A;  1NEN A;  5CKU A;  1PXB A;  2RAB A;  5FS9 A;  3F8R A;  1EBD A;  1L9C A;  3CPI G;  2JB3 A;  3NH3 X;  5JCK A;  4FDC B;  4K7Z A;  2BK3 A;  2YG4 A;  2GF3 A;  2WHD A;  2YG6 A;  5M10 A;  1BGN A;  2OAL A;  2BS2 A;  3AE4 A;  2WP6 A;  4PAB A;  3CNT A;  1OJC A;  4GDP A;  3UP4 A;  4A9W A;  3V76 A;  4RSL A;  1GSN A;  1NDA A;  1NAA A;  3UKK A;  3CGD A;  1L0V A;  4AP3 A;  3II4 A;  1BKW A;  1QJD A;  1S3B A;  1ZOY A;  2A89 A;  2EQ7 A;  4K5R A;  4AOS A;  1RSG A;  4B65 A;  4D04 A;  2C75 A;  3GWD A;  4JY2 A;  1PDH A;  3UOV A;  4H4W A;  1GTH A;  1VQW A;  1GRH A;  3NN6 X;  4BJZ A;  5IQ4 A;  4RG3 A;  3D8X A;  4CY8 A;  1GND A;  2XLU A;  1M6I A;  3G5Q A;  4H4R A;  3AEE A;  2AQJ A;  1PHH A;  1PS9 A;  1Y56 B;  2R46 A;  3DJD A;  5HHF A;  3UKL A;  3UTH A;  1JRZ A;  1PJ5 A;  1REO A;  3CNS A;  3DK8 A;  1PBE A;  1JOA A;  2TPR A;  1XDI A;  3BNM A;  2Q7V A;  1HYU A;  4B67 A;  3OZ2 A;  4FX9 A;  1LQU A;  1DNC A;  1FL2 A;  1KSS A;  1ZP0 A;  3V3O A;  1B8S A;  2XLP A;  3ATR A;  2GAH B;  1D5T A;  1GPE A;  2BA9 A;  2R9Z A;  1NPX A;  4YT0 A;  3UTG A;  4H4V A;  3RP8 A;  3COX A;  5EBK A;  5FS6 A;  1E6E A;  3VRD B;  1N4U A;  1GV4 A;  3RP6 A;  3GMB A;  1PBC A;  4KPR A;  4Z2U A;  1TYT A;  2AR8 A;  1DOD A;  2YR6 A;  4EM3 A;  1TDK A;  4Z44 A;  3V3N A;  2XCG A;  1O5W A;  2A8X A;  3E1T A;  2YR5 A;  5L46 A;  2J3N A;  4IA6 A;  2C76 A;  3AEB A;  1N4V A;  1LQT A;  4BK2 A;  2XVF A;  2YVJ A;  1JNR A;  2OLN A;  2BCP A;  3CGB A;  3C4N A;  4Y4N A;  1AOG A;  5KOW A;  5FMH A;  5IQ1 A;  5EB5 A;  3CIR A;  1JRY A;  3VQR A;  5HYM A;  4H4Q A;  4RG4 A;  1GT8 A;  2YQU A;  2B9W A;  2EQ8 A;  2WET A;  4FK1 A;  3BHF A;  2WU2 A;  4XWR A;  5ER0 A;  2OA1 A;  1GEU A;  4GCM A;  4I59 A;  3M12 A;  2YR4 A;  1O94 A;  3SQP A;  4A65 A;  4U8L A;  1H7W A;  4Z24 A;  2JBV A;  1IUU A;  4DSH A;  2GQW A;  5TR3 A;  1D7Y A;  2YG3 A;  3P9U A;  5IPY A;  3JSK A;  5C2T A;  3ALM A;  4JY3 A;  1X31 B;  1Y56 A;  1EL8 A;  3DK9 A;  1D4E A;  4FK1 C;  3RP7 A;  1CJC A;  2WES A;  3IHG A;  2YG7 A;  2C3C A;  1PXA A;  1FEA A;  3L8K A;  5GRT A;  5BUK A;  1GET A;  2BCG G;  4B68 A;  2CDU A;  4X9N A;  1Y0P A;  2GV8 A;  4H4X A;  2YLZ A;  4J36 A;  4OPT A;  1JU2 A;  4D03 A;  4OPC A;  4CCR A;  4YTM A;  2VZ2 A;  2VVL A;  4TLZ A;  1RP0 A;  4YSZ A;  2BYB A;  2OLO A;  1TRB A;  2C72 A;  1P2H A;  2WU5 A;  2XFO A;  2ZZ0 A;  2C64 A;  1CL0 A;  3EAN A;  2PHH A;  3GD3 A;  4U8J A;  4CNK A;  1QO8 A;  2V6O A;  3NK2 X;  4APN A;  4OCG A;  5EB4 A;  2BXS A;  2YLX A;  1ZMD A;  1TDF A;  1NHS A;  4DGK A;  2O9Z A;  1VG9 A;  1BWC A;  3BNU A;  5KXJ A;  4J33 A;  4BK1 A;  1JNZ A;  3AE1 A;  4CCQ A;  1TDE A;  3GRT A;  5EOW A;  2DKH A;  2GMJ A;  3IHM A;  4YXD A;  3BI2 A;  3B6D A;  2BAC A;  2E5V A;  1N1P A;  4U2L A;  1ZX9 A;  3PO7 A;  2IVE A;  3VR9 A;  3NRN A;  3EF6 A;  3NN0 X;  1LVL A;  1E1M A;  1KNP A;  1OJA A;  1E1L A;  2W0H A;  3UKQ A;  1YY5 A;  1PBB A;  4H7U A;  4CNJ A;  1F8R A;  3UKP A;  1YKJ A;  4P9S A;  2XLS A;  5FS7 A;  3DJE A;  1V59 A;  5DBJ A;  1BGJ A;  4A6N B;  4OVI A;  4PAA A;  5BUL A;  4ICY A;  2C67 A;  2PYX A;  1JRX A;  4H4S A;  2WDQ A;  1S2Y A;  2Z5Y A;  3QFB A;  3QSE A;  1XAN A;  4J31 A;  3DME A;  2R4J A;  4ZCC A;  4YSX A;  3ITJ A;  1NHR A;  2GR0 A;  3B3R A;  2Q6U A;  4O5U A;  2NPX A;  4H4Z A;  4K22 A;  2WP9 A;  4A99 A;  4GUV A;  3AE6 A;  4JDR A;  2RGO A;  3CPH G;  3ICR A;  3DGZ A;  4WCT A;  2VVL G;  4A5L A;  1ZDL A;  2V60 A;  4EIP A;  2QA1 A;  4UP3 A;  3UOX A;  1ZMC A;  2ACZ A;  2CFY A;  4U8I A;  1CC2 A;  4J34 A;  1IUX A;  2WP5 A;  4Z26 A;  1D4D A;  2A87 A;  3AB1 A;  3DJG X;  1CC6 A;  3NHO X;  2WPF A;  1MO9 A;  1Q1W A;  3AE8 A;  3UTE A;  1SEZ A;  2APG A;  3AWI A;  2WDR A;  3ZDN A;  1CJ3 A;  2B7S A;  1TDO A;  1O95 A;  4XWZ A;  1PN0 A;  2E4G A;  1TYP A;  1GTE A;  4EMJ A;  3H8L A;  1LPF A;  3QVR A;  3UOZ A;  2XVJ A;  4O5Q A;  2XFU A;  1YQZ A;  3I6D A;  3GDP A;  3P4P A;  2JB2 A;  4ZN0 A;  5JCN A;  1KDG A;  1COY A;  2C70 A;  1KF6 A;  4EM4 A;  2B9X A;  4U8O A;  5KVI A;  1FEC A;  2CVJ A;  5BVA A;  1FEB A;  2YM2 A;  3R9U A;  1H82 A;  3VRB A;  1D7L A;  2YM1 A;  2VOU A;  3VR8 A;  3C96 A;  4OPG A;  4K2X A;  3LZX A;  4H4U A;  2XFN A;  1XHC A;  3G5R A;  3ICS A;  4H50 A;  4X4J A;  2EQ9 A;  2X8G A;  4U8N A;  4EQW A;  2V3B A;  3NYE A;  3T37 A;  4H2R A;  4KX6 A;  4BV6 A;  1GRA A;  2WOI A;  1OJT A;  4EIQ A;  4C5O A;  1B37 A;  3DA1 A;  3NLC A;  4H2N A;  4GRT A;  3P4S A;  3NYF A;  4K5S A;  1GRE A;  1PJ7 A;  2XLT A;  3ICT A;  3AYL A;  2HQM A;  3AYJ A;  4J57 A;  2WOV A;  4U2T A;  1H83 A;  3S61 A;  2YVF A;  1P2E A;  3ATQ A;  4IVO B;  2IVD A;  3CGE A;  4J2W A;  4NEV A;  1L9E A;  2ZZC A;  3RNM A;  5LV9 A;  1VRQ B;  3BI5 A; 
#chains in the Genus database with same CATH topology
 3AE2 A;  1ZK7 A;  2XVH A;  2GRT A;  5U63 A;  1KNR A;  4M52 A;  4YSH A;  3AEC A;  4YSY A;  4AT0 A;  1EL9 A;  3GRS A;  3FG2 P;  2CUL A;  1VDC A;  2BC0 A;  1FOH A;  3SM8 A;  4REK A;  3RED A;  1L9D A;  2TMD A;  1F3P A;  5KOX A;  1B4V A;  2C3D A;  1GOS A;  2VRM A;  3C4A A;  3GYX A;  4EMI A;  2WS3 A;  1Q9I A;  1F8S A;  4GF7 A;  5KNL A;  2H88 A;  4H2Q A;  1IUT A;  3KKJ A;  1DOE A;  3OC4 A;  3T2Y A;  4USR A;  1GRG A;  4EQR A;  2AAQ A;  2GVC A;  4NZH A;  4CRT A;  1RYI A;  1H6V A;  2YG5 A;  4CY6 A;  4AT2 A;  2GQF A;  3M13 A;  2BK4 A;  3AE5 A;  5C3J A;  4IV9 A;  2XYO A;  2BXR A;  4YKG A;  1DOC A;  1M64 A;  5M0Z A;  2XLR A;  4I58 A;  4K8D A;  2FJA A;  1K0J A;  1H86 A;  4TM3 A;  4C3Y A;  3AD7 B;  5JCM A;  1QLB A;  4LU6 A;  3NK1 X;  3G5S A;  3P1W A;  3DJJ A;  2YAU A;  1EL7 A;  2R0C A;  4C3X A;  2EQ6 A;  2WPC A;  3D1C A;  3IC9 A;  1OJD A;  1GRF A;  2XVE A;  4A7A A;  3AXB A;  2B7R A;  4G6G A;  2QAE A;  1LJ1 A;  2Y6R A;  3QVP A;  3QJ4 A;  3F8D A;  3KA7 A;  2JKC A;  3AEA A;  4C77 A;  2OAM A;  4Z2T A;  2GH5 A;  4GDE A;  3KU9 A;  1F8W A;  3NTA A;  5JCI A;  4JN9 A;  2V61 A;  3AEG A;  3SZW A;  2QCU A;  2RGJ A;  4USQ A;  1Q1R A;  1NEK A;  5KVH A;  3CTY A;  4MJW A;  1CBO A;  4GR1 A;  4II2 A;  2VVM A;  4TM4 A;  5HXI A;  3VRA A;  3WE0 A;  3LAD A;  1B5Q A;  3K30 A;  1EL5 A;  3P4R A;  3AE7 A;  4EQX A;  2JAE A;  1E39 A;  5J60 A;  2C7G A;  2NVK X;  2DKI A;  3BI4 A;  1PJ6 A;  1IUV A;  3AD8 B;  3H8I A;  4H4T A;  3AEF A;  4E0V A;  2GR3 A;  2VQ7 A;  4YTN A;  1H84 A;  5BRT A;  2R4E A;  3UOY A;  1CHU A;  2JB1 A;  3PVC A;  5KWF A;  3F8P A;  1H7X A;  1KFY A;  2YLS A;  4G6H A;  4OPD A;  3O0H A;  3SFD A;  2FJD A;  2XFQ A;  3LZW A;  3NG7 X;  4H4P A;  1JEH A;  2Q0L A;  4TLX A;  4B69 A;  3CNP A;  4A79 A;  3CPJ G;  2WPE A;  3CMM A;  2YLT A;  3FPZ A;  4NTD A;  5HY5 A;  2Z5X A;  2H89 A;  2BAB A;  2XFP A;  2V3A A;  3CND A;  1BZL A;  4Z2R A;  1NG3 A;  3UCL A;  1PXC A;  1S2Q A;  2FBW A;  4NTC A;  1NG4 A;  3L1R A;  4Y4M A;  4H4Y A;  3DH9 A;  4H2P A;  3GDN A;  1E1K A;  3GD4 A;  2FJB A;  3GMC A;  4NTE A;  3NGC X;  3PS9 A;  5FS8 A;  4IA5 A;  4JNA A;  3NIX A;  1ZKQ A;  1LTX R;  2GR1 A;  3FIM B;  3T14 A;  3UKH A;  3AYI A;  2WDV A;  4U8P A;  4TM1 A;  2C65 A;  4DNA A;  1CC4 A;  2ZBW A;  1K0I A;  1E1N A;  3NTD A;  3S5W A;  4OPI A;  3AED A;  3KLJ A;  1N4W A;  2FJE A;  4IVM B;  3H4K A;  2I0Z A;  3K7T A;  2Y6Q A;  4Z43 A;  4U2S A;  1DXL A;  3NYC A;  1LV0 A;  4X9M A;  1D4C A;  1CJ2 A;  2WQY A;  4B64 A;  1CF3 A;  2VRL A;  1E7P A;  3IWA A;  1K4Q A;  4UDR A;  4Y4L A;  1CJ4 A;  3FMW A;  3ISH A;  2QA2 A;  4OPU A;  3GSI A;  1S3E A;  3RHA A;  3AE9 A;  4II3 A;  4J56 A;  3QSS A;  3IF9 A;  2F5Z A;  1KSU A;  1ZY8 A;  1GRT A;  5J7X A;  2X8C A;  4WX1 A;  1H81 A;  3P4Q A;  3KD9 A;  3ALJ A;  2V5Z A;  4B63 A;  4LA1 A;  3UTF A;  1GES A;  3BHK A;  1YQ4 A;  3T2K A;  1ONF A;  1DJN A;  4BJY A;  4A6N A;  3NNE A;  1ELI A;  1W4X A;  2JK6 A;  3EPT A;  5U1O A;  3DGH A;  3ZYX A;  3AD9 B;  4EQS A;  3FBS A;  1DJQ A;  1UKV G;  2GMH A;  2E1M A;  2B76 A;  2X50 A;  3CNJ A;  3LB8 A;  4GAV A;  2YLW A;  5JCL A;  3NK0 X;  1IUW A;  3NT6 A;  3GYJ A;  1MOK A;  4U8K A;  4ADW A;  3AE3 A;  5GSN A;  1NHP A;  3DK4 A;  4HA6 A;  4U8M A;  5U25 A;  1GAL A;  3UP5 A;  3CGC A;  4HB9 A;  4OPL A;  2X8H A;  1PBD A;  4UDP A;  3ABV A;  2UZZ A;  3Q9T A;  2GR2 A;  3UKF A;  4B1B A;  4LII A;  2XVI A;  3SGL A;  3NKS A;  2WEU A;  1GER A;  2XDO A;  2R45 A;  3HZL A;  4NNJ A;  2X3N A;  1NHQ A;  1IUS A;  4EMW A;  2WOW A;  1IJH A;  4AP1 A;  4AOX A;  4ZCD A;  2VQB A;  2X99 A;  3URH A;  2GAG B;  3CN8 A;  3LXD A;  3QSM A;  1VG0 A;  2BS4 A;  1MXT A;  4JNQ A;  2GEW A;  3ALL A;  4UDQ A;  3I3L A;  3KPF A;  5CQF A;  1F6M A;  4BK3 A;  1DOB A;  4NEW A;  4ECH A;  2BK5 A;  1FCD A;  2R0P A;  4YKF A;  3EAO A;  3UKA A;  2R0G A;  4BUR A;  4YTP A;  1ZOV A;  5KRQ A;  3K7Q X;  2WBA A;  2BS3 A;  3M0O A;  2B9Y A;  4TM0 A;  2BC1 A;  3KVE A;  3SFE A;  4C74 A;  2C66 A;  3QFA A;  2YWL A;  3Q6J A;  3LJP A;  3LOV A;  1GRB A;  2GB0 A;  4DSG A;  4Z25 A;  1GXF A;  2RGH A;  4B66 A;  4CBQ A;  3K7M X;  2ARD A;  4XXG A;  1BF3 A;  1K0L A;  1XPQ A;  2YLR A;  4N9X A;  3T2Z A;  3GYI A;  2C73 A;  2BRA A;  2Q0K A;  1TDN A;  2ZZB A;  2IID A;  4YWO A;  4JQ9 A;  1OJ9 A;  1YQ3 A;  3ADA B;  1PBF A;  3SZ0 A;  2YVG A;  1Z6L A;  3GWF A;  1NEN A;  5CKU A;  1PXB A;  2RAB A;  5FS9 A;  3F8R A;  1EBD A;  1L9C A;  3SYI A;  3CPI G;  2JB3 A;  3NH3 X;  5JCK A;  4FDC B;  4K7Z A;  2BK3 A;  2YG4 A;  2GF3 A;  2WHD A;  2YG6 A;  5M10 A;  1BGN A;  2OAL A;  2BS2 A;  3AE4 A;  2WP6 A;  4PAB A;  3CNT A;  1OJC A;  4GDP A;  3UP4 A;  4A9W A;  3V76 A;  4RSL A;  1GSN A;  1NDA A;  1NAA A;  3UKK A;  3CGD A;  1L0V A;  4AP3 A;  3II4 A;  1BKW A;  1QJD A;  1S3B A;  1ZOY A;  2A89 A;  2EQ7 A;  4K5R A;  4AOS A;  1RSG A;  4B65 A;  4D04 A;  2C75 A;  3GWD A;  4JY2 A;  1PDH A;  3UOV A;  4H4W A;  1GTH A;  1VQW A;  1GRH A;  3NN6 X;  4BJZ A;  5IQ4 A;  4RG3 A;  3KPK A;  3D8X A;  4CY8 A;  1GND A;  2XLU A;  1M6I A;  3G5Q A;  4H4R A;  3AEE A;  2AQJ A;  1PHH A;  1PS9 A;  1Y56 B;  2R46 A;  3DJD A;  5HHF A;  3UKL A;  3UTH A;  1JRZ A;  1PJ5 A;  1REO A;  3CNS A;  3DK8 A;  1PBE A;  1JOA A;  2TPR A;  1XDI A;  3BNM A;  2Q7V A;  5KMP A;  1HYU A;  5KMQ A;  4B67 A;  3OZ2 A;  4FX9 A;  1LQU A;  1DNC A;  1FL2 A;  1KSS A;  1ZP0 A;  3V3O A;  1B8S A;  2XLP A;  3ATR A;  2GAH B;  1D5T A;  1GPE A;  2BA9 A;  2R9Z A;  1NPX A;  4YT0 A;  3UTG A;  4H4V A;  3RP8 A;  3COX A;  5EBK A;  5FS6 A;  1E6E A;  3VRD B;  1N4U A;  1GV4 A;  3RP6 A;  3GMB A;  1PBC A;  4KPR A;  4Z2U A;  1TYT A;  3T0K A;  2AR8 A;  1DOD A;  2YR6 A;  4EM3 A;  1TDK A;  4Z44 A;  3V3N A;  2XCG A;  1O5W A;  2A8X A;  2C4C A;  3E1T A;  3HYX A;  2YR5 A;  3HYV A;  5L46 A;  2J3N A;  4IA6 A;  2C76 A;  3AEB A;  1N4V A;  1LQT A;  4BK2 A;  2XVF A;  2YVJ A;  1JNR A;  2OLN A;  2BCP A;  3CGB A;  3C4N A;  4Y4N A;  1AOG A;  5KOW A;  5FMH A;  5IQ1 A;  5EB5 A;  3CIR A;  1JRY A;  3VQR A;  5HYM A;  4H4Q A;  4RG4 A;  1GT8 A;  2YQU A;  2B9W A;  2EQ8 A;  2WET A;  4FK1 A;  3BHF A;  5KMS A;  2WU2 A;  4XWR A;  5ER0 A;  2OA1 A;  1GEU A;  4GCM A;  4I59 A;  3M12 A;  2YR4 A;  1O94 A;  3SQP A;  4A65 A;  4U8L A;  1H7W A;  4Z24 A;  2JBV A;  1IUU A;  4DSH A;  2GQW A;  3HYW A;  5TR3 A;  1D7Y A;  2YG3 A;  3P9U A;  5IPY A;  3JSK A;  5C2T A;  3ALM A;  4JY3 A;  1X31 B;  1Y56 A;  1EL8 A;  3DK9 A;  1D4E A;  4FK1 C;  3RP7 A;  1CJC A;  2WES A;  3SZF A;  3IHG A;  2YG7 A;  2BRY A;  2C3C A;  1PXA A;  1FEA A;  4G74 A;  3L8K A;  5GRT A;  5BUK A;  1GET A;  2BCG G;  4B68 A;  2CDU A;  4X9N A;  1Y0P A;  2GV8 A;  4H4X A;  2YLZ A;  4J36 A;  4OPT A;  1JU2 A;  4D03 A;  4OPC A;  4CCR A;  4YTM A;  2VZ2 A;  2VVL A;  4TLZ A;  1RP0 A;  3SZC A;  4YSZ A;  2BYB A;  2OLO A;  1TRB A;  2C72 A;  1P2H A;  2WU5 A;  2XFO A;  2ZZ0 A;  2C64 A;  1CL0 A;  3EAN A;  2PHH A;  3GD3 A;  4U8J A;  4CNK A;  1QO8 A;  2V6O A;  3NK2 X;  4GAP A;  4APN A;  4OCG A;  5EB4 A;  2BXS A;  2YLX A;  1ZMD A;  5KMR A;  1TDF A;  1NHS A;  4DGK A;  2O9Z A;  1VG9 A;  1BWC A;  3BNU A;  5KXJ A;  4J33 A;  4BK1 A;  1JNZ A;  3AE1 A;  4CCQ A;  1TDE A;  3GRT A;  5EOW A;  2DKH A;  2GMJ A;  3IHM A;  4YXD A;  3BI2 A;  3B6D A;  2BAC A;  2E5V A;  1N1P A;  4U2L A;  1ZX9 A;  3PO7 A;  2IVE A;  3VR9 A;  3NRN A;  3EF6 A;  3NN0 X;  1LVL A;  1E1M A;  1KNP A;  1OJA A;  1E1L A;  2W0H A;  3UKQ A;  1YY5 A;  1PBB A;  4H7U A;  4CNJ A;  1F8R A;  3UKP A;  1YKJ A;  4P9S A;  2XLS A;  5FS7 A;  3DJE A;  1V59 A;  4G73 A;  3SX6 A;  3SY4 A;  5DBJ A;  1BGJ A;  4G9K A;  4A6N B;  4OVI A;  3SXI A;  4PAA A;  5BUL A;  4ICY A;  2C67 A;  2PYX A;  1JRX A;  4H4S A;  2WDQ A;  1S2Y A;  2Z5Y A;  3QFB A;  3QSE A;  1XAN A;  4J31 A;  3DME A;  2R4J A;  4ZCC A;  4YSX A;  3ITJ A;  1NHR A;  2GR0 A;  3B3R A;  2Q6U A;  4O5U A;  2NPX A;  4H4Z A;  4K22 A;  2WP9 A;  4A99 A;  4GUV A;  3AE6 A;  4JDR A;  2RGO A;  3CPH G;  3ICR A;  3DGZ A;  4WCT A;  2VVL G;  4A5L A;  1ZDL A;  2V60 A;  4EIP A;  2QA1 A;  4UP3 A;  3UOX A;  1ZMC A;  2ACZ A;  2CFY A;  4U8I A;  1CC2 A;  4J34 A;  1IUX A;  2WP5 A;  4Z26 A;  1D4D A;  2A87 A;  3AB1 A;  3DJG X;  1CC6 A;  3NHO X;  2WPF A;  1MO9 A;  1Q1W A;  3AE8 A;  3UTE A;  1SEZ A;  2APG A;  3AWI A;  2WDR A;  3ZDN A;  1CJ3 A;  2B7S A;  1TDO A;  1O95 A;  4XWZ A;  1PN0 A;  2E4G A;  1TYP A;  1GTE A;  4EMJ A;  3H8L A;  1LPF A;  3QVR A;  3UOZ A;  2XVJ A;  4O5Q A;  2XFU A;  1YQZ A;  3I6D A;  3GDP A;  3P4P A;  2JB2 A;  4NWZ A;  4ZN0 A;  5JCN A;  1KDG A;  1COY A;  2C70 A;  1KF6 A;  4EM4 A;  2B9X A;  4U8O A;  5KVI A;  1FEC A;  2CVJ A;  5BVA A;  1FEB A;  2YM2 A;  3R9U A;  1H82 A;  3VRB A;  1D7L A;  2YM1 A;  2VOU A;  3VR8 A;  3C96 A;  4OPG A;  4K2X A;  3LZX A;  4H4U A;  2XFN A;  1XHC A;  3G5R A;  3ICS A;  4H50 A;  4X4J A;  2EQ9 A;  2X8G A;  4U8N A;  4EQW A;  2V3B A;  3NYE A;  3T37 A;  4H2R A;  4KX6 A;  4BV6 A;  1GRA A;  2WOI A;  1OJT A;  4EIQ A;  4C5O A;  1B37 A;  3DA1 A;  3NLC A;  4H2N A;  3T31 A;  4GRT A;  3P4S A;  3NYF A;  4K5S A;  1GRE A;  1PJ7 A;  2XLT A;  3ICT A;  3AYL A;  2HQM A;  3AYJ A;  4J57 A;  2WOV A;  4U2T A;  1H83 A;  3S61 A;  2YVF A;  1P2E A;  3ATQ A;  4IVO B;  2IVD A;  3CGE A;  4J2W A;  4NEV A;  1L9E A;  2ZZC A;  3RNM A;  5LV9 A;  1VRQ B;  3BI5 A; 
#chains in the Genus database with same CATH homology
 3AE2 A;  1ZK7 A;  2XVH A;  2GRT A;  5U63 A;  1KNR A;  4M52 A;  4YSH A;  3AEC A;  4YSY A;  4AT0 A;  1EL9 A;  3GRS A;  3FG2 P;  2CUL A;  1VDC A;  2BC0 A;  1FOH A;  3SM8 A;  4REK A;  3RED A;  1L9D A;  2TMD A;  1F3P A;  5KOX A;  1B4V A;  2C3D A;  1GOS A;  2VRM A;  3C4A A;  3GYX A;  4EMI A;  2WS3 A;  1Q9I A;  1F8S A;  4GF7 A;  5KNL A;  2H88 A;  4H2Q A;  1IUT A;  3KKJ A;  1DOE A;  3OC4 A;  3T2Y A;  4USR A;  1GRG A;  4EQR A;  2AAQ A;  2GVC A;  4NZH A;  4CRT A;  1RYI A;  1H6V A;  2YG5 A;  4CY6 A;  4AT2 A;  2GQF A;  3M13 A;  2BK4 A;  3AE5 A;  5C3J A;  4IV9 A;  2XYO A;  2BXR A;  4YKG A;  1DOC A;  1M64 A;  5M0Z A;  2XLR A;  4I58 A;  4K8D A;  2FJA A;  1K0J A;  1H86 A;  4TM3 A;  4C3Y A;  3AD7 B;  5JCM A;  1QLB A;  4LU6 A;  3NK1 X;  3G5S A;  3P1W A;  3DJJ A;  2YAU A;  1EL7 A;  2R0C A;  4C3X A;  2EQ6 A;  2WPC A;  3D1C A;  3IC9 A;  1OJD A;  1GRF A;  2XVE A;  4A7A A;  3AXB A;  2B7R A;  4G6G A;  2QAE A;  1LJ1 A;  2Y6R A;  3QVP A;  3QJ4 A;  3F8D A;  3KA7 A;  2JKC A;  3AEA A;  4C77 A;  2OAM A;  4Z2T A;  2GH5 A;  4GDE A;  3KU9 A;  1F8W A;  3NTA A;  5JCI A;  4JN9 A;  2V61 A;  3AEG A;  3SZW A;  2QCU A;  2RGJ A;  4USQ A;  1Q1R A;  1NEK A;  5KVH A;  3CTY A;  4MJW A;  1CBO A;  4GR1 A;  4II2 A;  2VVM A;  4TM4 A;  5HXI A;  3VRA A;  3WE0 A;  3LAD A;  1B5Q A;  3K30 A;  1EL5 A;  3P4R A;  3AE7 A;  4EQX A;  2JAE A;  1E39 A;  5J60 A;  2C7G A;  2NVK X;  2DKI A;  3BI4 A;  1PJ6 A;  1IUV A;  3AD8 B;  3H8I A;  4H4T A;  3AEF A;  4E0V A;  2GR3 A;  2VQ7 A;  4YTN A;  1H84 A;  5BRT A;  2R4E A;  3UOY A;  1CHU A;  2JB1 A;  3PVC A;  5KWF A;  3F8P A;  1H7X A;  1KFY A;  2YLS A;  4G6H A;  4OPD A;  3O0H A;  3SFD A;  2FJD A;  2XFQ A;  3LZW A;  3NG7 X;  4H4P A;  1JEH A;  2Q0L A;  4TLX A;  4B69 A;  3CNP A;  4A79 A;  3CPJ G;  2WPE A;  3CMM A;  2YLT A;  3FPZ A;  4NTD A;  5HY5 A;  2Z5X A;  2H89 A;  2BAB A;  2XFP A;  2V3A A;  3CND A;  1BZL A;  4Z2R A;  1NG3 A;  3UCL A;  1PXC A;  1S2Q A;  2FBW A;  4NTC A;  1NG4 A;  3L1R A;  4Y4M A;  4H4Y A;  3DH9 A;  4H2P A;  3GDN A;  1E1K A;  3GD4 A;  2FJB A;  3GMC A;  4NTE A;  3NGC X;  3PS9 A;  5FS8 A;  4IA5 A;  4JNA A;  3NIX A;  1ZKQ A;  1LTX R;  2GR1 A;  3FIM B;  3T14 A;  3UKH A;  3AYI A;  2WDV A;  4U8P A;  4TM1 A;  2C65 A;  4DNA A;  1CC4 A;  2ZBW A;  1K0I A;  1E1N A;  3NTD A;  3S5W A;  4OPI A;  3AED A;  3KLJ A;  1N4W A;  2FJE A;  4IVM B;  3H4K A;  2I0Z A;  3K7T A;  2Y6Q A;  4Z43 A;  4U2S A;  1DXL A;  3NYC A;  1LV0 A;  4X9M A;  1D4C A;  1CJ2 A;  2WQY A;  4B64 A;  1CF3 A;  2VRL A;  1E7P A;  3IWA A;  1K4Q A;  4UDR A;  4Y4L A;  1CJ4 A;  3FMW A;  3ISH A;  2QA2 A;  4OPU A;  3GSI A;  1S3E A;  3RHA A;  3AE9 A;  4II3 A;  4J56 A;  3QSS A;  3IF9 A;  2F5Z A;  1KSU A;  1ZY8 A;  1GRT A;  5J7X A;  2X8C A;  4WX1 A;  1H81 A;  3P4Q A;  3KD9 A;  3ALJ A;  2V5Z A;  4B63 A;  4LA1 A;  3UTF A;  1GES A;  3BHK A;  1YQ4 A;  3T2K A;  1ONF A;  1DJN A;  4BJY A;  4A6N A;  3NNE A;  1ELI A;  1W4X A;  2JK6 A;  3EPT A;  5U1O A;  3DGH A;  3ZYX A;  3AD9 B;  4EQS A;  3FBS A;  1DJQ A;  1UKV G;  2GMH A;  2E1M A;  2B76 A;  2X50 A;  3CNJ A;  3LB8 A;  4GAV A;  2YLW A;  5JCL A;  3NK0 X;  1IUW A;  3NT6 A;  3GYJ A;  1MOK A;  4U8K A;  4ADW A;  3AE3 A;  5GSN A;  1NHP A;  3DK4 A;  4HA6 A;  4U8M A;  5U25 A;  1GAL A;  3UP5 A;  3CGC A;  4HB9 A;  4OPL A;  2X8H A;  1PBD A;  4UDP A;  3ABV A;  2UZZ A;  3Q9T A;  2GR2 A;  3UKF A;  4B1B A;  4LII A;  2XVI A;  3SGL A;  3NKS A;  2WEU A;  1GER A;  2XDO A;  2R45 A;  3HZL A;  4NNJ A;  2X3N A;  1NHQ A;  1IUS A;  4EMW A;  2WOW A;  1IJH A;  4AP1 A;  4AOX A;  4ZCD A;  2VQB A;  2X99 A;  3URH A;  2GAG B;  3CN8 A;  3LXD A;  3QSM A;  1VG0 A;  2BS4 A;  1MXT A;  4JNQ A;  2GEW A;  3ALL A;  4UDQ A;  3I3L A;  3KPF A;  5CQF A;  1F6M A;  4BK3 A;  1DOB A;  4NEW A;  4ECH A;  2BK5 A;  1FCD A;  2R0P A;  4YKF A;  3EAO A;  3UKA A;  2R0G A;  4BUR A;  4YTP A;  1ZOV A;  5KRQ A;  3K7Q X;  2WBA A;  2BS3 A;  3M0O A;  2B9Y A;  4TM0 A;  2BC1 A;  3KVE A;  3SFE A;  4C74 A;  2C66 A;  3QFA A;  2YWL A;  3Q6J A;  3LJP A;  3LOV A;  1GRB A;  2GB0 A;  4DSG A;  4Z25 A;  1GXF A;  2RGH A;  4B66 A;  4CBQ A;  3K7M X;  2ARD A;  4XXG A;  1BF3 A;  1K0L A;  1XPQ A;  2YLR A;  4N9X A;  3T2Z A;  3GYI A;  2C73 A;  2BRA A;  2Q0K A;  1TDN A;  2ZZB A;  2IID A;  4YWO A;  4JQ9 A;  1OJ9 A;  1YQ3 A;  3ADA B;  1PBF A;  3SZ0 A;  2YVG A;  1Z6L A;  3GWF A;  1NEN A;  5CKU A;  1PXB A;  2RAB A;  5FS9 A;  3F8R A;  1EBD A;  1L9C A;  3SYI A;  3CPI G;  2JB3 A;  3NH3 X;  5JCK A;  4FDC B;  4K7Z A;  2BK3 A;  2YG4 A;  2GF3 A;  2WHD A;  2YG6 A;  5M10 A;  1BGN A;  2OAL A;  2BS2 A;  3AE4 A;  2WP6 A;  4PAB A;  3CNT A;  1OJC A;  4GDP A;  3UP4 A;  4A9W A;  3V76 A;  4RSL A;  1GSN A;  1NDA A;  1NAA A;  3UKK A;  3CGD A;  1L0V A;  4AP3 A;  3II4 A;  1BKW A;  1QJD A;  1S3B A;  1ZOY A;  2A89 A;  2EQ7 A;  4K5R A;  4AOS A;  1RSG A;  4B65 A;  4D04 A;  2C75 A;  3GWD A;  4JY2 A;  1PDH A;  3UOV A;  4H4W A;  1GTH A;  1VQW A;  1GRH A;  3NN6 X;  4BJZ A;  5IQ4 A;  4RG3 A;  3KPK A;  3D8X A;  4CY8 A;  1GND A;  2XLU A;  1M6I A;  3G5Q A;  4H4R A;  3AEE A;  2AQJ A;  1PHH A;  1PS9 A;  1Y56 B;  2R46 A;  3DJD A;  5HHF A;  3UKL A;  3UTH A;  1JRZ A;  1PJ5 A;  1REO A;  3CNS A;  3DK8 A;  1PBE A;  1JOA A;  2TPR A;  1XDI A;  3BNM A;  2Q7V A;  5KMP A;  1HYU A;  5KMQ A;  4B67 A;  3OZ2 A;  4FX9 A;  1LQU A;  1DNC A;  1FL2 A;  1KSS A;  1ZP0 A;  3V3O A;  1B8S A;  2XLP A;  3ATR A;  2GAH B;  1D5T A;  1GPE A;  2BA9 A;  2R9Z A;  1NPX A;  4YT0 A;  3UTG A;  4H4V A;  3RP8 A;  3COX A;  5EBK A;  5FS6 A;  1E6E A;  3VRD B;  1N4U A;  1GV4 A;  3RP6 A;  3GMB A;  1PBC A;  4KPR A;  4Z2U A;  1TYT A;  3T0K A;  2AR8 A;  1DOD A;  2YR6 A;  4EM3 A;  1TDK A;  4Z44 A;  3V3N A;  2XCG A;  1O5W A;  2A8X A;  2C4C A;  3E1T A;  3HYX A;  2YR5 A;  3HYV A;  5L46 A;  2J3N A;  4IA6 A;  2C76 A;  3AEB A;  1N4V A;  1LQT A;  4BK2 A;  2XVF A;  2YVJ A;  1JNR A;  2OLN A;  2BCP A;  3CGB A;  3C4N A;  4Y4N A;  1AOG A;  5KOW A;  5FMH A;  5IQ1 A;  5EB5 A;  3CIR A;  1JRY A;  3VQR A;  5HYM A;  4H4Q A;  4RG4 A;  1GT8 A;  2YQU A;  2B9W A;  2EQ8 A;  2WET A;  4FK1 A;  3BHF A;  5KMS A;  2WU2 A;  4XWR A;  5ER0 A;  2OA1 A;  1GEU A;  4GCM A;  4I59 A;  3M12 A;  2YR4 A;  1O94 A;  3SQP A;  4A65 A;  4U8L A;  1H7W A;  4Z24 A;  2JBV A;  1IUU A;  4DSH A;  2GQW A;  3HYW A;  5TR3 A;  1D7Y A;  2YG3 A;  3P9U A;  5IPY A;  3JSK A;  5C2T A;  3ALM A;  4JY3 A;  1X31 B;  1Y56 A;  1EL8 A;  3DK9 A;  1D4E A;  4FK1 C;  3RP7 A;  1CJC A;  2WES A;  3SZF A;  3IHG A;  2YG7 A;  2BRY A;  2C3C A;  1PXA A;  1FEA A;  4G74 A;  3L8K A;  5GRT A;  5BUK A;  1GET A;  2BCG G;  4B68 A;  2CDU A;  4X9N A;  1Y0P A;  2GV8 A;  4H4X A;  2YLZ A;  4J36 A;  4OPT A;  1JU2 A;  4D03 A;  4OPC A;  4CCR A;  4YTM A;  2VZ2 A;  2VVL A;  4TLZ A;  1RP0 A;  3SZC A;  4YSZ A;  2BYB A;  2OLO A;  1TRB A;  2C72 A;  1P2H A;  2WU5 A;  2XFO A;  2ZZ0 A;  2C64 A;  1CL0 A;  3EAN A;  2PHH A;  3GD3 A;  4U8J A;  4CNK A;  1QO8 A;  2V6O A;  3NK2 X;  4GAP A;  4APN A;  4OCG A;  5EB4 A;  2BXS A;  2YLX A;  1ZMD A;  5KMR A;  1TDF A;  1NHS A;  4DGK A;  2O9Z A;  1VG9 A;  1BWC A;  3BNU A;  5KXJ A;  4J33 A;  4BK1 A;  1JNZ A;  3AE1 A;  4CCQ A;  1TDE A;  3GRT A;  5EOW A;  2DKH A;  2GMJ A;  3IHM A;  4YXD A;  3BI2 A;  3B6D A;  2BAC A;  2E5V A;  1N1P A;  4U2L A;  1ZX9 A;  3PO7 A;  2IVE A;  3VR9 A;  3NRN A;  3EF6 A;  3NN0 X;  1LVL A;  1E1M A;  1KNP A;  1OJA A;  1E1L A;  2W0H A;  3UKQ A;  1YY5 A;  1PBB A;  4H7U A;  4CNJ A;  1F8R A;  3UKP A;  1YKJ A;  4P9S A;  2XLS A;  5FS7 A;  3DJE A;  1V59 A;  4G73 A;  3SX6 A;  3SY4 A;  5DBJ A;  1BGJ A;  4G9K A;  4A6N B;  4OVI A;  3SXI A;  4PAA A;  5BUL A;  4ICY A;  2C67 A;  2PYX A;  1JRX A;  4H4S A;  2WDQ A;  1S2Y A;  2Z5Y A;  3QFB A;  3QSE A;  1XAN A;  4J31 A;  3DME A;  2R4J A;  4ZCC A;  4YSX A;  3ITJ A;  1NHR A;  2GR0 A;  3B3R A;  2Q6U A;  4O5U A;  2NPX A;  4H4Z A;  4K22 A;  2WP9 A;  4A99 A;  4GUV A;  3AE6 A;  4JDR A;  2RGO A;  3CPH G;  3ICR A;  3DGZ A;  4WCT A;  2VVL G;  4A5L A;  1ZDL A;  2V60 A;  4EIP A;  2QA1 A;  4UP3 A;  3UOX A;  1ZMC A;  2ACZ A;  2CFY A;  4U8I A;  1CC2 A;  4J34 A;  1IUX A;  2WP5 A;  4Z26 A;  1D4D A;  2A87 A;  3AB1 A;  3DJG X;  1CC6 A;  3NHO X;  2WPF A;  1MO9 A;  1Q1W A;  3AE8 A;  3UTE A;  1SEZ A;  2APG A;  3AWI A;  2WDR A;  3ZDN A;  1CJ3 A;  2B7S A;  1TDO A;  1O95 A;  4XWZ A;  1PN0 A;  2E4G A;  1TYP A;  1GTE A;  4EMJ A;  3H8L A;  1LPF A;  3QVR A;  3UOZ A;  2XVJ A;  4O5Q A;  2XFU A;  1YQZ A;  3I6D A;  3GDP A;  3P4P A;  2JB2 A;  4NWZ A;  4ZN0 A;  5JCN A;  1KDG A;  1COY A;  2C70 A;  1KF6 A;  4EM4 A;  2B9X A;  4U8O A;  5KVI A;  1FEC A;  2CVJ A;  5BVA A;  1FEB A;  2YM2 A;  3R9U A;  1H82 A;  3VRB A;  1D7L A;  2YM1 A;  2VOU A;  3VR8 A;  3C96 A;  4OPG A;  4K2X A;  3LZX A;  4H4U A;  2XFN A;  1XHC A;  3G5R A;  3ICS A;  4H50 A;  4X4J A;  2EQ9 A;  2X8G A;  4U8N A;  4EQW A;  2V3B A;  3NYE A;  3T37 A;  4H2R A;  4KX6 A;  4BV6 A;  1GRA A;  2WOI A;  1OJT A;  4EIQ A;  4C5O A;  1B37 A;  3DA1 A;  3NLC A;  4H2N A;  3T31 A;  4GRT A;  3P4S A;  3NYF A;  4K5S A;  1GRE A;  1PJ7 A;  2XLT A;  3ICT A;  3AYL A;  2HQM A;  3AYJ A;  4J57 A;  2WOV A;  4U2T A;  1H83 A;  3S61 A;  2YVF A;  1P2E A;  3ATQ A;  4IVO B;  2IVD A;  3CGE A;  4J2W A;  4NEV A;  1L9E A;  2ZZC A;  3RNM A;  5LV9 A;  1VRQ B;  3BI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...