1KDGA

Crystal structure of the flavin domain of cellobiose dehydrogenase
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
541
structure length
541
Chain Sequence
b'TPYDYIIVGAGPGGIIAADRLSEAGKKVLLLERGGPSTKQTGGTYVAPWATSSGLTKFDIPGLFESLFTDSNPFWWCKDITVFAGCLVGGGTSVNGALYWYPNDGDFSSSVGWPSSWTNHAPYTSKLSSRLPSTDHPSTDGQRYLEQSFNVVSQLLKGQGYNQATINDNPNYKDHVFGYSAFDFLNGKRAGPVATYLQTALARPNFTFKTNVMVSNVVRNGSQILGVQTNDPTLGPNGFIPVTPKGRVILSAGAFGTSRILFQSGIGPTDMIQTVQSNPTAAAALPPQNQWINLPVGMNAQDNPSINLVFTHPSIDAYENWADVWSNPRPADAAQYLANQSGVFAGASPKLNFWRAYSGSDGFTRYAQGTVRPGAASVNSSLPYNASQIFTITVYLSTGIQSRGRIGIDAALRGTVLTPPWLVNPVDKTVLLQALHDVVSNIGSIPGLTMITPDVTQTLEEYVDAYDPATMNSNHWVSSTTIGSSPQSAVVDSNVKVFGTNNLFIVDAGIIPHLPTGNPQGTLMSAAEQAAAKILALAGGP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cellobiose dehydrogenase
publication title Crystal Structure of the Flavoprotein Domain of the Extracellular Flavocytochrome Cellobiose Dehydrogenase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 190
structure length 541
sequence length 541
chains with identical sequence B
ec nomenclature ec 1.1.99.18: Cellobiose dehydrogenase (acceptor).
pdb deposition date 2001-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00732 GMC_oxred_N GMC oxidoreductase
A PF05199 GMC_oxred_C GMC oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.410.10 Alpha Beta 2-Layer Sandwich Cholesterol Oxidase; domain 2 Cholesterol Oxidase; domain 2 1kdgA02
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 1kdgA01
1GEUA 5KXJA 3NNEA 2X8HA 3CIRA 2GMHA 2XVHA 2C72A 4H2RA 2JK6A 3IF9A 2C75A 2XLPA 4JNQA 4RG4A 5U25A 3ICSA 4AT0A 1E1MA 1EBDA 2BC0A 1CJ3A 5KOWA 2B9WA 2GR3A 1JEHA 1GERA 2FJAA 4H4VA 2I0ZA 4I59A 4NTEA 2WOIA 3BI2A 3FBSA 1FEBA 4J57A 1B5QA 1GT8A 4K5SA 3CNJA 2QA1A 4YSXA 5HYMA 1LQUA 3D1CA 2GRTA 4CNJA 1N4UA 1N1PA 2WDVA 2C7GA 4JNAA 4EQSA 2R9ZA 3BHFA 1JNZA 2RGHA 3UTHA 3NN6X 3AE1A 5BULA 4IA6A 1VRQB 1K4QA 2RGJA 2X3NA 1D4EA 3AECA 3UKLA 3ALLA 1NHSA 5HXIA 2YM1A 3K30A 3F8RA 3AEBA 4TLZA 2TPRA 1PXCA 3GWFA 5JCIA 1B37A 4PABA 4CNKA 1LPFA 1PJ6A 2WP5A 2BCPA 3ATRA 5EOWA 4K22A 2YG5A 4O5QA 1PJ7A 3NLCA 2R46A 4EMIA 4KX6A 2V3BA 3L8KA 1N4WA 1CL0A 3CGEA 1JNRA 2NPXA 2V5ZA 4JN9A 1GRBA 3LADA 4J36A 3UOZA 5KOXA 1DXLA 1GNDA 2Z5XA 1PHHA 4TM3A 2R45A 3DJDA 3V3NA 1CJ4A 1KNRA 4XWZA 3VR9A 3AE5A 2GF3A 4OCGA 3LOVA 4I58A 5JCMA 3C96A 3SFEA 1O94A 4U2LA 5GSNA 2A8XA 1DOCA 1DODA 2Z5YA 4USRA 2XLTA 2VQBA 2ACZA 2WP9A 4USQA 2WDRA 1GRTA 1OJDA 2V61A 4GDPA 5DBJA 2A89A 2GB0A 4H4WA 2ARDA 1XHCA 1GALA 3UKKA 2VVLA 3AEGA 3AEAA 4BV6A 1GREA 3GSIA 1E1NA 1M64A 3QFBA 1ZMDA 3WE0A 1B8SA 3RP6A 3RP8A 4AOXA 1NPXA 3P4SA 3QJ4A 4H4TA 4A9WA 1OJ9A 2VRMA 3KA7A 3RHAA 2YLWA 1FCDA 1VDCA 1X31B 3CN8A 3VR8A 4Z26A 4IV9A 3UKAA 2JAEA 2WPEA 3FIMB 3I3LA 4FDCB 4MJWA 1D7LA 2X99A 3DH9A 3ITJA 2BACA 3CGBA 3ALJA 1N4VA 3GYJA 3G5SA 4Z44A 2OAMA 4EQRA 4HA6A 2C3DA 2YQUA 5L46A 3IWAA 2ZZCA 1TDFA 3DA1A 4DNAA 5JCKA 4TLXA 1YQ3A 1VG0A 3B6DA 3SM8A 4X9NA 1F8RA 3BHKA 4U8LA 2X8GA 2HQMA 2Q6UA 2XVIA 3REDA 3GDPA 1P2HA 3DGHA 2WPFA 2BABA 2C3CA 2C65A 1GTEA 1RP0A 3RNMA 3ABVA 4LIIA 5KRQA 2R0GA 4E0VA 1D5TA 3V3OA 3NGCX 3CPIG 4B1BA 3KU9A 3COXA 2QCUA 3AD9B 1TDKA 4TM0A 1PBFA 3GWDA 4ZN0A 2APGA 2GVCA 3AB1A 4JY3A 4U8MA 1IUXA 5KWFA 1Y56B 4GR1A 3NYEA 4FK1A 1CF3A 2CVJA 3D8XA 2GH5A 2YLZA 2VRLA 1TDNA 4GUVA 2FJBA 3NIXA 1H7WA 1LVLA 4Z24A 3AEEA 3P4PA 2C64A 1ZDLA 1E6EA 4WX1A 3UTGA 4C5OA 1GRGA 4YTNA 2R4EA 1JOAA 1ZOYA 2YVJA 1NENA 1GSNA 1O95A 1ZX9A 2E1MA 1W4XA 1E7PA 2BCGG 2BK3A 4YT0A 3AE3A 3GDNA 3KPFA 4WCTA 2XCGA 3C4AA 3DK4A 4C3XA 3AYIA 3CNDA 1IUUA 5HY5A 1GXFA 3SQPA 1FL2A 1DOEA 2WP6A 3GMBA 3ICTA 2B9XA 3LZWA 4HB9A 4U8KA 1M6IA 3T37A 2GAGB 3O0HA 3PO7A 1D4CA 3QSMA 5KVIA 4U2TA 1XDIA 4BK3A 2OLNA 1CBOA 2YVGA 4EQWA 5U63A 1BWCA 2B9YA 5CKUA 1Y56A 2XFNA 2BXRA 1YKJA 4OPUA 2YLRA 1JRYA 1LQTA 3G5QA 2XFPA 4GDEA 5JCNA 1DJQA 4X9MA 4B63A 1D7YA 1QO8A 2YLSA 1FECA 3BNUA 1KSUA 2H88A 2WDQA 4GF7A 1OJTA 4LU6A 4OPCA 1KF6A 2H89A 3EF6A 1EL8A 4Y4LA 4B67A 3NHOX 4AT2A 4DSHA 4H4YA 3M13A 2YLTA 1H82A 4P9SA 4U8OA 2EQ7A 1GTHA 1SEZA 4B64A 5BUKA 2E5VA 4H4PA 2DKHA 4EM4A 1UKVG 3KD9A 1ZOVA 3NK0X 5FS8A 4O5UA 3ZDNA 4APNA 3NK2X 1PDHA 1H84A 1ZY8A 2WBAA 2FJEA 3KVEA 3LZXA 4Z2TA 2JB3A 5GRTA 3LXDA 3DJJA 4TM4A 2BS4A 3R9UA 1CHUA 4FK1C 1L9EA 2AAQA 3AE8A 2Q0KA 3VRDB 4GCMA 2EQ9A 4YTPA 1MXTA 2YVFA 3UTFA 3IHMA 4IA5A 3CPJG 3CNSA 4NEWA 5FS7A 2BS3A 3K7QX 2GAHB 5FS6A 3UOVA 5BVAA 2WEUA 4OPTA 1GRHA 3UKHA 2XFUA 1MO9A 3F8PA 4OPGA 2E4GA 2GQFA 3NTDA 3QSSA 1PXAA 1TDOA 4A7AA 4M52A 2XFOA 3AE7A 1K0IA 1QLBA 2OALA 2Q0LA 3DGZA 1MOKA 3DMEA 4EQXA 2B76A 3K7MX 4YSZA 1BKWA 3GMCA 1S2YA 1YQZA 1ZP0A 4AP3A 1LJ1A 2V3AA 3JSKA 1COYA 1F8WA 2C73A 2XFQA 2IVEA 4H2PA 4BK2A 3AEDA 1TYTA 2OA1A 5IPYA 4XWRA 3NRNA 1ONFA 4Z43A 1NG4A 2JB1A 3ISHA 3CNPA 1OJAA 2R0CA 2YG4A 4OPLA 4ZCCA 4EIPA 2PHHA 3DJGX 3AWIA 1LTXR 3EPTA 4H4RA 5C3JA 1KDGA 4D03A 2V6OA 3CGDA 3NYFA 2IIDA 1EL9A 2Q7VA 1DJNA 1IUTA 3ALMA 2XDOA 4NTCA 4XXGA 4ZCDA 2CULA 4H2QA 2WU2A 1IUWA 3RP7A 1NEKA 3UKFA 4CCQA 1TYPA 2VQ7A 2DKIA 2X50A 4FX9A 3VQRA 2CDUA 1BF3A 1VQWA 3NG7X 4BJYA 3BNMA 1PXBA 3KLJA 4NZHA 2VOUA 3H8LA 1H7XA 2J3NA 4YKGA 1S2QA 3KKJA 3DJEA 4H4SA 1Q1WA 2F5ZA 4UDPA 5C2TA 4JDRA 2OLOA 4GRTA 4Y4MA 1P2EA 1K0LA 4H4QA 1ZK7A 4B68A 5JCLA 3CGCA 1TRBA 4K2XA 2NVKX 2W0HA 4YXDA 3UOYA 4YSHA 3QVPA 2Y6RA 2EQ6A 1L9DA 2O9ZA 1ZKQA 1O5WA 3G5RA 3L1RA 1F3PA 4ECHA 1QJDA 2JKCA 2QAEA 3AE6A 3PS9A 5FS9A 1GRFA 3URHA 4C77A 4CRTA 3NT6A 4RSLA 4A99A 4B66A 2BS2A 3SGLA 3GD3A 3QFAA 3IHGA 3NN0X 5J60A 1TDEA 2WU5A 4IVOB 4EM3A 2WPCA 2WETA 3H8IA 3M0OA 3K7TA 3P1WA 4LA1A 3OZ2A 2WS3A 3LB8A 2ZBWA 1E1KA 1H81A 1KNPA 3AE9A 1L0VA 2AQJA 3CNTA 2XYOA 4CY8A 4K8DA 4BJZA 4EIQA 4JQ9A 2JB2A 4C3YA 1B4VA 1Y0PA 3UP5A 4Y4NA 2VVLG 2BC1A 4AOSA 3P4QA 4A6NB 2C67A 4D04A 4C74A 1PBBA 2GEWA 1CC4A 2XLUA 3F8DA 2YLXA 1EL5A 3ZYXA 4A65A 3NYCA 1RYIA 2GR1A 4J34A 3VRBA 4YKFA 4Z2RA 2WHDA 1DOBA 1XANA 3AD7B 2BA9A 3Q9TA 4H50A 3NTAA 5EBKA 2YR5A 1Q1RA 5TR3A 1GETA 1RSGA 1KSSA 2C76A 1F8SA 2Y6QA 2GR0A 1S3BA 4TM1A 4YWOA 4ICYA 2VVMA 3UCLA 4AP1A 1FEAA 5M10A 5FMHA 3FMWA 2ZZBA 1F6MA 3ADAB 2YAUA 4B65A 1E1LA 4UDQA 2C66A 1AOGA 1H6VA 1NG3A 3AD8B 2BK4A 2CFYA 1VG9A 2UZZA 4H7UA 3QSEA 2YG6A 1OJCA 2WQYA 4OPIA 3NK1X 2GQWA 2YR6A 4A79A 1H86A 3E1TA 3ICRA 5U1OA 1IJHA 3B3RA 4CY6A 3AE2A 1PN0A 3ATQA 5J7XA 4CBQA 4A6NA 1K0JA 3S5WA 1GV4A 2WESA 2YR4A 1BGNA 2YM2A 2BXSA 5HHFA 1GOSA 2RGOA 3OC4A 1PS9A 1Z6LA 4YSYA 3EAOA 2TMDA 5CQFA 2B7RA 3HZLA 3Q6JA 1PJ5A 4PAAA 1ZMCA 4KPRA 2XLSA 1KFYA 3AEFA 3S61A 4ADWA 3DK8A 2V60A 4K5RA 2R4JA 3UKQA 1JU2A 1GPEA 1NDAA 2XLRA 3NH3X 3UOXA 1NHPA 4Z2UA 1S3EA 1NHRA 3CTYA 4J56A 3IC9A 4U8JA 1NHQA 3FG2P 2R0PA 3UKPA 4OVIA 2PYXA 3P4RA 4H4ZA 1PBDA 1XPQA 4H4XA 1IUSA 3NKSA 1GESA 1YQ4A 3FPZA 2FJDA 4RG3A 2BYBA 4J31A 5M0ZA 2WOVA 2JBVA 4K7ZA 4YTMA 5LV9A 1DNCA 1HYUA 1D4DA 4U8PA 5BRTA 3C4NA 2C70A 4N9XA 4EMWA 3AE4A 4U8NA 1NAAA 3UTEA 3LJPA 2A87A 3GYIA 2GMJA 1LV0A 1L9CA 1EL7A 4Z25A 2FBWA 3EANA 1ELIA 3P9UA 2IVDA 4A5LA 3M12A 1CJCA 4J2WA 4BURA 4H4UA 2B7SA 4DSGA 1YY5A 1Q9IA 2YG7A 2ZZ0A 3AXBA 5ER0A 1H83A 5KVHA 2BK5A 1PBCA 3PVCA 3II4A 1JRXA 3UP4A 2RABA 4UP3A 3I6DA 4IVMB 3BI4A 4OPDA 1E39A 3BI5A 4J33A 4B69A 3CPHG 4BK1A 2AR8A 2YG3A 5EB4A 2GR2A 3GRSA 1REOA 5IQ4A 2EQ8A 4DGKA 1PBEA 3QVRA 4H2NA 3H4KA 4X4JA 5IQ1A 2XVEA 3AYLA 4CCRA 2XVFA 1BZLA 1FOHA 1CJ2A 5EB5A 4JY2A 3AYJA 1V59A 1CC6A 3DK9A 4U8IA 1BGJA 2WOWA 1CC2A 1IUVA 2QA2A 4NTDA 3V76A 3GD4A 2X8CA 1GRAA 4REKA 4NEVA 2GV8A 2YWLA 2XVJA 2VZ2A 3GRTA 3SFDA 3VRAA 4U2SA 1JRZA 4EMJA 4UDRA
chains in the Genus database with same CATH superfamily
1GEUA 5KXJA 3NNEA 2X8HA 3CIRA 2GMHA 2XVHA 2C72A 4H2RA 2JK6A 3IF9A 2C75A 2XLPA 4JNQA 4RG4A 5U25A 3ICSA 4AT0A 1E1MA 1EBDA 2BC0A 1CJ3A 5KOWA 2B9WA 2GR3A 1JEHA 1GERA 2FJAA 4H4VA 2I0ZA 4I59A 4NTEA 2WOIA 3BI2A 3FBSA 1FEBA 4J57A 1B5QA 1GT8A 4K5SA 3CNJA 2QA1A 4YSXA 5HYMA 1LQUA 3HYXA 3D1CA 2GRTA 4CNJA 1N4UA 1N1PA 2WDVA 2C7GA 4JNAA 4EQSA 2R9ZA 3BHFA 1JNZA 2RGHA 3UTHA 3NN6X 3AE1A 5KMQA 5BULA 4IA6A 1VRQB 1K4QA 2RGJA 2X3NA 1D4EA 3AECA 3T0KA 3UKLA 3ALLA 1NHSA 2BRYA 2YM1A 3K30A 3F8RA 5HXIA 3AEBA 4TLZA 2TPRA 1PXCA 3GWFA 3SY4A 5JCIA 1B37A 4PABA 4CNKA 1LPFA 1PJ6A 2WP5A 2BCPA 3ATRA 5EOWA 4K22A 2YG5A 4O5QA 1PJ7A 3NLCA 2R46A 4EMIA 4KX6A 2V3BA 3L8KA 1N4WA 1CL0A 3CGEA 1JNRA 2NPXA 2V5ZA 4JN9A 1GRBA 3LADA 4J36A 3UOZA 5KOXA 1DXLA 1GNDA 2Z5XA 1PHHA 4TM3A 2R45A 3DJDA 3V3NA 1CJ4A 1KNRA 4XWZA 3VR9A 3AE5A 2GF3A 4OCGA 3LOVA 4I58A 5JCMA 3C96A 3SFEA 1O94A 4U2LA 5GSNA 2A8XA 1DOCA 1DODA 2Z5YA 4USRA 2XLTA 2VQBA 2ACZA 2WP9A 4USQA 2WDRA 1GRTA 1OJDA 2V61A 4GDPA 5DBJA 2A89A 2GB0A 4H4WA 2ARDA 1XHCA 1GALA 3UKKA 2VVLA 3AEGA 3AEAA 4BV6A 1GREA 4G73A 3GSIA 1E1NA 1M64A 3QFBA 1ZMDA 3WE0A 1B8SA 3RP6A 3RP8A 4AOXA 1NPXA 3HYWA 3P4SA 3QJ4A 4H4TA 4A9WA 1OJ9A 2VRMA 3KA7A 3RHAA 2YLWA 1FCDA 1VDCA 1X31B 3CN8A 3VR8A 4Z26A 4IV9A 3UKAA 2JAEA 2WPEA 3FIMB 3I3LA 4MJWA 4FDCB 1D7LA 2X99A 3DH9A 3ITJA 2BACA 3CGBA 3ALJA 1N4VA 3GYJA 3G5SA 4Z44A 2OAMA 4EQRA 4HA6A 2C3DA 2YQUA 5L46A 3T2YA 3IWAA 2ZZCA 1TDFA 3DA1A 4DNAA 5JCKA 4TLXA 1YQ3A 1VG0A 3B6DA 3SM8A 2C4CA 1F8RA 3BHKA 4X9NA 4U8LA 2X8GA 2HQMA 3REDA 2Q6UA 2XVIA 3GDPA 1P2HA 3DGHA 2WPFA 2BABA 2C3CA 2C65A 1GTEA 1RP0A 3T14A 3RNMA 3ABVA 4LIIA 5KRQA 4GAVA 2R0GA 4E0VA 1D5TA 3V3OA 3NGCX 3CPIG 4B1BA 3KU9A 3COXA 2QCUA 3AD9B 1TDKA 4TM0A 1PBFA 3GWDA 4ZN0A 2APGA 2GVCA 3AB1A 4JY3A 4U8MA 1IUXA 5KWFA 1Y56B 4GR1A 3NYEA 4FK1A 1CF3A 2CVJA 3D8XA 2GH5A 2YLZA 2VRLA 1TDNA 4GUVA 2FJBA 3NIXA 1H7WA 1LVLA 4Z24A 3AEEA 3P4PA 2C64A 1ZDLA 1E6EA 4WX1A 3UTGA 4C5OA 1GRGA 4YTNA 2R4EA 1JOAA 1ZOYA 2YVJA 1NENA 1GSNA 1O95A 1ZX9A 2E1MA 3SZWA 1W4XA 1E7PA 2BCGG 2BK3A 4YT0A 3GDNA 3AE3A 3KPFA 4WCTA 2XCGA 3C4AA 3DK4A 4C3XA 3AYIA 3CNDA 1IUUA 5HY5A 1GXFA 3SQPA 1FL2A 1DOEA 2WP6A 3GMBA 3ICTA 2B9XA 3LZWA 4HB9A 4U8KA 1M6IA 3T37A 2GAGB 3O0HA 3PO7A 1D4CA 3QSMA 5KVIA 4U2TA 1XDIA 4BK3A 2OLNA 5KMRA 1CBOA 2YVGA 4EQWA 5U63A 1BWCA 2B9YA 5CKUA 1Y56A 2XFNA 2BXRA 1YKJA 4OPUA 2YLRA 1JRYA 1LQTA 3G5QA 2XFPA 4GDEA 5JCNA 1DJQA 4X9MA 4B63A 1D7YA 1QO8A 2YLSA 1FECA 3BNUA 1KSUA 2H88A 2WDQA 4GF7A 1OJTA 4LU6A 4OPCA 1KF6A 2H89A 3T31A 3EF6A 1EL8A 4Y4LA 4B67A 3NHOX 4AT2A 4DSHA 4H4YA 3M13A 2YLTA 1H82A 4P9SA 4U8OA 2EQ7A 1GTHA 1SEZA 4B64A 5BUKA 2E5VA 4H4PA 3SYIA 2DKHA 4EM4A 1UKVG 3KD9A 1ZOVA 3NK0X 5FS8A 4O5UA 3ZDNA 4APNA 3NK2X 1PDHA 1H84A 1ZY8A 2WBAA 2FJEA 3KVEA 3LZXA 4Z2TA 5KNLA 2JB3A 5GRTA 3LXDA 3DJJA 4TM4A 2BS4A 3R9UA 1CHUA 4FK1C 1L9EA 2AAQA 3AE8A 2Q0KA 3VRDB 4GCMA 2EQ9A 4YTPA 4G6GA 1MXTA 2YVFA 3UTFA 3IHMA 4IA5A 3CPJG 3CNSA 4NEWA 5FS7A 2BS3A 3K7QX 2GAHB 5FS6A 3UOVA 5BVAA 2WEUA 4OPTA 1GRHA 3UKHA 2XFUA 1MO9A 3F8PA 4OPGA 2E4GA 2GQFA 3NTDA 3QSSA 1PXAA 1TDOA 4A7AA 4M52A 2XFOA 3AE7A 1K0IA 1QLBA 2OALA 3SZFA 2Q0LA 3DGZA 1MOKA 3DMEA 4G6HA 4EQXA 2B76A 3K7MX 4YSZA 1BKWA 3GMCA 1S2YA 1YQZA 1ZP0A 4AP3A 1LJ1A 2V3AA 3JSKA 1COYA 1F8WA 2C73A 2XFQA 2IVEA 4H2PA 4BK2A 3AEDA 1TYTA 2OA1A 5IPYA 4XWRA 3NRNA 3T2ZA 1ONFA 4Z43A 1NG4A 2JB1A 3ISHA 3CNPA 1OJAA 2R0CA 2YG4A 4OPLA 4ZCCA 4EIPA 2PHHA 3DJGX 3AWIA 1LTXR 3EPTA 4H4RA 2BRAA 5C3JA 1KDGA 4D03A 2V6OA 3CGDA 3NYFA 2IIDA 1EL9A 2Q7VA 1DJNA 1IUTA 3ALMA 2XDOA 4NTCA 4XXGA 4ZCDA 2CULA 4H2QA 2WU2A 1IUWA 3RP7A 1NEKA 3UKFA 4CCQA 1TYPA 2VQ7A 2DKIA 2X50A 4FX9A 3VQRA 2CDUA 1BF3A 1VQWA 3NG7X 4BJYA 3BNMA 1PXBA 3KLJA 4NZHA 2VOUA 3H8LA 1H7XA 2J3NA 4YKGA 1S2QA 3KKJA 3DJEA 4H4SA 1Q1WA 4UDPA 2F5ZA 5C2TA 4JDRA 2OLOA 4GRTA 4Y4MA 1P2EA 1K0LA 4H4QA 1ZK7A 4B68A 5JCLA 3GYXA 3CGCA 1TRBA 4K2XA 2NVKX 2W0HA 4YXDA 3UOYA 4YSHA 3QVPA 2Y6RA 2EQ6A 1L9DA 2O9ZA 1ZKQA 1O5WA 3G5RA 3L1RA 1F3PA 4ECHA 1QJDA 2JKCA 4G9KA 2QAEA 3AE6A 3PS9A 5FS9A 1GRFA 3URHA 4C77A 4CRTA 3NT6A 4RSLA 4A99A 4B66A 2BS2A 3SGLA 3SZCA 3GD3A 3QFAA 3IHGA 3NN0X 5J60A 1TDEA 2WU5A 4IVOB 4EM3A 2WPCA 2WETA 3H8IA 3M0OA 3K7TA 3P1WA 4LA1A 3OZ2A 2WS3A 3LB8A 2ZBWA 1E1KA 3SXIA 1H81A 1KNPA 3AE9A 1L0VA 2AQJA 3CNTA 2XYOA 4CY8A 4K8DA 4BJZA 4EIQA 4JQ9A 2JB2A 4C3YA 1B4VA 1Y0PA 3UP5A 4Y4NA 2VVLG 2BC1A 4AOSA 3P4QA 5KMSA 4A6NB 2C67A 4D04A 4C74A 1PBBA 4GAPA 2GEWA 1CC4A 2XLUA 3F8DA 2YLXA 1EL5A 3KPKA 3ZYXA 4A65A 3NYCA 1RYIA 2GR1A 4J34A 3VRBA 4YKFA 4Z2RA 2WHDA 1DOBA 1XANA 3AD7B 2BA9A 3Q9TA 4H50A 3NTAA 5EBKA 2YR5A 4II2A 1Q1RA 5TR3A 1GETA 1RSGA 1KSSA 2C76A 1F8SA 2Y6QA 2GR0A 1S3BA 4TM1A 4YWOA 4ICYA 2VVMA 3UCLA 4AP1A 1FEAA 5M10A 5FMHA 3FMWA 2ZZBA 4NNJA 1F6MA 3ADAB 2YAUA 4B65A 1E1LA 4UDQA 2C66A 1AOGA 1H6VA 1NG3A 3AD8B 2BK4A 2CFYA 1VG9A 2UZZA 4H7UA 3QSEA 2YG6A 1OJCA 2WQYA 4OPIA 3NK1X 2GQWA 2YR6A 4A79A 1H86A 3E1TA 3ICRA 5U1OA 1IJHA 3B3RA 4CY6A 3AE2A 1PN0A 3ATQA 5J7XA 4CBQA 4A6NA 1K0JA 3S5WA 1GV4A 2WESA 2YR4A 1BGNA 2YM2A 2BXSA 5HHFA 1GOSA 2RGOA 3OC4A 1PS9A 1Z6LA 3SX6A 4YSYA 3EAOA 2TMDA 5CQFA 2B7RA 3HZLA 3Q6JA 1PJ5A 4PAAA 1ZMCA 4KPRA 2XLSA 1KFYA 3AEFA 3S61A 4ADWA 5KMPA 3DK8A 2V60A 4K5RA 2R4JA 3UKQA 1JU2A 1GPEA 1NDAA 2XLRA 3NH3X 3UOXA 1NHPA 4Z2UA 1S3EA 1NHRA 3CTYA 4J56A 3IC9A 4U8JA 1NHQA 3FG2P 2R0PA 3UKPA 4OVIA 2PYXA 3P4RA 4H4ZA 1PBDA 1XPQA 4H4XA 1IUSA 3NKSA 1GESA 1YQ4A 3FPZA 2FJDA 4RG3A 2BYBA 4J31A 5M0ZA 2WOVA 2JBVA 4K7ZA 4YTMA 5LV9A 1DNCA 1HYUA 1D4DA 4U8PA 5BRTA 3C4NA 2C70A 3HYVA 4N9XA 3SZ0A 3AE4A 4U8NA 1NAAA 4EMWA 3UTEA 3LJPA 2A87A 4NWZA 3GYIA 2GMJA 1LV0A 1L9CA 1EL7A 4Z25A 2FBWA 3EANA 1ELIA 3P9UA 2IVDA 4A5LA 3M12A 1CJCA 4J2WA 4BURA 4H4UA 2B7SA 4DSGA 1YY5A 1Q9IA 2YG7A 2ZZ0A 3AXBA 5ER0A 1H83A 4II3A 4G74A 5KVHA 2BK5A 1PBCA 3PVCA 3II4A 1JRXA 3UP4A 2RABA 4UP3A 3I6DA 4IVMB 3BI4A 4OPDA 1E39A 3BI5A 4J33A 4B69A 3CPHG 4BK1A 2AR8A 3CMMA 5EB4A 2YG3A 2GR2A 3GRSA 1REOA 5IQ4A 2EQ8A 4DGKA 1PBEA 3QVRA 4H2NA 3T2KA 3H4KA 4X4JA 5IQ1A 2XVEA 3AYLA 4CCRA 2XVFA 1BZLA 1FOHA 1CJ2A 5EB5A 4JY2A 3AYJA 1V59A 1CC6A 3DK9A 4U8IA 1BGJA 2WOWA 1CC2A 1IUVA 2QA2A 4NTDA 3V76A 3GD4A 2X8CA 1GRAA 4REKA 4NEVA 2GV8A 2YWLA 2XVJA 2VZ2A 3GRTA 3SFDA 3VRAA 4U2SA 1JRZA 4EMJA 4UDRA
chains in the Genus database with same CATH topology
1GEUA 5KXJA 3NNEA 2X8HA 3CIRA 2GMHA 2XVHA 2C72A 4H2RA 2JK6A 3IF9A 2C75A 2XLPA 4JNQA 4RG4A 5U25A 3ICSA 4AT0A 1E1MA 1EBDA 2BC0A 1CJ3A 5KOWA 2B9WA 2GR3A 1JEHA 1GERA 2FJAA 4H4VA 2I0ZA 4I59A 4NTEA 2WOIA 3BI2A 3FBSA 1FEBA 4J57A 1B5QA 1GT8A 4K5SA 3CNJA 2QA1A 4YSXA 5HYMA 1LQUA 3HYXA 3D1CA 2GRTA 4CNJA 1N4UA 1N1PA 2WDVA 2C7GA 4JNAA 4EQSA 2R9ZA 3BHFA 1JNZA 2RGHA 3UTHA 3NN6X 3AE1A 5KMQA 5BULA 4IA6A 1VRQB 1K4QA 2RGJA 2X3NA 1D4EA 3AECA 3T0KA 3UKLA 3ALLA 1NHSA 2BRYA 2YM1A 3K30A 3F8RA 5HXIA 3AEBA 4TLZA 2TPRA 1PXCA 3GWFA 3SY4A 5JCIA 1B37A 4PABA 4CNKA 1LPFA 1PJ6A 2WP5A 2BCPA 3ATRA 5EOWA 4K22A 2YG5A 4O5QA 1PJ7A 3NLCA 2R46A 4EMIA 4KX6A 2V3BA 3L8KA 1N4WA 1CL0A 3CGEA 1JNRA 2NPXA 2V5ZA 4JN9A 1GRBA 3LADA 4J36A 3UOZA 5KOXA 1DXLA 1GNDA 2Z5XA 1PHHA 4TM3A 2R45A 3DJDA 3V3NA 1CJ4A 1KNRA 4XWZA 3VR9A 3AE5A 2GF3A 4OCGA 3LOVA 4I58A 5JCMA 3C96A 3SFEA 1O94A 4U2LA 5GSNA 2A8XA 1DOCA 1DODA 2Z5YA 4USRA 2XLTA 2VQBA 2ACZA 2WP9A 4USQA 2WDRA 1GRTA 1OJDA 2V61A 4GDPA 5DBJA 2A89A 2GB0A 4H4WA 2ARDA 1XHCA 1GALA 3UKKA 2VVLA 3AEGA 3AEAA 4BV6A 1GREA 4G73A 3GSIA 1E1NA 1M64A 3QFBA 1ZMDA 3WE0A 1B8SA 3RP6A 3RP8A 4AOXA 1NPXA 3HYWA 3P4SA 3QJ4A 4H4TA 4A9WA 1OJ9A 2VRMA 3KA7A 3RHAA 2YLWA 1FCDA 1VDCA 1X31B 3CN8A 3VR8A 4Z26A 4IV9A 3UKAA 2JAEA 2WPEA 3FIMB 3I3LA 4MJWA 4FDCB 1D7LA 2X99A 3DH9A 3ITJA 2BACA 3CGBA 3ALJA 1N4VA 3GYJA 3G5SA 4Z44A 2OAMA 4EQRA 4HA6A 2C3DA 2YQUA 5L46A 3T2YA 3IWAA 2ZZCA 1TDFA 3DA1A 4DNAA 5JCKA 4TLXA 1YQ3A 1VG0A 3B6DA 3SM8A 2C4CA 1F8RA 3BHKA 4X9NA 4U8LA 2X8GA 2HQMA 3REDA 2Q6UA 2XVIA 3GDPA 1P2HA 3DGHA 2WPFA 2BABA 2C3CA 2C65A 1GTEA 1RP0A 3T14A 3RNMA 3ABVA 4LIIA 5KRQA 4GAVA 2R0GA 4E0VA 1D5TA 3V3OA 3NGCX 3CPIG 4B1BA 3KU9A 3COXA 2QCUA 3AD9B 1TDKA 4TM0A 1PBFA 3GWDA 4ZN0A 2APGA 2GVCA 3AB1A 4JY3A 4U8MA 1IUXA 5KWFA 1Y56B 4GR1A 3NYEA 4FK1A 1CF3A 2CVJA 3D8XA 2GH5A 2YLZA 2VRLA 1TDNA 4GUVA 2FJBA 3NIXA 1H7WA 1LVLA 4Z24A 3AEEA 3P4PA 2C64A 1ZDLA 1E6EA 4WX1A 3UTGA 4C5OA 1GRGA 4YTNA 2R4EA 1JOAA 1ZOYA 2YVJA 1NENA 1GSNA 1O95A 1ZX9A 2E1MA 3SZWA 1W4XA 1E7PA 2BCGG 2BK3A 4YT0A 3GDNA 3AE3A 3KPFA 4WCTA 2XCGA 3C4AA 3DK4A 4C3XA 3AYIA 3CNDA 1IUUA 5HY5A 1GXFA 3SQPA 1FL2A 1DOEA 2WP6A 3GMBA 3ICTA 2B9XA 3LZWA 4HB9A 4U8KA 1M6IA 3T37A 2GAGB 3O0HA 3PO7A 1D4CA 3QSMA 5KVIA 4U2TA 1XDIA 4BK3A 2OLNA 5KMRA 1CBOA 2YVGA 4EQWA 5U63A 1BWCA 2B9YA 5CKUA 1Y56A 2XFNA 2BXRA 1YKJA 4OPUA 2YLRA 1JRYA 1LQTA 3G5QA 2XFPA 4GDEA 5JCNA 1DJQA 4X9MA 4B63A 1D7YA 1QO8A 2YLSA 1FECA 3BNUA 1KSUA 2H88A 2WDQA 4GF7A 1OJTA 4LU6A 4OPCA 1KF6A 2H89A 3T31A 3EF6A 1EL8A 4Y4LA 4B67A 3NHOX 4AT2A 4DSHA 4H4YA 3M13A 2YLTA 1H82A 4P9SA 4U8OA 2EQ7A 1GTHA 1SEZA 4B64A 5BUKA 2E5VA 4H4PA 3SYIA 2DKHA 4EM4A 1UKVG 3KD9A 1ZOVA 3NK0X 5FS8A 4O5UA 3ZDNA 4APNA 3NK2X 1PDHA 1H84A 1ZY8A 2WBAA 2FJEA 3KVEA 3LZXA 4Z2TA 5KNLA 2JB3A 5GRTA 3LXDA 3DJJA 4TM4A 2BS4A 3R9UA 1CHUA 4FK1C 1L9EA 2AAQA 3AE8A 2Q0KA 3VRDB 4GCMA 2EQ9A 4YTPA 4G6GA 1MXTA 2YVFA 3UTFA 3IHMA 4IA5A 3CPJG 3CNSA 4NEWA 5FS7A 2BS3A 3K7QX 2GAHB 5FS6A 3UOVA 5BVAA 2WEUA 4OPTA 1GRHA 3UKHA 2XFUA 1MO9A 3F8PA 4OPGA 2E4GA 2GQFA 3NTDA 3QSSA 1PXAA 1TDOA 4A7AA 4M52A 2XFOA 3AE7A 1K0IA 1QLBA 2OALA 3SZFA 2Q0LA 3DGZA 1MOKA 3DMEA 4G6HA 4EQXA 2B76A 3K7MX 4YSZA 1BKWA 3GMCA 1S2YA 1YQZA 1ZP0A 4AP3A 1LJ1A 2V3AA 3JSKA 1COYA 1F8WA 2C73A 2XFQA 2IVEA 4H2PA 4BK2A 3AEDA 1TYTA 2OA1A 5IPYA 4XWRA 3NRNA 3T2ZA 1ONFA 4Z43A 1NG4A 2JB1A 3ISHA 3CNPA 1OJAA 2R0CA 2YG4A 4OPLA 4ZCCA 4EIPA 2PHHA 3DJGX 3AWIA 1LTXR 3EPTA 4H4RA 2BRAA 5C3JA 1KDGA 4D03A 2V6OA 3CGDA 3NYFA 2IIDA 1EL9A 2Q7VA 1DJNA 1IUTA 3ALMA 2XDOA 4NTCA 4XXGA 4ZCDA 2CULA 4H2QA 2WU2A 1IUWA 3RP7A 1NEKA 3UKFA 4CCQA 1TYPA 2VQ7A 2DKIA 2X50A 4FX9A 3VQRA 2CDUA 1BF3A 1VQWA 3NG7X 4BJYA 3BNMA 1PXBA 3KLJA 4NZHA 2VOUA 3H8LA 1H7XA 2J3NA 4YKGA 1S2QA 3KKJA 3DJEA 4H4SA 1Q1WA 4UDPA 2F5ZA 5C2TA 4JDRA 2OLOA 4GRTA 4Y4MA 1P2EA 1K0LA 4H4QA 1ZK7A 4B68A 5JCLA 3GYXA 3CGCA 1TRBA 4K2XA 2NVKX 2W0HA 4YXDA 3UOYA 4YSHA 3QVPA 2Y6RA 2EQ6A 1L9DA 2O9ZA 1ZKQA 1O5WA 3G5RA 3L1RA 1F3PA 4ECHA 1QJDA 2JKCA 4G9KA 2QAEA 3AE6A 3PS9A 5FS9A 1GRFA 3URHA 4C77A 4CRTA 3NT6A 4RSLA 4A99A 4B66A 2BS2A 3SGLA 3SZCA 3GD3A 3QFAA 3IHGA 3NN0X 5J60A 1TDEA 2WU5A 4IVOB 4EM3A 2WPCA 2WETA 3H8IA 3M0OA 3K7TA 3P1WA 4LA1A 3OZ2A 2WS3A 3LB8A 2ZBWA 1E1KA 3SXIA 1H81A 1KNPA 3AE9A 1L0VA 2AQJA 3CNTA 2XYOA 4CY8A 4K8DA 4BJZA 4EIQA 4JQ9A 2JB2A 4C3YA 1B4VA 1Y0PA 3UP5A 4Y4NA 2VVLG 2BC1A 4AOSA 3P4QA 5KMSA 4A6NB 2C67A 4D04A 4C74A 1PBBA 4GAPA 2GEWA 1CC4A 2XLUA 3F8DA 2YLXA 1EL5A 3KPKA 3ZYXA 4A65A 3NYCA 1RYIA 2GR1A 4J34A 3VRBA 4YKFA 4Z2RA 2WHDA 1DOBA 1XANA 3AD7B 2BA9A 3Q9TA 4H50A 3NTAA 5EBKA 2YR5A 4II2A 1Q1RA 5TR3A 1GETA 1RSGA 1KSSA 2C76A 1F8SA 2Y6QA 2GR0A 1S3BA 4TM1A 4YWOA 4ICYA 2VVMA 3UCLA 4AP1A 1FEAA 5M10A 5FMHA 3FMWA 2ZZBA 4NNJA 1F6MA 3ADAB 2YAUA 4B65A 1E1LA 4UDQA 2C66A 1AOGA 1H6VA 1NG3A 3AD8B 2BK4A 2CFYA 1VG9A 2UZZA 4H7UA 3QSEA 2YG6A 1OJCA 2WQYA 4OPIA 3NK1X 2GQWA 2YR6A 4A79A 1H86A 3E1TA 3ICRA 5U1OA 1IJHA 3B3RA 4CY6A 3AE2A 1PN0A 3ATQA 5J7XA 4CBQA 4A6NA 1K0JA 3S5WA 1GV4A 2WESA 2YR4A 1BGNA 2YM2A 2BXSA 5HHFA 1GOSA 2RGOA 3OC4A 1PS9A 1Z6LA 3SX6A 4YSYA 3EAOA 2TMDA 5CQFA 2B7RA 3HZLA 3Q6JA 1PJ5A 4PAAA 1ZMCA 4KPRA 2XLSA 1KFYA 3AEFA 3S61A 4ADWA 5KMPA 3DK8A 2V60A 4K5RA 2R4JA 3UKQA 1JU2A 1GPEA 1NDAA 2XLRA 3NH3X 3UOXA 1NHPA 4Z2UA 1S3EA 1NHRA 3CTYA 4J56A 3IC9A 4U8JA 1NHQA 3FG2P 2R0PA 3UKPA 4OVIA 2PYXA 3P4RA 4H4ZA 1PBDA 1XPQA 4H4XA 1IUSA 3NKSA 1GESA 1YQ4A 3FPZA 2FJDA 4RG3A 2BYBA 4J31A 5M0ZA 2WOVA 2JBVA 4K7ZA 4YTMA 5LV9A 1DNCA 1HYUA 1D4DA 4U8PA 5BRTA 3C4NA 2C70A 3HYVA 4N9XA 3SZ0A 3AE4A 4U8NA 1NAAA 4EMWA 3UTEA 3LJPA 2A87A 4NWZA 3GYIA 2GMJA 1LV0A 1L9CA 1EL7A 4Z25A 2FBWA 3EANA 1ELIA 3P9UA 2IVDA 4A5LA 3M12A 1CJCA 4J2WA 4BURA 4H4UA 2B7SA 4DSGA 1YY5A 1Q9IA 2YG7A 2ZZ0A 3AXBA 5ER0A 1H83A 4II3A 4G74A 5KVHA 2BK5A 1PBCA 3PVCA 3II4A 1JRXA 3UP4A 2RABA 4UP3A 3I6DA 4IVMB 3BI4A 4OPDA 1E39A 3BI5A 4J33A 4B69A 3CPHG 4BK1A 2AR8A 3CMMA 5EB4A 2YG3A 2GR2A 3GRSA 1REOA 5IQ4A 2EQ8A 4DGKA 1PBEA 3QVRA 4H2NA 3T2KA 3H4KA 4X4JA 5IQ1A 2XVEA 3AYLA 4CCRA 2XVFA 1BZLA 1FOHA 1CJ2A 5EB5A 4JY2A 3AYJA 1V59A 1CC6A 3DK9A 4U8IA 1BGJA 2WOWA 1CC2A 1IUVA 2QA2A 4NTDA 3V76A 3GD4A 2X8CA 1GRAA 4REKA 4NEVA 2GV8A 2YWLA 2XVJA 2VZ2A 3GRTA 3SFDA 3VRAA 4U2SA 1JRZA 4EMJA 4UDRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GEU A;  5KXJ A;  3NNE A;  2X8H A;  3CIR A;  2GMH A;  2XVH A;  2C72 A;  4H2R A;  2JK6 A;  3IF9 A;  2C75 A;  2XLP A;  4JNQ A;  4RG4 A;  5U25 A;  3ICS A;  4AT0 A;  1E1M A;  1EBD A;  2BC0 A;  1CJ3 A;  5KOW A;  2B9W A;  2GR3 A;  1JEH A;  1GER A;  2FJA A;  4H4V A;  2I0Z A;  4I59 A;  4NTE A;  2WOI A;  3BI2 A;  3FBS A;  1FEB A;  4J57 A;  1B5Q A;  1GT8 A;  4K5S A;  3CNJ A;  2QA1 A;  4YSX A;  5HYM A;  1LQU A;  3D1C A;  2GRT A;  4CNJ A;  1N4U A;  1N1P A;  2WDV A;  2C7G A;  4JNA A;  4EQS A;  2R9Z A;  3BHF A;  1JNZ A;  2RGH A;  3UTH A;  3NN6 X;  3AE1 A;  5BUL A;  4IA6 A;  1VRQ B;  1K4Q A;  2RGJ A;  2X3N A;  1D4E A;  3AEC A;  3UKL A;  3ALL A;  1NHS A;  5HXI A;  2YM1 A;  3K30 A;  3F8R A;  3AEB A;  4TLZ A;  2TPR A;  1PXC A;  3GWF A;  5JCI A;  1B37 A;  4PAB A;  4CNK A;  1LPF A;  1PJ6 A;  2WP5 A;  2BCP A;  3ATR A;  5EOW A;  4K22 A;  2YG5 A;  4O5Q A;  1PJ7 A;  3NLC A;  2R46 A;  4EMI A;  4KX6 A;  2V3B A;  3L8K A;  1N4W A;  1CL0 A;  3CGE A;  1JNR A;  2NPX A;  2V5Z A;  4JN9 A;  1GRB A;  3LAD A;  4J36 A;  3UOZ A;  5KOX A;  1DXL A;  1GND A;  2Z5X A;  1PHH A;  4TM3 A;  2R45 A;  3DJD A;  3V3N A;  1CJ4 A;  1KNR A;  4XWZ A;  3VR9 A;  3AE5 A;  2GF3 A;  4OCG A;  3LOV A;  4I58 A;  5JCM A;  3C96 A;  3SFE A;  1O94 A;  4U2L A;  5GSN A;  2A8X A;  1DOC A;  1DOD A;  2Z5Y A;  4USR A;  2XLT A;  2VQB A;  2ACZ A;  2WP9 A;  4USQ A;  2WDR A;  1GRT A;  1OJD A;  2V61 A;  4GDP A;  5DBJ A;  2A89 A;  2GB0 A;  4H4W A;  2ARD A;  1XHC A;  1GAL A;  3UKK A;  2VVL A;  3AEG A;  3AEA A;  4BV6 A;  1GRE A;  3GSI A;  1E1N A;  1M64 A;  3QFB A;  1ZMD A;  3WE0 A;  1B8S A;  3RP6 A;  3RP8 A;  4AOX A;  1NPX A;  3P4S A;  3QJ4 A;  4H4T A;  4A9W A;  1OJ9 A;  2VRM A;  3KA7 A;  3RHA A;  2YLW A;  1FCD A;  1VDC A;  1X31 B;  3CN8 A;  3VR8 A;  4Z26 A;  4IV9 A;  3UKA A;  2JAE A;  2WPE A;  3FIM B;  3I3L A;  4FDC B;  4MJW A;  1D7L A;  2X99 A;  3DH9 A;  3ITJ A;  2BAC A;  3CGB A;  3ALJ A;  1N4V A;  3GYJ A;  3G5S A;  4Z44 A;  2OAM A;  4EQR A;  4HA6 A;  2C3D A;  2YQU A;  5L46 A;  3IWA A;  2ZZC A;  1TDF A;  3DA1 A;  4DNA A;  5JCK A;  4TLX A;  1YQ3 A;  1VG0 A;  3B6D A;  3SM8 A;  4X9N A;  1F8R A;  3BHK A;  4U8L A;  2X8G A;  2HQM A;  2Q6U A;  2XVI A;  3RED A;  3GDP A;  1P2H A;  3DGH A;  2WPF A;  2BAB A;  2C3C A;  2C65 A;  1GTE A;  1RP0 A;  3RNM A;  3ABV A;  4LII A;  5KRQ A;  2R0G A;  4E0V A;  1D5T A;  3V3O A;  3NGC X;  3CPI G;  4B1B A;  3KU9 A;  3COX A;  2QCU A;  3AD9 B;  1TDK A;  4TM0 A;  1PBF A;  3GWD A;  4ZN0 A;  2APG A;  2GVC A;  3AB1 A;  4JY3 A;  4U8M A;  1IUX A;  5KWF A;  1Y56 B;  4GR1 A;  3NYE A;  4FK1 A;  1CF3 A;  2CVJ A;  3D8X A;  2GH5 A;  2YLZ A;  2VRL A;  1TDN A;  4GUV A;  2FJB A;  3NIX A;  1H7W A;  1LVL A;  4Z24 A;  3AEE A;  3P4P A;  2C64 A;  1ZDL A;  1E6E A;  4WX1 A;  3UTG A;  4C5O A;  1GRG A;  4YTN A;  2R4E A;  1JOA A;  1ZOY A;  2YVJ A;  1NEN A;  1GSN A;  1O95 A;  1ZX9 A;  2E1M A;  1W4X A;  1E7P A;  2BCG G;  2BK3 A;  4YT0 A;  3AE3 A;  3GDN A;  3KPF A;  4WCT A;  2XCG A;  3C4A A;  3DK4 A;  4C3X A;  3AYI A;  3CND A;  1IUU A;  5HY5 A;  1GXF A;  3SQP A;  1FL2 A;  1DOE A;  2WP6 A;  3GMB A;  3ICT A;  2B9X A;  3LZW A;  4HB9 A;  4U8K A;  1M6I A;  3T37 A;  2GAG B;  3O0H A;  3PO7 A;  1D4C A;  3QSM A;  5KVI A;  4U2T A;  1XDI A;  4BK3 A;  2OLN A;  1CBO A;  2YVG A;  4EQW A;  5U63 A;  1BWC A;  2B9Y A;  5CKU A;  1Y56 A;  2XFN A;  2BXR A;  1YKJ A;  4OPU A;  2YLR A;  1JRY A;  1LQT A;  3G5Q A;  2XFP A;  4GDE A;  5JCN A;  1DJQ A;  4X9M A;  4B63 A;  1D7Y A;  1QO8 A;  2YLS A;  1FEC A;  3BNU A;  1KSU A;  2H88 A;  2WDQ A;  4GF7 A;  1OJT A;  4LU6 A;  4OPC A;  1KF6 A;  2H89 A;  3EF6 A;  1EL8 A;  4Y4L A;  4B67 A;  3NHO X;  4AT2 A;  4DSH A;  4H4Y A;  3M13 A;  2YLT A;  1H82 A;  4P9S A;  4U8O A;  2EQ7 A;  1GTH A;  1SEZ A;  4B64 A;  5BUK A;  2E5V A;  4H4P A;  2DKH A;  4EM4 A;  1UKV G;  3KD9 A;  1ZOV A;  3NK0 X;  5FS8 A;  4O5U A;  3ZDN A;  4APN A;  3NK2 X;  1PDH A;  1H84 A;  1ZY8 A;  2WBA A;  2FJE A;  3KVE A;  3LZX A;  4Z2T A;  2JB3 A;  5GRT A;  3LXD A;  3DJJ A;  4TM4 A;  2BS4 A;  3R9U A;  1CHU A;  4FK1 C;  1L9E A;  2AAQ A;  3AE8 A;  2Q0K A;  3VRD B;  4GCM A;  2EQ9 A;  4YTP A;  1MXT A;  2YVF A;  3UTF A;  3IHM A;  4IA5 A;  3CPJ G;  3CNS A;  4NEW A;  5FS7 A;  2BS3 A;  3K7Q X;  2GAH B;  5FS6 A;  3UOV A;  5BVA A;  2WEU A;  4OPT A;  1GRH A;  3UKH A;  2XFU A;  1MO9 A;  3F8P A;  4OPG A;  2E4G A;  2GQF A;  3NTD A;  3QSS A;  1PXA A;  1TDO A;  4A7A A;  4M52 A;  2XFO A;  3AE7 A;  1K0I A;  1QLB A;  2OAL A;  2Q0L A;  3DGZ A;  1MOK A;  3DME A;  4EQX A;  2B76 A;  3K7M X;  4YSZ A;  1BKW A;  3GMC A;  1S2Y A;  1YQZ A;  1ZP0 A;  4AP3 A;  1LJ1 A;  2V3A A;  3JSK A;  1COY A;  1F8W A;  2C73 A;  2XFQ A;  2IVE A;  4H2P A;  4BK2 A;  3AED A;  1TYT A;  2OA1 A;  5IPY A;  4XWR A;  3NRN A;  1ONF A;  4Z43 A;  1NG4 A;  2JB1 A;  3ISH A;  3CNP A;  1OJA A;  2R0C A;  2YG4 A;  4OPL A;  4ZCC A;  4EIP A;  2PHH A;  3DJG X;  3AWI A;  1LTX R;  3EPT A;  4H4R A;  5C3J A;  1KDG A;  4D03 A;  2V6O A;  3CGD A;  3NYF A;  2IID A;  1EL9 A;  2Q7V A;  1DJN A;  1IUT A;  3ALM A;  2XDO A;  4NTC A;  4XXG A;  4ZCD A;  2CUL A;  4H2Q A;  2WU2 A;  1IUW A;  3RP7 A;  1NEK A;  3UKF A;  4CCQ A;  1TYP A;  2VQ7 A;  2DKI A;  2X50 A;  4FX9 A;  3VQR A;  2CDU A;  1BF3 A;  1VQW A;  3NG7 X;  4BJY A;  3BNM A;  1PXB A;  3KLJ A;  4NZH A;  2VOU A;  3H8L A;  1H7X A;  2J3N A;  4YKG A;  1S2Q A;  3KKJ A;  3DJE A;  4H4S A;  1Q1W A;  2F5Z A;  4UDP A;  5C2T A;  4JDR A;  2OLO A;  4GRT A;  4Y4M A;  1P2E A;  1K0L A;  4H4Q A;  1ZK7 A;  4B68 A;  5JCL A;  3CGC A;  1TRB A;  4K2X A;  2NVK X;  2W0H A;  4YXD A;  3UOY A;  4YSH A;  3QVP A;  2Y6R A;  2EQ6 A;  1L9D A;  2O9Z A;  1ZKQ A;  1O5W A;  3G5R A;  3L1R A;  1F3P A;  4ECH A;  1QJD A;  2JKC A;  2QAE A;  3AE6 A;  3PS9 A;  5FS9 A;  1GRF A;  3URH A;  4C77 A;  4CRT A;  3NT6 A;  4RSL A;  4A99 A;  4B66 A;  2BS2 A;  3SGL A;  3GD3 A;  3QFA A;  3IHG A;  3NN0 X;  5J60 A;  1TDE A;  2WU5 A;  4IVO B;  4EM3 A;  2WPC A;  2WET A;  3H8I A;  3M0O A;  3K7T A;  3P1W A;  4LA1 A;  3OZ2 A;  2WS3 A;  3LB8 A;  2ZBW A;  1E1K A;  1H81 A;  1KNP A;  3AE9 A;  1L0V A;  2AQJ A;  3CNT A;  2XYO A;  4CY8 A;  4K8D A;  4BJZ A;  4EIQ A;  4JQ9 A;  2JB2 A;  4C3Y A;  1B4V A;  1Y0P A;  3UP5 A;  4Y4N A;  2VVL G;  2BC1 A;  4AOS A;  3P4Q A;  4A6N B;  2C67 A;  4D04 A;  4C74 A;  1PBB A;  2GEW A;  1CC4 A;  2XLU A;  3F8D A;  2YLX A;  1EL5 A;  3ZYX A;  4A65 A;  3NYC A;  1RYI A;  2GR1 A;  4J34 A;  3VRB A;  4YKF A;  4Z2R A;  2WHD A;  1DOB A;  1XAN A;  3AD7 B;  2BA9 A;  3Q9T A;  4H50 A;  3NTA A;  5EBK A;  2YR5 A;  1Q1R A;  5TR3 A;  1GET A;  1RSG A;  1KSS A;  2C76 A;  1F8S A;  2Y6Q A;  2GR0 A;  1S3B A;  4TM1 A;  4YWO A;  4ICY A;  2VVM A;  3UCL A;  4AP1 A;  1FEA A;  5M10 A;  5FMH A;  3FMW A;  2ZZB A;  1F6M A;  3ADA B;  2YAU A;  4B65 A;  1E1L A;  4UDQ A;  2C66 A;  1AOG A;  1H6V A;  1NG3 A;  3AD8 B;  2BK4 A;  2CFY A;  1VG9 A;  2UZZ A;  4H7U A;  3QSE A;  2YG6 A;  1OJC A;  2WQY A;  4OPI A;  3NK1 X;  2GQW A;  2YR6 A;  4A79 A;  1H86 A;  3E1T A;  3ICR A;  5U1O A;  1IJH A;  3B3R A;  4CY6 A;  3AE2 A;  1PN0 A;  3ATQ A;  5J7X A;  4CBQ A;  4A6N A;  1K0J A;  3S5W A;  1GV4 A;  2WES A;  2YR4 A;  1BGN A;  2YM2 A;  2BXS A;  5HHF A;  1GOS A;  2RGO A;  3OC4 A;  1PS9 A;  1Z6L A;  4YSY A;  3EAO A;  2TMD A;  5CQF A;  2B7R A;  3HZL A;  3Q6J A;  1PJ5 A;  4PAA A;  1ZMC A;  4KPR A;  2XLS A;  1KFY A;  3AEF A;  3S61 A;  4ADW A;  3DK8 A;  2V60 A;  4K5R A;  2R4J A;  3UKQ A;  1JU2 A;  1GPE A;  1NDA A;  2XLR A;  3NH3 X;  3UOX A;  1NHP A;  4Z2U A;  1S3E A;  1NHR A;  3CTY A;  4J56 A;  3IC9 A;  4U8J A;  1NHQ A;  3FG2 P;  2R0P A;  3UKP A;  4OVI A;  2PYX A;  3P4R A;  4H4Z A;  1PBD A;  1XPQ A;  4H4X A;  1IUS A;  3NKS A;  1GES A;  1YQ4 A;  3FPZ A;  2FJD A;  4RG3 A;  2BYB A;  4J31 A;  5M0Z A;  2WOV A;  2JBV A;  4K7Z A;  4YTM A;  5LV9 A;  1DNC A;  1HYU A;  1D4D A;  4U8P A;  5BRT A;  3C4N A;  2C70 A;  4N9X A;  4EMW A;  3AE4 A;  4U8N A;  1NAA A;  3UTE A;  3LJP A;  2A87 A;  3GYI A;  2GMJ A;  1LV0 A;  1L9C A;  1EL7 A;  4Z25 A;  2FBW A;  3EAN A;  1ELI A;  3P9U A;  2IVD A;  4A5L A;  3M12 A;  1CJC A;  4J2W A;  4BUR A;  4H4U A;  2B7S A;  4DSG A;  1YY5 A;  1Q9I A;  2YG7 A;  2ZZ0 A;  3AXB A;  5ER0 A;  1H83 A;  5KVH A;  2BK5 A;  1PBC A;  3PVC A;  3II4 A;  1JRX A;  3UP4 A;  2RAB A;  4UP3 A;  3I6D A;  4IVM B;  3BI4 A;  4OPD A;  1E39 A;  3BI5 A;  4J33 A;  4B69 A;  3CPH G;  4BK1 A;  2AR8 A;  2YG3 A;  5EB4 A;  2GR2 A;  3GRS A;  1REO A;  5IQ4 A;  2EQ8 A;  4DGK A;  1PBE A;  3QVR A;  4H2N A;  3H4K A;  4X4J A;  5IQ1 A;  2XVE A;  3AYL A;  4CCR A;  2XVF A;  1BZL A;  1FOH A;  1CJ2 A;  5EB5 A;  4JY2 A;  3AYJ A;  1V59 A;  1CC6 A;  3DK9 A;  4U8I A;  1BGJ A;  2WOW A;  1CC2 A;  1IUV A;  2QA2 A;  4NTD A;  3V76 A;  3GD4 A;  2X8C A;  1GRA A;  4REK A;  4NEV A;  2GV8 A;  2YWL A;  2XVJ A;  2VZ2 A;  3GRT A;  3SFD A;  3VRA A;  4U2S A;  1JRZ A;  4EMJ A;  4UDR A; 
#chains in the Genus database with same CATH topology
 1GEU A;  5KXJ A;  3NNE A;  2X8H A;  3CIR A;  2GMH A;  2XVH A;  2C72 A;  4H2R A;  2JK6 A;  3IF9 A;  2C75 A;  2XLP A;  4JNQ A;  4RG4 A;  5U25 A;  3ICS A;  4AT0 A;  1E1M A;  1EBD A;  2BC0 A;  1CJ3 A;  5KOW A;  2B9W A;  2GR3 A;  1JEH A;  1GER A;  2FJA A;  4H4V A;  2I0Z A;  4I59 A;  4NTE A;  2WOI A;  3BI2 A;  3FBS A;  1FEB A;  4J57 A;  1B5Q A;  1GT8 A;  4K5S A;  3CNJ A;  2QA1 A;  4YSX A;  5HYM A;  1LQU A;  3HYX A;  3D1C A;  2GRT A;  4CNJ A;  1N4U A;  1N1P A;  2WDV A;  2C7G A;  4JNA A;  4EQS A;  2R9Z A;  3BHF A;  1JNZ A;  2RGH A;  3UTH A;  3NN6 X;  3AE1 A;  5KMQ A;  5BUL A;  4IA6 A;  1VRQ B;  1K4Q A;  2RGJ A;  2X3N A;  1D4E A;  3AEC A;  3T0K A;  3UKL A;  3ALL A;  1NHS A;  2BRY A;  2YM1 A;  3K30 A;  3F8R A;  5HXI A;  3AEB A;  4TLZ A;  2TPR A;  1PXC A;  3GWF A;  3SY4 A;  5JCI A;  1B37 A;  4PAB A;  4CNK A;  1LPF A;  1PJ6 A;  2WP5 A;  2BCP A;  3ATR A;  5EOW A;  4K22 A;  2YG5 A;  4O5Q A;  1PJ7 A;  3NLC A;  2R46 A;  4EMI A;  4KX6 A;  2V3B A;  3L8K A;  1N4W A;  1CL0 A;  3CGE A;  1JNR A;  2NPX A;  2V5Z A;  4JN9 A;  1GRB A;  3LAD A;  4J36 A;  3UOZ A;  5KOX A;  1DXL A;  1GND A;  2Z5X A;  1PHH A;  4TM3 A;  2R45 A;  3DJD A;  3V3N A;  1CJ4 A;  1KNR A;  4XWZ A;  3VR9 A;  3AE5 A;  2GF3 A;  4OCG A;  3LOV A;  4I58 A;  5JCM A;  3C96 A;  3SFE A;  1O94 A;  4U2L A;  5GSN A;  2A8X A;  1DOC A;  1DOD A;  2Z5Y A;  4USR A;  2XLT A;  2VQB A;  2ACZ A;  2WP9 A;  4USQ A;  2WDR A;  1GRT A;  1OJD A;  2V61 A;  4GDP A;  5DBJ A;  2A89 A;  2GB0 A;  4H4W A;  2ARD A;  1XHC A;  1GAL A;  3UKK A;  2VVL A;  3AEG A;  3AEA A;  4BV6 A;  1GRE A;  4G73 A;  3GSI A;  1E1N A;  1M64 A;  3QFB A;  1ZMD A;  3WE0 A;  1B8S A;  3RP6 A;  3RP8 A;  4AOX A;  1NPX A;  3HYW A;  3P4S A;  3QJ4 A;  4H4T A;  4A9W A;  1OJ9 A;  2VRM A;  3KA7 A;  3RHA A;  2YLW A;  1FCD A;  1VDC A;  1X31 B;  3CN8 A;  3VR8 A;  4Z26 A;  4IV9 A;  3UKA A;  2JAE A;  2WPE A;  3FIM B;  3I3L A;  4MJW A;  4FDC B;  1D7L A;  2X99 A;  3DH9 A;  3ITJ A;  2BAC A;  3CGB A;  3ALJ A;  1N4V A;  3GYJ A;  3G5S A;  4Z44 A;  2OAM A;  4EQR A;  4HA6 A;  2C3D A;  2YQU A;  5L46 A;  3T2Y A;  3IWA A;  2ZZC A;  1TDF A;  3DA1 A;  4DNA A;  5JCK A;  4TLX A;  1YQ3 A;  1VG0 A;  3B6D A;  3SM8 A;  2C4C A;  1F8R A;  3BHK A;  4X9N A;  4U8L A;  2X8G A;  2HQM A;  3RED A;  2Q6U A;  2XVI A;  3GDP A;  1P2H A;  3DGH A;  2WPF A;  2BAB A;  2C3C A;  2C65 A;  1GTE A;  1RP0 A;  3T14 A;  3RNM A;  3ABV A;  4LII A;  5KRQ A;  4GAV A;  2R0G A;  4E0V A;  1D5T A;  3V3O A;  3NGC X;  3CPI G;  4B1B A;  3KU9 A;  3COX A;  2QCU A;  3AD9 B;  1TDK A;  4TM0 A;  1PBF A;  3GWD A;  4ZN0 A;  2APG A;  2GVC A;  3AB1 A;  4JY3 A;  4U8M A;  1IUX A;  5KWF A;  1Y56 B;  4GR1 A;  3NYE A;  4FK1 A;  1CF3 A;  2CVJ A;  3D8X A;  2GH5 A;  2YLZ A;  2VRL A;  1TDN A;  4GUV A;  2FJB A;  3NIX A;  1H7W A;  1LVL A;  4Z24 A;  3AEE A;  3P4P A;  2C64 A;  1ZDL A;  1E6E A;  4WX1 A;  3UTG A;  4C5O A;  1GRG A;  4YTN A;  2R4E A;  1JOA A;  1ZOY A;  2YVJ A;  1NEN A;  1GSN A;  1O95 A;  1ZX9 A;  2E1M A;  3SZW A;  1W4X A;  1E7P A;  2BCG G;  2BK3 A;  4YT0 A;  3GDN A;  3AE3 A;  3KPF A;  4WCT A;  2XCG A;  3C4A A;  3DK4 A;  4C3X A;  3AYI A;  3CND A;  1IUU A;  5HY5 A;  1GXF A;  3SQP A;  1FL2 A;  1DOE A;  2WP6 A;  3GMB A;  3ICT A;  2B9X A;  3LZW A;  4HB9 A;  4U8K A;  1M6I A;  3T37 A;  2GAG B;  3O0H A;  3PO7 A;  1D4C A;  3QSM A;  5KVI A;  4U2T A;  1XDI A;  4BK3 A;  2OLN A;  5KMR A;  1CBO A;  2YVG A;  4EQW A;  5U63 A;  1BWC A;  2B9Y A;  5CKU A;  1Y56 A;  2XFN A;  2BXR A;  1YKJ A;  4OPU A;  2YLR A;  1JRY A;  1LQT A;  3G5Q A;  2XFP A;  4GDE A;  5JCN A;  1DJQ A;  4X9M A;  4B63 A;  1D7Y A;  1QO8 A;  2YLS A;  1FEC A;  3BNU A;  1KSU A;  2H88 A;  2WDQ A;  4GF7 A;  1OJT A;  4LU6 A;  4OPC A;  1KF6 A;  2H89 A;  3T31 A;  3EF6 A;  1EL8 A;  4Y4L A;  4B67 A;  3NHO X;  4AT2 A;  4DSH A;  4H4Y A;  3M13 A;  2YLT A;  1H82 A;  4P9S A;  4U8O A;  2EQ7 A;  1GTH A;  1SEZ A;  4B64 A;  5BUK A;  2E5V A;  4H4P A;  3SYI A;  2DKH A;  4EM4 A;  1UKV G;  3KD9 A;  1ZOV A;  3NK0 X;  5FS8 A;  4O5U A;  3ZDN A;  4APN A;  3NK2 X;  1PDH A;  1H84 A;  1ZY8 A;  2WBA A;  2FJE A;  3KVE A;  3LZX A;  4Z2T A;  5KNL A;  2JB3 A;  5GRT A;  3LXD A;  3DJJ A;  4TM4 A;  2BS4 A;  3R9U A;  1CHU A;  4FK1 C;  1L9E A;  2AAQ A;  3AE8 A;  2Q0K A;  3VRD B;  4GCM A;  2EQ9 A;  4YTP A;  4G6G A;  1MXT A;  2YVF A;  3UTF A;  3IHM A;  4IA5 A;  3CPJ G;  3CNS A;  4NEW A;  5FS7 A;  2BS3 A;  3K7Q X;  2GAH B;  5FS6 A;  3UOV A;  5BVA A;  2WEU A;  4OPT A;  1GRH A;  3UKH A;  2XFU A;  1MO9 A;  3F8P A;  4OPG A;  2E4G A;  2GQF A;  3NTD A;  3QSS A;  1PXA A;  1TDO A;  4A7A A;  4M52 A;  2XFO A;  3AE7 A;  1K0I A;  1QLB A;  2OAL A;  3SZF A;  2Q0L A;  3DGZ A;  1MOK A;  3DME A;  4G6H A;  4EQX A;  2B76 A;  3K7M X;  4YSZ A;  1BKW A;  3GMC A;  1S2Y A;  1YQZ A;  1ZP0 A;  4AP3 A;  1LJ1 A;  2V3A A;  3JSK A;  1COY A;  1F8W A;  2C73 A;  2XFQ A;  2IVE A;  4H2P A;  4BK2 A;  3AED A;  1TYT A;  2OA1 A;  5IPY A;  4XWR A;  3NRN A;  3T2Z A;  1ONF A;  4Z43 A;  1NG4 A;  2JB1 A;  3ISH A;  3CNP A;  1OJA A;  2R0C A;  2YG4 A;  4OPL A;  4ZCC A;  4EIP A;  2PHH A;  3DJG X;  3AWI A;  1LTX R;  3EPT A;  4H4R A;  2BRA A;  5C3J A;  1KDG A;  4D03 A;  2V6O A;  3CGD A;  3NYF A;  2IID A;  1EL9 A;  2Q7V A;  1DJN A;  1IUT A;  3ALM A;  2XDO A;  4NTC A;  4XXG A;  4ZCD A;  2CUL A;  4H2Q A;  2WU2 A;  1IUW A;  3RP7 A;  1NEK A;  3UKF A;  4CCQ A;  1TYP A;  2VQ7 A;  2DKI A;  2X50 A;  4FX9 A;  3VQR A;  2CDU A;  1BF3 A;  1VQW A;  3NG7 X;  4BJY A;  3BNM A;  1PXB A;  3KLJ A;  4NZH A;  2VOU A;  3H8L A;  1H7X A;  2J3N A;  4YKG A;  1S2Q A;  3KKJ A;  3DJE A;  4H4S A;  1Q1W A;  4UDP A;  2F5Z A;  5C2T A;  4JDR A;  2OLO A;  4GRT A;  4Y4M A;  1P2E A;  1K0L A;  4H4Q A;  1ZK7 A;  4B68 A;  5JCL A;  3GYX A;  3CGC A;  1TRB A;  4K2X A;  2NVK X;  2W0H A;  4YXD A;  3UOY A;  4YSH A;  3QVP A;  2Y6R A;  2EQ6 A;  1L9D A;  2O9Z A;  1ZKQ A;  1O5W A;  3G5R A;  3L1R A;  1F3P A;  4ECH A;  1QJD A;  2JKC A;  4G9K A;  2QAE A;  3AE6 A;  3PS9 A;  5FS9 A;  1GRF A;  3URH A;  4C77 A;  4CRT A;  3NT6 A;  4RSL A;  4A99 A;  4B66 A;  2BS2 A;  3SGL A;  3SZC A;  3GD3 A;  3QFA A;  3IHG A;  3NN0 X;  5J60 A;  1TDE A;  2WU5 A;  4IVO B;  4EM3 A;  2WPC A;  2WET A;  3H8I A;  3M0O A;  3K7T A;  3P1W A;  4LA1 A;  3OZ2 A;  2WS3 A;  3LB8 A;  2ZBW A;  1E1K A;  3SXI A;  1H81 A;  1KNP A;  3AE9 A;  1L0V A;  2AQJ A;  3CNT A;  2XYO A;  4CY8 A;  4K8D A;  4BJZ A;  4EIQ A;  4JQ9 A;  2JB2 A;  4C3Y A;  1B4V A;  1Y0P A;  3UP5 A;  4Y4N A;  2VVL G;  2BC1 A;  4AOS A;  3P4Q A;  5KMS A;  4A6N B;  2C67 A;  4D04 A;  4C74 A;  1PBB A;  4GAP A;  2GEW A;  1CC4 A;  2XLU A;  3F8D A;  2YLX A;  1EL5 A;  3KPK A;  3ZYX A;  4A65 A;  3NYC A;  1RYI A;  2GR1 A;  4J34 A;  3VRB A;  4YKF A;  4Z2R A;  2WHD A;  1DOB A;  1XAN A;  3AD7 B;  2BA9 A;  3Q9T A;  4H50 A;  3NTA A;  5EBK A;  2YR5 A;  4II2 A;  1Q1R A;  5TR3 A;  1GET A;  1RSG A;  1KSS A;  2C76 A;  1F8S A;  2Y6Q A;  2GR0 A;  1S3B A;  4TM1 A;  4YWO A;  4ICY A;  2VVM A;  3UCL A;  4AP1 A;  1FEA A;  5M10 A;  5FMH A;  3FMW A;  2ZZB A;  4NNJ A;  1F6M A;  3ADA B;  2YAU A;  4B65 A;  1E1L A;  4UDQ A;  2C66 A;  1AOG A;  1H6V A;  1NG3 A;  3AD8 B;  2BK4 A;  2CFY A;  1VG9 A;  2UZZ A;  4H7U A;  3QSE A;  2YG6 A;  1OJC A;  2WQY A;  4OPI A;  3NK1 X;  2GQW A;  2YR6 A;  4A79 A;  1H86 A;  3E1T A;  3ICR A;  5U1O A;  1IJH A;  3B3R A;  4CY6 A;  3AE2 A;  1PN0 A;  3ATQ A;  5J7X A;  4CBQ A;  4A6N A;  1K0J A;  3S5W A;  1GV4 A;  2WES A;  2YR4 A;  1BGN A;  2YM2 A;  2BXS A;  5HHF A;  1GOS A;  2RGO A;  3OC4 A;  1PS9 A;  1Z6L A;  3SX6 A;  4YSY A;  3EAO A;  2TMD A;  5CQF A;  2B7R A;  3HZL A;  3Q6J A;  1PJ5 A;  4PAA A;  1ZMC A;  4KPR A;  2XLS A;  1KFY A;  3AEF A;  3S61 A;  4ADW A;  5KMP A;  3DK8 A;  2V60 A;  4K5R A;  2R4J A;  3UKQ A;  1JU2 A;  1GPE A;  1NDA A;  2XLR A;  3NH3 X;  3UOX A;  1NHP A;  4Z2U A;  1S3E A;  1NHR A;  3CTY A;  4J56 A;  3IC9 A;  4U8J A;  1NHQ A;  3FG2 P;  2R0P A;  3UKP A;  4OVI A;  2PYX A;  3P4R A;  4H4Z A;  1PBD A;  1XPQ A;  4H4X A;  1IUS A;  3NKS A;  1GES A;  1YQ4 A;  3FPZ A;  2FJD A;  4RG3 A;  2BYB A;  4J31 A;  5M0Z A;  2WOV A;  2JBV A;  4K7Z A;  4YTM A;  5LV9 A;  1DNC A;  1HYU A;  1D4D A;  4U8P A;  5BRT A;  3C4N A;  2C70 A;  3HYV A;  4N9X A;  3SZ0 A;  3AE4 A;  4U8N A;  1NAA A;  4EMW A;  3UTE A;  3LJP A;  2A87 A;  4NWZ A;  3GYI A;  2GMJ A;  1LV0 A;  1L9C A;  1EL7 A;  4Z25 A;  2FBW A;  3EAN A;  1ELI A;  3P9U A;  2IVD A;  4A5L A;  3M12 A;  1CJC A;  4J2W A;  4BUR A;  4H4U A;  2B7S A;  4DSG A;  1YY5 A;  1Q9I A;  2YG7 A;  2ZZ0 A;  3AXB A;  5ER0 A;  1H83 A;  4II3 A;  4G74 A;  5KVH A;  2BK5 A;  1PBC A;  3PVC A;  3II4 A;  1JRX A;  3UP4 A;  2RAB A;  4UP3 A;  3I6D A;  4IVM B;  3BI4 A;  4OPD A;  1E39 A;  3BI5 A;  4J33 A;  4B69 A;  3CPH G;  4BK1 A;  2AR8 A;  3CMM A;  5EB4 A;  2YG3 A;  2GR2 A;  3GRS A;  1REO A;  5IQ4 A;  2EQ8 A;  4DGK A;  1PBE A;  3QVR A;  4H2N A;  3T2K A;  3H4K A;  4X4J A;  5IQ1 A;  2XVE A;  3AYL A;  4CCR A;  2XVF A;  1BZL A;  1FOH A;  1CJ2 A;  5EB5 A;  4JY2 A;  3AYJ A;  1V59 A;  1CC6 A;  3DK9 A;  4U8I A;  1BGJ A;  2WOW A;  1CC2 A;  1IUV A;  2QA2 A;  4NTD A;  3V76 A;  3GD4 A;  2X8C A;  1GRA A;  4REK A;  4NEV A;  2GV8 A;  2YWL A;  2XVJ A;  2VZ2 A;  3GRT A;  3SFD A;  3VRA A;  4U2S A;  1JRZ A;  4EMJ A;  4UDR A; 
#chains in the Genus database with same CATH homology
 1GEU A;  5KXJ A;  3NNE A;  2X8H A;  3CIR A;  2GMH A;  2XVH A;  2C72 A;  4H2R A;  2JK6 A;  3IF9 A;  2C75 A;  2XLP A;  4JNQ A;  4RG4 A;  5U25 A;  3ICS A;  4AT0 A;  1E1M A;  1EBD A;  2BC0 A;  1CJ3 A;  5KOW A;  2B9W A;  2GR3 A;  1JEH A;  1GER A;  2FJA A;  4H4V A;  2I0Z A;  4I59 A;  4NTE A;  2WOI A;  3BI2 A;  3FBS A;  1FEB A;  4J57 A;  1B5Q A;  1GT8 A;  4K5S A;  3CNJ A;  2QA1 A;  4YSX A;  5HYM A;  1LQU A;  3HYX A;  3D1C A;  2GRT A;  4CNJ A;  1N4U A;  1N1P A;  2WDV A;  2C7G A;  4JNA A;  4EQS A;  2R9Z A;  3BHF A;  1JNZ A;  2RGH A;  3UTH A;  3NN6 X;  3AE1 A;  5KMQ A;  5BUL A;  4IA6 A;  1VRQ B;  1K4Q A;  2RGJ A;  2X3N A;  1D4E A;  3AEC A;  3T0K A;  3UKL A;  3ALL A;  1NHS A;  2BRY A;  2YM1 A;  3K30 A;  3F8R A;  5HXI A;  3AEB A;  4TLZ A;  2TPR A;  1PXC A;  3GWF A;  3SY4 A;  5JCI A;  1B37 A;  4PAB A;  4CNK A;  1LPF A;  1PJ6 A;  2WP5 A;  2BCP A;  3ATR A;  5EOW A;  4K22 A;  2YG5 A;  4O5Q A;  1PJ7 A;  3NLC A;  2R46 A;  4EMI A;  4KX6 A;  2V3B A;  3L8K A;  1N4W A;  1CL0 A;  3CGE A;  1JNR A;  2NPX A;  2V5Z A;  4JN9 A;  1GRB A;  3LAD A;  4J36 A;  3UOZ A;  5KOX A;  1DXL A;  1GND A;  2Z5X A;  1PHH A;  4TM3 A;  2R45 A;  3DJD A;  3V3N A;  1CJ4 A;  1KNR A;  4XWZ A;  3VR9 A;  3AE5 A;  2GF3 A;  4OCG A;  3LOV A;  4I58 A;  5JCM A;  3C96 A;  3SFE A;  1O94 A;  4U2L A;  5GSN A;  2A8X A;  1DOC A;  1DOD A;  2Z5Y A;  4USR A;  2XLT A;  2VQB A;  2ACZ A;  2WP9 A;  4USQ A;  2WDR A;  1GRT A;  1OJD A;  2V61 A;  4GDP A;  5DBJ A;  2A89 A;  2GB0 A;  4H4W A;  2ARD A;  1XHC A;  1GAL A;  3UKK A;  2VVL A;  3AEG A;  3AEA A;  4BV6 A;  1GRE A;  4G73 A;  3GSI A;  1E1N A;  1M64 A;  3QFB A;  1ZMD A;  3WE0 A;  1B8S A;  3RP6 A;  3RP8 A;  4AOX A;  1NPX A;  3HYW A;  3P4S A;  3QJ4 A;  4H4T A;  4A9W A;  1OJ9 A;  2VRM A;  3KA7 A;  3RHA A;  2YLW A;  1FCD A;  1VDC A;  1X31 B;  3CN8 A;  3VR8 A;  4Z26 A;  4IV9 A;  3UKA A;  2JAE A;  2WPE A;  3FIM B;  3I3L A;  4MJW A;  4FDC B;  1D7L A;  2X99 A;  3DH9 A;  3ITJ A;  2BAC A;  3CGB A;  3ALJ A;  1N4V A;  3GYJ A;  3G5S A;  4Z44 A;  2OAM A;  4EQR A;  4HA6 A;  2C3D A;  2YQU A;  5L46 A;  3T2Y A;  3IWA A;  2ZZC A;  1TDF A;  3DA1 A;  4DNA A;  5JCK A;  4TLX A;  1YQ3 A;  1VG0 A;  3B6D A;  3SM8 A;  2C4C A;  1F8R A;  3BHK A;  4X9N A;  4U8L A;  2X8G A;  2HQM A;  3RED A;  2Q6U A;  2XVI A;  3GDP A;  1P2H A;  3DGH A;  2WPF A;  2BAB A;  2C3C A;  2C65 A;  1GTE A;  1RP0 A;  3T14 A;  3RNM A;  3ABV A;  4LII A;  5KRQ A;  4GAV A;  2R0G A;  4E0V A;  1D5T A;  3V3O A;  3NGC X;  3CPI G;  4B1B A;  3KU9 A;  3COX A;  2QCU A;  3AD9 B;  1TDK A;  4TM0 A;  1PBF A;  3GWD A;  4ZN0 A;  2APG A;  2GVC A;  3AB1 A;  4JY3 A;  4U8M A;  1IUX A;  5KWF A;  1Y56 B;  4GR1 A;  3NYE A;  4FK1 A;  1CF3 A;  2CVJ A;  3D8X A;  2GH5 A;  2YLZ A;  2VRL A;  1TDN A;  4GUV A;  2FJB A;  3NIX A;  1H7W A;  1LVL A;  4Z24 A;  3AEE A;  3P4P A;  2C64 A;  1ZDL A;  1E6E A;  4WX1 A;  3UTG A;  4C5O A;  1GRG A;  4YTN A;  2R4E A;  1JOA A;  1ZOY A;  2YVJ A;  1NEN A;  1GSN A;  1O95 A;  1ZX9 A;  2E1M A;  3SZW A;  1W4X A;  1E7P A;  2BCG G;  2BK3 A;  4YT0 A;  3GDN A;  3AE3 A;  3KPF A;  4WCT A;  2XCG A;  3C4A A;  3DK4 A;  4C3X A;  3AYI A;  3CND A;  1IUU A;  5HY5 A;  1GXF A;  3SQP A;  1FL2 A;  1DOE A;  2WP6 A;  3GMB A;  3ICT A;  2B9X A;  3LZW A;  4HB9 A;  4U8K A;  1M6I A;  3T37 A;  2GAG B;  3O0H A;  3PO7 A;  1D4C A;  3QSM A;  5KVI A;  4U2T A;  1XDI A;  4BK3 A;  2OLN A;  5KMR A;  1CBO A;  2YVG A;  4EQW A;  5U63 A;  1BWC A;  2B9Y A;  5CKU A;  1Y56 A;  2XFN A;  2BXR A;  1YKJ A;  4OPU A;  2YLR A;  1JRY A;  1LQT A;  3G5Q A;  2XFP A;  4GDE A;  5JCN A;  1DJQ A;  4X9M A;  4B63 A;  1D7Y A;  1QO8 A;  2YLS A;  1FEC A;  3BNU A;  1KSU A;  2H88 A;  2WDQ A;  4GF7 A;  1OJT A;  4LU6 A;  4OPC A;  1KF6 A;  2H89 A;  3T31 A;  3EF6 A;  1EL8 A;  4Y4L A;  4B67 A;  3NHO X;  4AT2 A;  4DSH A;  4H4Y A;  3M13 A;  2YLT A;  1H82 A;  4P9S A;  4U8O A;  2EQ7 A;  1GTH A;  1SEZ A;  4B64 A;  5BUK A;  2E5V A;  4H4P A;  3SYI A;  2DKH A;  4EM4 A;  1UKV G;  3KD9 A;  1ZOV A;  3NK0 X;  5FS8 A;  4O5U A;  3ZDN A;  4APN A;  3NK2 X;  1PDH A;  1H84 A;  1ZY8 A;  2WBA A;  2FJE A;  3KVE A;  3LZX A;  4Z2T A;  5KNL A;  2JB3 A;  5GRT A;  3LXD A;  3DJJ A;  4TM4 A;  2BS4 A;  3R9U A;  1CHU A;  4FK1 C;  1L9E A;  2AAQ A;  3AE8 A;  2Q0K A;  3VRD B;  4GCM A;  2EQ9 A;  4YTP A;  4G6G A;  1MXT A;  2YVF A;  3UTF A;  3IHM A;  4IA5 A;  3CPJ G;  3CNS A;  4NEW A;  5FS7 A;  2BS3 A;  3K7Q X;  2GAH B;  5FS6 A;  3UOV A;  5BVA A;  2WEU A;  4OPT A;  1GRH A;  3UKH A;  2XFU A;  1MO9 A;  3F8P A;  4OPG A;  2E4G A;  2GQF A;  3NTD A;  3QSS A;  1PXA A;  1TDO A;  4A7A A;  4M52 A;  2XFO A;  3AE7 A;  1K0I A;  1QLB A;  2OAL A;  3SZF A;  2Q0L A;  3DGZ A;  1MOK A;  3DME A;  4G6H A;  4EQX A;  2B76 A;  3K7M X;  4YSZ A;  1BKW A;  3GMC A;  1S2Y A;  1YQZ A;  1ZP0 A;  4AP3 A;  1LJ1 A;  2V3A A;  3JSK A;  1COY A;  1F8W A;  2C73 A;  2XFQ A;  2IVE A;  4H2P A;  4BK2 A;  3AED A;  1TYT A;  2OA1 A;  5IPY A;  4XWR A;  3NRN A;  3T2Z A;  1ONF A;  4Z43 A;  1NG4 A;  2JB1 A;  3ISH A;  3CNP A;  1OJA A;  2R0C A;  2YG4 A;  4OPL A;  4ZCC A;  4EIP A;  2PHH A;  3DJG X;  3AWI A;  1LTX R;  3EPT A;  4H4R A;  2BRA A;  5C3J A;  1KDG A;  4D03 A;  2V6O A;  3CGD A;  3NYF A;  2IID A;  1EL9 A;  2Q7V A;  1DJN A;  1IUT A;  3ALM A;  2XDO A;  4NTC A;  4XXG A;  4ZCD A;  2CUL A;  4H2Q A;  2WU2 A;  1IUW A;  3RP7 A;  1NEK A;  3UKF A;  4CCQ A;  1TYP A;  2VQ7 A;  2DKI A;  2X50 A;  4FX9 A;  3VQR A;  2CDU A;  1BF3 A;  1VQW A;  3NG7 X;  4BJY A;  3BNM A;  1PXB A;  3KLJ A;  4NZH A;  2VOU A;  3H8L A;  1H7X A;  2J3N A;  4YKG A;  1S2Q A;  3KKJ A;  3DJE A;  4H4S A;  1Q1W A;  4UDP A;  2F5Z A;  5C2T A;  4JDR A;  2OLO A;  4GRT A;  4Y4M A;  1P2E A;  1K0L A;  4H4Q A;  1ZK7 A;  4B68 A;  5JCL A;  3GYX A;  3CGC A;  1TRB A;  4K2X A;  2NVK X;  2W0H A;  4YXD A;  3UOY A;  4YSH A;  3QVP A;  2Y6R A;  2EQ6 A;  1L9D A;  2O9Z A;  1ZKQ A;  1O5W A;  3G5R A;  3L1R A;  1F3P A;  4ECH A;  1QJD A;  2JKC A;  4G9K A;  2QAE A;  3AE6 A;  3PS9 A;  5FS9 A;  1GRF A;  3URH A;  4C77 A;  4CRT A;  3NT6 A;  4RSL A;  4A99 A;  4B66 A;  2BS2 A;  3SGL A;  3SZC A;  3GD3 A;  3QFA A;  3IHG A;  3NN0 X;  5J60 A;  1TDE A;  2WU5 A;  4IVO B;  4EM3 A;  2WPC A;  2WET A;  3H8I A;  3M0O A;  3K7T A;  3P1W A;  4LA1 A;  3OZ2 A;  2WS3 A;  3LB8 A;  2ZBW A;  1E1K A;  3SXI A;  1H81 A;  1KNP A;  3AE9 A;  1L0V A;  2AQJ A;  3CNT A;  2XYO A;  4CY8 A;  4K8D A;  4BJZ A;  4EIQ A;  4JQ9 A;  2JB2 A;  4C3Y A;  1B4V A;  1Y0P A;  3UP5 A;  4Y4N A;  2VVL G;  2BC1 A;  4AOS A;  3P4Q A;  5KMS A;  4A6N B;  2C67 A;  4D04 A;  4C74 A;  1PBB A;  4GAP A;  2GEW A;  1CC4 A;  2XLU A;  3F8D A;  2YLX A;  1EL5 A;  3KPK A;  3ZYX A;  4A65 A;  3NYC A;  1RYI A;  2GR1 A;  4J34 A;  3VRB A;  4YKF A;  4Z2R A;  2WHD A;  1DOB A;  1XAN A;  3AD7 B;  2BA9 A;  3Q9T A;  4H50 A;  3NTA A;  5EBK A;  2YR5 A;  4II2 A;  1Q1R A;  5TR3 A;  1GET A;  1RSG A;  1KSS A;  2C76 A;  1F8S A;  2Y6Q A;  2GR0 A;  1S3B A;  4TM1 A;  4YWO A;  4ICY A;  2VVM A;  3UCL A;  4AP1 A;  1FEA A;  5M10 A;  5FMH A;  3FMW A;  2ZZB A;  4NNJ A;  1F6M A;  3ADA B;  2YAU A;  4B65 A;  1E1L A;  4UDQ A;  2C66 A;  1AOG A;  1H6V A;  1NG3 A;  3AD8 B;  2BK4 A;  2CFY A;  1VG9 A;  2UZZ A;  4H7U A;  3QSE A;  2YG6 A;  1OJC A;  2WQY A;  4OPI A;  3NK1 X;  2GQW A;  2YR6 A;  4A79 A;  1H86 A;  3E1T A;  3ICR A;  5U1O A;  1IJH A;  3B3R A;  4CY6 A;  3AE2 A;  1PN0 A;  3ATQ A;  5J7X A;  4CBQ A;  4A6N A;  1K0J A;  3S5W A;  1GV4 A;  2WES A;  2YR4 A;  1BGN A;  2YM2 A;  2BXS A;  5HHF A;  1GOS A;  2RGO A;  3OC4 A;  1PS9 A;  1Z6L A;  3SX6 A;  4YSY A;  3EAO A;  2TMD A;  5CQF A;  2B7R A;  3HZL A;  3Q6J A;  1PJ5 A;  4PAA A;  1ZMC A;  4KPR A;  2XLS A;  1KFY A;  3AEF A;  3S61 A;  4ADW A;  5KMP A;  3DK8 A;  2V60 A;  4K5R A;  2R4J A;  3UKQ A;  1JU2 A;  1GPE A;  1NDA A;  2XLR A;  3NH3 X;  3UOX A;  1NHP A;  4Z2U A;  1S3E A;  1NHR A;  3CTY A;  4J56 A;  3IC9 A;  4U8J A;  1NHQ A;  3FG2 P;  2R0P A;  3UKP A;  4OVI A;  2PYX A;  3P4R A;  4H4Z A;  1PBD A;  1XPQ A;  4H4X A;  1IUS A;  3NKS A;  1GES A;  1YQ4 A;  3FPZ A;  2FJD A;  4RG3 A;  2BYB A;  4J31 A;  5M0Z A;  2WOV A;  2JBV A;  4K7Z A;  4YTM A;  5LV9 A;  1DNC A;  1HYU A;  1D4D A;  4U8P A;  5BRT A;  3C4N A;  2C70 A;  3HYV A;  4N9X A;  3SZ0 A;  3AE4 A;  4U8N A;  1NAA A;  4EMW A;  3UTE A;  3LJP A;  2A87 A;  4NWZ A;  3GYI A;  2GMJ A;  1LV0 A;  1L9C A;  1EL7 A;  4Z25 A;  2FBW A;  3EAN A;  1ELI A;  3P9U A;  2IVD A;  4A5L A;  3M12 A;  1CJC A;  4J2W A;  4BUR A;  4H4U A;  2B7S A;  4DSG A;  1YY5 A;  1Q9I A;  2YG7 A;  2ZZ0 A;  3AXB A;  5ER0 A;  1H83 A;  4II3 A;  4G74 A;  5KVH A;  2BK5 A;  1PBC A;  3PVC A;  3II4 A;  1JRX A;  3UP4 A;  2RAB A;  4UP3 A;  3I6D A;  4IVM B;  3BI4 A;  4OPD A;  1E39 A;  3BI5 A;  4J33 A;  4B69 A;  3CPH G;  4BK1 A;  2AR8 A;  3CMM A;  5EB4 A;  2YG3 A;  2GR2 A;  3GRS A;  1REO A;  5IQ4 A;  2EQ8 A;  4DGK A;  1PBE A;  3QVR A;  4H2N A;  3T2K A;  3H4K A;  4X4J A;  5IQ1 A;  2XVE A;  3AYL A;  4CCR A;  2XVF A;  1BZL A;  1FOH A;  1CJ2 A;  5EB5 A;  4JY2 A;  3AYJ A;  1V59 A;  1CC6 A;  3DK9 A;  4U8I A;  1BGJ A;  2WOW A;  1CC2 A;  1IUV A;  2QA2 A;  4NTD A;  3V76 A;  3GD4 A;  2X8C A;  1GRA A;  4REK A;  4NEV A;  2GV8 A;  2YWL A;  2XVJ A;  2VZ2 A;  3GRT A;  3SFD A;  3VRA A;  4U2S A;  1JRZ A;  4EMJ A;  4UDR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...