1KDIA

Reduced form of plastocyanin from dryopteris crassirhizoma
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
102
structure length
102
Chain Sequence
b'AKVEVGDEVGNFKFYPDSITVSAGEAVEFTLVGETGHNIVFDIPAGAPGTVASELKAASMDENDLLSEDEPSFKAKVSTPGTYTFYCTPHKSANMKGTLTVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title The structure and unusual pH dependence of plastocyanin from the fern Dryopteris crassirhizoma. The protonation of an active site histidine is hindered by pi-pi interactions.
pubmed doi rcsb
molecule tags Electron transfer
total genus 22
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 1998-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1kdiA00
4GXFA 1JZJA 1NZRA 1RCYA 1ETJA 4UF7C 3S8GB 3CVCA 2B3IA 1E30A 3EH4B 3H56A 4E9SA 1FFTB 2E86A 3FSZA 2BP0A 7PAZA 4QKTA 5I5JA 2IDFA 1AS7A 5B1JC 2UX6A 4HHGA 3TASA 7PCYA 2LLNA 1NINA 1OE3A 1NIBA 3WNJA 5B7FA 4N4YB 4KOCA 1OCOB 2IH8A 3V9CA 4F7KA 3WI9A 5D4IA 3EH5B 2J56A 2GC7C 2GBAA 2GHZA 1CC3A 2QT6A 3PXLA 1BQKA 1GS6X 1PMYA 2UXGA 3FU8A 2PPFA 2W8CA 2BO0A 4DP5X 2IDUA 2QDVA 1BEXA 1ET7A 5AZUA 1JXDA 1BYPA 1AQ8A 2DY2A 3FSWA 2HRHA 4K9JA 1ILSA 2VW4A 1GS8A 3DKHA 1OCZB 2FWLB 2HX9A 1DZ0A 1J5CA 3IN2A 4A2GA 4CSZA 2P80D 2OV0A 2Q5BA 1AOZA 4GP4B 3ASOB 3D12B 1E5YA 3X1BA 1AAJA 2R7EA 1L9OA 3PCYA 2IAAC 3NP3A 1AIZA 4A2FA 4E9QA 2X88A 3S3BB 4DP0X 2XLLA 1NIDA 4BK5C 2FJSA 1N70A 1WA1X 1UATA 3WG7B 1CURA 3PAZA 2TSBA 4YSPA 1PZAA 5I5IA 4Q89A 2VM4A 1NIAA 2YQBA 3AG4B 1XB8A 3FSAA 4A67A 4M4RB 2Y1AA 2J55A 2UXTA 3FT0A 1A4AA 1KBWA 2FQDA 1XB6A 5B7MA 3CVDA 3KW8A 4N8UA 1ZIBA 3NJJA 1W6WA 1SFHA 3NT0A 5ANHA 4E9VA 5B1BB 1MZYA 9PCYA 3UAAA 5A7EA 4HIPA 5B1JA 2IH9A 3X1GA 1AANA 3DIVA 4DPCX 4G7QB 2XWZA 4HHWA 4P5RA 3G5WA 1MG3C 4TXVB 3T6WA 5I6NA 4G70B 2Q9OA 1JVLA 5I6LA 5AFAA 3T9WA 3T6VA 2W88A 1PLAA 2VSKB 4DP9X 4BWUA 4YSAA 1ZDQA 4YSCA 3IE9A 3NP4A 2VN3A 4E9WA 3X1EA 1M57B 1NTDA 2GI0A 2HLEB 1J5DA 1SFDA 5D4HA 1BQ5A 2IWKA 3AG3B 3S3DB 2XUWA 3OD3A 2VM3A 1TU2A 2DWTA 2AVFA 4YSUA 1AZBA 1L9RA 1L9PA 1E5ZA 4ENZA 1T5KA 1JZFA 4GYBA 3TBCA 4QLWA 2XX1A 4E9YA 4KO9A 3ERXA 2XV2A 1URIA 4GP8B 2YAMA 3GDCA 5B7EA 1L9TA 1J9TA 3X1NA 4PCYA 2YXWA 2H3XC 4DP6X 4NAJA 3FS9A 1PNDA 5TK2A 1IC0A 1JZEA 2IDQA 4FA7B 2QDWA 2CALA 1NWOA 4WKXA 3ZBMA 4YSSA 3QQXA 2PP9A 2JKWA 3FQ2A 3QJRB 2XX0A 1SF3A 1E67A 5I6KA 1CYWA 3NSFA 2BWDA 2YAPA 3NSDA 2UXFA 1WS7A 1ZPUA 1JXFA 2EILB 3QJQB 2JFCA 1J9RA 2DV6A 2BZCA 3CDZB 2AANA 2FNWA 2GB2A 3ABMB 5E9NA 3OMNB 1SDDB 2A3TA 2UXVA 4FAAB 1ET5A 3NYKA 1W6LA 3X2QB 1A8ZA 1SF5A 2H47C 3H4HA 1JZHA 5IY5B 2B08A 1AACA 2Y69B 1GS7A 1GY2A 1X9UA 3QJTB 3NJIA 1PF3A 2N0MA 2OCCB 4YSOA 4BXVA 3ZDWA 3AW5A 1MZZA 5F7BA 2OJ1A 3FQ1A 2RACA 1RKRA 2WO2B 2BZ7A 1JZGA 4A2DA 3C75A 5B1KA 3OM3B 4BDVB 1CYXA 2IWEA 2PPDA 6PAZA 4Q8BA 2PLTA 2EINB 3BVDB 8PAZA 1A4BA 1J9SA 1KCBA 2YAEA 4DP2X 1ASPA 3NJGA 1OCRB 1OE1A 3TU6A 1PAZA 1KV7A 1RZQA 3TA4D 2XXGA 4GY4A 1NDTA 1OE2A 2XYBA 1SHWA 1MDAA 4W1TA 5F7AA 1AZCA 4G71B 2PCFA 1NPJA 3UADA 3N2JA 1WS8A 3IN0A 2ZOOA 1QHQA 4HCFA 1RZPA 1BAWA 2PCYA 1MG2C 3SQRA 4AI7A 3NSCA 1XB3A 4G72B 3NJMA 1L9QA 2NRDA 1HAWA 3S8FB 3ABGA 4X4KA 2I7SA 1WAEA 4A2EA 3ZIYA 2YAHA 3UACA 1HFUA 5I5MA 3ABKB 5PAZA 1KYAA 1KCWA 2VSMB 2BWIA 1KBVA 4AKPA 3WKQA 1AZNA 3N55A 1OV8A 1OF0A 3V9EA 2UX7A 4DP4X 1A4CA 1NIFA 1WA2X 3CVBA 2DYSB 3CDZA 2J5WA 5I28A 4AZUA 2ZWNA 3CZUB 2HX8A 6PCYA 1SDDA 5I6MA 2CAKA 2IDTA 1PZCA 1J9QA 2J57A 3HEIB 4DPBX 1GYCA 2AZAA 1IUZA 1AZUA 1KGYE 3AG2B 3EF4A 3FYEB 1AZRA 1GR7A 3UAEA 2WSDA 1TEFA 2XVBA 3OMIB 4A66A 1ASQA 2FTAA 1IBYA 3EH3B 1JERA 2AZUA 4L0PB 1BXUA 4YSDA 1ADWA 1B3IA 2YAFA 1CUOA 1V55B 3AG1B 1BQRA 2PPAA 1KDJA 5B3SB 3ASNB 4KNSA 1PNCA 1SHXA 2FT6A 4HZ1A 4BDVA 2PPEA 1N68A 1V54B 3OMAB 1AR1B 1M56B 3KW7A 4HAKA 4KO5A 5I6OA 1F56A 1DYZA 1PZBA 1EZLA 1E65A 1FA4A 1PLBA 4YL4A 2FT7A 4NB7A 2XU9A 1A3ZA 1GY1A 2HRGA 3NJFA 2QPDB 1PY0A 1JOIA 4JHUA 4DPAX 4E9TA 3FU9A 5PCYA 2YAOA 3PLYA 2EIJB 3SBRA 1OCCB 1NPNA 1ZIAA 5LDUA 3DTUB 1JVOA 2GIMA 3FQYA 3EHBB 3OQRA 4UANA 3FU7B 2BW5A 2BP8B 2EIMB 4AKQA 3WIAA 3L45A 2FT8A 3QPKA 1ZV2A 4E9XA 2H5UA 1I53A 1NWPA 3U25A 2I7OA 3WKPA 4A68A 2HZHA 1L9SA 4PAZA 2XV3A 2FQEA 4YVNA 1W8EA 2XV0A 3IBOA 3IEAA 3SBQA 1AG0A 3AY2A 4W9ZA 1YLBB 4M3HA 4GP5B 5TK4A 1QLEB 4KOBA 2YAQA 2MRYA 5D4JA 4KNUA 1JZIA 2BW4A 3SBPA 3X1FA 1BXVA 1JXGA 4YVUA 2PP8A 2VW7A 4E9RA 1NICA 2AFNA 2I85A 1HAUA 4YSTA 5AKRA 3UGEA 3QJSB 2EIKB 3S3CB 3NJKA 4JHVA 3MBWB 1SNRA 3NJNA 1TKWA 4A2HA 1X9RA 3FPXA 2BP0B 4AX3A 3PAVA 3H4FA 4BXSV 1TEGA 1V10A 4UAHA 2FQGA 3FYIB 4DP1X 1FWXA 1ILUA 3NJLA 3TBBA 1NIEA 4YSQA 5FC9A 4BWTA 5I26A 4BWWA 3PAUA 3FSVA 4AKOA 1BYOA 2P80A 3AZUA 2YXVA 3NSYA 4CSPA 3HB3B 1KDIA 1AS6A 3ZX1A 2WO3B 2GC4C 2XXFA 4G7RB 3T6XA 2HXAA 2FQFA 2VW6A 4DP7X 3QJUB 4HALA 1QNIA 4NERA 4YSEA 4F2FA 3JT2A 1ID2A 3T6ZA 1OOWA 4KNTA 4HCGA 2X87A 5I6PA 1GW0A 3UABA 2VMJA 1SJMA 3JTBA 4KO6A 1XMEB 2ZXWB 5EHFA 4RH4A 4JKNA 1WA0X 1PCSA 3MX0B 2JXMA 3FU7A 2DYRB 4F2EA 2IWFA 2BP8A 3BQVA 4HCIA 1AS8A 4P5SA 4WTQA 3ABLB 2CJ3A 2DWSA 2PP7A 2PPCA 1GSKA 3RYMA 2ZONA 2R7EB 4MFHA 1EHKB 4EF3A 1PLCA 1R1CA 2GSMB 2TSAA 2CUAA 1AG6A 1M9WA 2CBPA 5B1AB 3FPYA 2YARA 3T71A 1BXAA 4ZK8A 2HX7A 4YSRA 1A65A 4G7SB 4DP8X 3WNIA 2IDSA 3CG8A 2CCWA 1IKOP 1ZDSA 4KO7A 1ASOA 3GXUB 2QPEB 3PPSA 2BHFA 3NJHA 3GYRA 3QJVB 1IBZA 1VLXA 1ET8A 2MTAA
chains in the Genus database with same CATH superfamily
4L8BA 4NRZA 1COBA 4G9FB 1X7SA 3DO7A 4LRNH 5JW4N 3GSVA 5EOTA 3AY4C 3OAWA 2VXQL 1DVSA 3GXFA 3C9NB 5B21A 3AAZA 2JELL 2YD7A 1MFEL 4CC4C 3FO2A 2X4QA 4FN0A 4J2QA 4M1CD 4S1QL 4YUEL 5EG6C 1GCFA 1RHHA 1FUNA 1ANUA 1QKZH 4I3RL 5CJOL 5GS3A 4AC2A 2NLJB 1D5MB 5D9SB 3MLRH 4LOVA 4Q4IA 3TBVA 3VTAA 4BK8A 4TTDD 4AH2B 3DOSA 5B7FA 3WTVA 4UMSA 3DC0A 4K3HA 1BZ7B 2GHWB 3QDJB 4PCKA 2F7IA 4Q9RH 4M43L 1VPOH 2PPFA 2W8CA 2W94A 4RIRB 2QDVA 1OCWH 3BH9B 4HKJB 3IXAB 4U1NB 1JGLH 3BKJL 4Y2DC 2YD9A 4OQ1A 4N5EC 1A7RH 3IVKB 4MQXC 5G4OA 4URTB 3UPRB 3T0EC 3EO1A 4U1IA 4KZEL 4R2GD 2Z35A 2Y6TE 2C3XA 2JKJA 1B6UA 5IMKB 4IGBA 4Z3EA 2CBQA 2P80D 3FQUA 1SMOA 4GG6A 1HE8A 4E2OA 1YZZA 1I9RL 4QNPF 1M6OA 3VFNB 5A2JH 4X7SL 5TE6L 4N22A 4PWHA 1Y6NR 3PCYA 1R0AH 1XSOA 1QMUA 2IQAB 3PQYE 2FD6H 2WYIA 5CWSB 5KW9L 2F2HA 4PREA 3W37A 5EBLA 1MI5D 3CK0L 4PJHF 1QSFA 5J06A 4ZO7A 2A6IB 4FNUA 4IOFC 2ARJQ 5FCSH 4XO8A 3PGDA 5ICXB 2CPCA 4YFLF 4YSPA 1IFHL 2ADYA 2J12B 3H0TB 4J1UB 5IJKC 1KN4L 2WZ5A 2W07B 4Y8DC 2R2EB 1YUKB 1Y18B 3ARBC 3D52A 1L6XA 5FAAA 1Z5LB 5ISZA 3TFKC 5A40E 1EGJH 2UXTA 1LO5A 3EYQC 3WS6C 3LY6A 2PF6A 4KK9D 2R69L 4IRJB 5FXCH 5K9JH 4AUUA 1M4KA 2VLRE 3MNDA 4G9FA 1J1XL 4P59L 4HWEH 1E6OH 5EO9B 4HPYH 1SHMA 2APFA 3DA0A 5I8EB 4BFOA 4IIQB 4S11A 5F71A 2WKLA 1AGEB 3SGKC 2VUYA 3WELA 2WNGA 4HIPA 1Q94A 4Y4KC 3AUVA 4FFZH 4JFZH 4TQ8A 5IK3B 3V7AE 1RU9L 5T33H 1AGBB 2CDFB 2FH6A 3L3OC 1RIUH 2XWZA 4TRPH 2IOMA 2NLJA 4F33B 5BZDB 5I6NA 1D5MA 5D9SA 4AH2A 5G55A 3VD2A 5DHMC 5DD0L 1ZT4B 1BZ7A 2D2OA 1FZOB 3CSGA 2ADGB 4YL9A 3QDJA 4LEEA 5EOCH 2WY3B 4Y19E 3DXAE 1D5IL 1XF3B 2ID5A 1MHEB 4RIRA 1SFDA 3ASWA 1IU1A 4JR9L 2KS0A 4PPTA 4TVSa 2XRAH 2COVD 3BH9A 4HKJA 3IXAA 1YNTB 2XUWA 4U1NA 5HDRA 4PJGB 1S7SB 1B2YA 3VGEA 3ZL2A 3U79A 3IVKA 3O3BB 1AZBA 3UPRA 4WEEA 1E5ZA 4EUPB 4XN7A 3TBCA 5IMKA 5MP6L 1G5GA 1DQTA 3ENEA 4HU2A 4MA7L 4ZS6C 1MCOL 1KCSL 3SPVB 3PWUB 4M5ZL 4PGJA 3D0VB 1FVDB 4JVUA 2F19L 3VFNA 3MBWA 4HS8H 1S5HA 1WBXB 1HX0A 4HT1L 2EYSB 5DHYB 2IQAA 4ZUTB 1Y0LB 3SJVE 3THML 5CWSA 4WWNA 4JK0D 1ODUA 1QLEH 3SE8L 1G1OA 4Z7QE 1IC0A 1JZEA 1MRFL 2D03L 2WVUA 3ETTA 2A6IA 1AQMA 3L8QA 5ICXA 1O75A 3WTXA 4P46C 1R47A 4HJJH 4XPFL 1OSEA 4Y2LA 2Z7ZA 3QRLA 3KPLB 2IPTH 3MRBB 3H0TA 4J1UA 3EIFA 2W07A 4WLCA 4IKKA 2RFXB 3P3UA 2R2EA 1Y18A 1Z5LA 2IBZX 2WQXA 5HD8C 4AYDC 3MMEB 1E67A 3OWEA 5DMJB 3SE9H 2Z7YA 4IRJA 4QNPE 2BWDA 4PGBB 1ACYL 1ZPUA 2UXFA 4KRPC 4HCRH 4Z3IA 5HYSB 2AANA 3NFSL 3KL3A 5EO9A 1A6VL 4DZBB 5I8EA 3LH2L 3NCBB 1XEUA 1SQ2N 1AGEA 3HNSH 4KPHH 2FB4H 3BGFB 1Q1JL 4KHTL 4I1NB 1JYNA 4PJHE 1MAJA 3NH7L 2KMWA 2ICEB 3H4HA 2HT3D 5IK3A 3UYOD 1B3JA 3HW7A 1JD9A 4GKSB 1AGBA 2CDFA 4B96A 4IU3B 4S1RH 1X9UA 4JM4H 4F33A 4OLUL 5BZDA 2OCCB 3EXJA 2ZPKH 3H2WA 4BXVA 1ZT4A 4LP5A 1FZOA 2ADGA 2WO2B 4XC1L 4WW1A 3HE6B 4OJFL 2FE0A 2BVQB 2J1WA 2H26B 1T04B 1FDLH 4X0NA 1XF3A 1MHEA 4Q8BA 5GRVL 3UTTE 1A0QL 3L2MA 1GC1C 2EE0A 3LYRA 3K6DA 1YNTA 3MCG1 3MQIA 2PXYD 1S7SA 2VC2L 3EOYG 4PJGA 2BM3A 1ASPA 3QA3B 4DP2X 3O3BA 4H0GA 1DVXA 3PWLA 3TTSA 4I77H 5CU9A 2HP4A 1BXXA 2YJLA 1YQVH 4W9IC 5DJ8B 4FJYA 1ZLUK 1QQDB 4HUUB 3TA4D 1MHPL 4CGUB 1I8KB 1OTUC 2OXHB 1AO7B 3C5ZC 3SPVA 1I8AA 3PWUA 4GPVA 3D0VA 3MCLL 1FVDA 4KK6D 1E5CA 3SCMB 3UADA 1JFHA 3T3MF 1I8LA 3V4VL 3ZRFC 4AI7A 1WBXA 1D7BA 1TZAA 2NR6C 1XB3A 2EYSA 3HAEH 4F2MB 1PBYA 5DHYA 1F13A 1YNLH 3NN8B 4ZMLA 4ZUTA 1Y0LA 3KCWA 4GH7B 2XT1B 4R97C 1T6WA 2OAAA 1A4KB 5E2UH 4OF8A 5CFHA 3ZIYA 2PR9A 3KPLA 3I2CH 1KYAA 3MRBA 1S3KH 1DJHA 1P4BH 2RFXA 3WJJA 3C5SB 5B8CB 1JZ4A 3O4LE 2XSKA 2R0LL 1SEQH 3BPLC 3V9EA 5D1ZB 3MMEA 3O4OB 3D0LB 3RRQA 3MJ9H 3RY5A 1RV6X 2C9SA 4PGBA 2EDFA 2RB8A 5DGQA 3SGEI 2ENJA 3VYNA 1MCPL 4B3EA 4AYGA 1TFHA 2VERN 5HHQB 5HYSA 4ZOEA 2J1YA 4BFIB 1OY3B 4DZBA 3RIKA 1VEPA 2YA0A 2IBZY 2K8MA 4MJJA 2VN5A 4N1EA 3HEIB 2DH3A 5EEVA 3MBED 2ICEA 2YD6A 5F97E 5E5RB 4GKSA 5IMMB 2NXZB 2E7CA 2FTAA 2EDEA 1XGUB 3ATAA 3FOLB 4GG8B 4JO5A 4FCHA 3FW6A 3WFBH 1XGQB 1XEDA 2RAMA 3DUHA 4ALAC 3HE6A 1KYOJ 1N18A 4ZFGH 2JCCB 2OZ4H 1JPEA 2BVQA 1RJLB 2H26A 3H55A 3IDJA 1P4UA 1T04A 5C2BL 3P30H 1X4YA 4UV4L 3STZB 3E2HB 4JRXE 3KW7A 4HA1A 4WO4C 1N12A 3P4LA 2JQAA 3S0PA 1E65A 2WKGA 1S9XB 3NZHL 1U30A 3QA3A 4EKXA 4QRPB 1GY1A 3ZW3A 4CC1A 1JOIA 2HFEB 3K5SA 4X99B 3KLAB 1VSCA 3N1QC 5DJ8A 4EN3B 2CNYA 1QQDA 4HUUA 1B0RB 1ADQL 3PLYA 5AVSB 3CH8A 1I8KA 5FYLD 3PGFL 2JIXD 1AO7A 2OXHA 4E68A 3VW3L 5GJTH 3QRBA 3QUMB 1CLYH 1AGFB 3SCMA 2CGYA 2IAND 1CF1A 3EDEA 4F15B 3F7PC 2K7QA 1IM3D 4PS8A 4DGVH 3SY0B 5FB8B 3CZSA 3NN8A 2O5XH 2DWXA 5IG7B 3V6OC 1TXKA 4HF5H 4HUKB 3SZ6A 1A4KA 1XO8A 1I3GH 4ZPVB 4PGDB 1KGWA 4M9PA 2D7OA 1Q72L 4WK2B 5IROC 3UJIH 3VQMA 3ULVC 3C5SA 1BBJB 5B8CA 3RWCB 2XACC 2FLMA 4M1DH 5D1ZA 2FHFA 3QG7H 2VLKE 3D0LA 4H25B 3IDNB 5EEZA 2E4FA 3T3ME 5BZWB 3V0FA 1TETH 3IDMB 3S35L 5HHQA 1JXGA 1E9QB 3S97C 4BFIA 4DK3A 4PVBA 2YR3A 4HJ1A 4OI7A 2NXYB 2VISB 4A6YL 1MHCB 3K6NA 4FE9A 3VFMB 1I82A 2A9BA 3NJKA 5EUOF 3OLEA 1J0YA 1SY6A 1C12B 3LEXA 5IMMA 1ZA3B 3T4AB 2KL6A 1Z0MA 1I3VA 1OSYA 3BXNB 3FUKA 1XGUA 2YHGA 3FOLA 5KTEL 4GG8A 3D4CA 4MX7B 5ANMB 1ILUA 2YSTA 4OZGF 1XGQA 4ZMWA 3G9AB 3FKUS 2E4TA 3PAUA 1RURL 4YPGB 2JCCA 2QPFA 3ULUC 1RJLA 4MD5B 2Z64C 2QQLL 3NACL 3TIEB 1E90A 3ZX1A 3BUIA 1FLTX 3LKQB 3STZA 2VT0A 4MA1C 4LBEB 5DWUH 4K4KA 3UBFA 1WBYB 3L2LA 4PRPB 4BZ2H 3PJSB 5H2BA 1S9XA 1CL7L 2ZUWA 1M05B 5EOCJ 4FYQA 3T0XA 4QRPA 4JG1H 3T6ZA 5FKAB 4XP4H 1TVDA 4KKRA 2HFEA 3NIFE 3DVFA 3KLAA 4X99A 4EN3A 3ILEA 4FFYH 1B0RA 3PWNB 4JZJB 2N7AA 4WCYL 3D6GA 4PY8J 5C09E 2A4CA 3QUMA 5CEXB 1AGFA 1VKXB 1GMEA 5I73C 1U9KA 1JF1B 2IFGA 4AYEC 5HI5C 4X7TB 4MCZB 3SY0A 5FB8A 2ZXAA 2LOEA 3QW9A 1Y6KR 5F1IB 5LGJB 4MJIB 4P2OB 4RGMC 4DAGL 1EHXA 5IFHL 1R1CA 1P1VA 2GSMB 1I75A 3PWJB 4U6TA 3ZKQD 1NAML 4ZPVA 3VACA 3WY1A 4PGDA 1IIKA 3KHQA 1EDHA 2HLAA 2DQTH 4WFED 1A65A 2DI8A 2NTSP 5E5UB 3MXVL 3L5JA 5CKAA 1BBJA 3CG8A 3RWCA 2VDLL 4DN3L 4BCYA 1GPOH 3B43A 3IDNA 5GGSB 3HUJB 2K45A 2J73A 1AD0B 3MACH 5BZWA 3IDMA 5M7QA 3CFCL 2G9HB 1E9QA 4PJ9B 1NFKA 4UAOB 3W0WD 2VISA 2GEQA 1MHCA 3VFMA 3WXVL 2FO1A 2XN0A 2VR8A 4LGSB 4X2UA 4HKXB 1WIOA 1C12A 3H56A 1FFTB 3TPUB 2D3LA 4P5TC 4ERSL 5KOMC 1ZA3A 3T4AA 4WY7L 5I5JA 1IT9L 4TVPD 1MH5B 1HZHH 3BXNA 4M62L 4P2QE 3WFCL 1DDTA 2LLNA 1T2QH 4MX7A 5ANMA 1OARL 3OPZL 4WV1C 1LDSA 5T5FH 4YPGA 1RIVL 1IO4C 4MD5A 3TIEA 5D4IA 4OCNC 3W9DB 1XIWB 1QPXA 1T80A 2WLJA 4LBEA 4Y9GA 3OXRB 2BNRE 2AF2A 1WBYA 4PRPA 4DFIA 3UO1H 5HDQL 3MLXL 3I6GB 3PJSA 1YEWA 4DP5X 1M05A 1EBAA 1JXDA 3EUUA 3DJRA 4S0SD 1OAXH 5FKAA 2K9UA 1I1AC 1HINH 1TU2B 5C3LD 1BF5A 2N0KA 3FCTB 3PWNA 1BGXL 3IN2A 2YWZA 1S7XB 4JZJA 1S78D 4A2GA 1E4XH 3F7KA 1ED3B 1PKQB 5CEXA 1T89C 3L3JB 1BVKB 3OPUA 4UZGA 1VKXA 2Q5BA 1JF1A 3EYVB 4LLMB 3BVUA 4LIQE 4X7TA 4MCZA 5IV2B 2CRMA 2Y7SA 1EZSA 4X5RA 3UP1A 4LARL 5F1IA 5TE4L 5LGJA 4MJIA 4P2OA 4P2YA 3VG0L 3WUWB 3T8MA 4A7QA 1L9OA 3PWJA 2HT2D 2C9QA 1QTYT 4JREC 3OR6B 3AGVA 4OTXH 1CG9B 3O3AB 2IJ0C 4RGNB 3S3BB 4OCXL 2JK5B 4IDJL 3U1SL 1OAQH 3D3VB 1WA1X 1UATA 5D70H 4XWOC 1FGNH 2F5AH 3PWPD 3J8F7 4RMBA 5I5IA 4HJEA 1SVBA 2UZIL 4U3XA 3HUJA 3O45B 5GGSA 1AD0A 3FSAA 4AOFA 3TEZA 2VR4A 2G9HA 1OAJA 2Y07L 1MJUL 4PJ9A 3NCCB 4QD2E 3ZR6A 4D8OA 5ABZA 1G0XA 3FU0A 2VDPB 3E3QE 5J11C 4TL5A 4KJYB 3BUDA 4K8RC 2ORBH 4HKXA 4E9VA 4XXDB 5L0QC 2AXFB 4PWIA 3TPUA 4JRYD 2R1XB 5EO0A 3V4PB 3IE4A 3G6JE 1NGYB 2L8AA 2FGWH 3D05A 5JIHA 1MH5A 2IH9A 1ZLUH 4AJ0A 4OFYD 2APWA 3ZZLA 3HLAB 1L7TL 4FYSA 1EX0A 1H6EA 1IV8A 3DGGB 4G70B 3P4OB 2XWJB 1Z3GL 1JD7A 5AFAA 1DJXA 5A16B 5CLWA 4F7EB 3QT2A 4KTDH 3W9DA 1XIWA 1N7ML 3RX8A 3BEWB 4GEIA 5FYKL 4PG9B 5IB2B 3OXRA 5BVPH 2EIBA 4JM2D 1YYCA 2X4OB 3ML9A 1BG1A 3I6GA 1XL4A 3GBNH 1VCBC 3S3DB 3PU7A 1J8HE 1TU2A 4QRRB 4UTBH 4FQ1L 3FCTA 3FXIC 1S7XA 4X5XB 1A1OB 1ED3A 1PKQA 3L3JA 1BVKA 3MRDB 3LOWA 2WBJB 3TJEH 1XX9C 2W9EH 3EYVA 1FC1A 3VXQB 3QDGB 3L16A 5IV2A 3BLBA 1AFVH 3HC3H 4FTVB 2Z91A 3WUWA 3MA9L 5ADOL 1DBAL 5D4QA 4XCCL 3S4SB 1NCCH 5JIMA 3QDMB 1WGVA 2EADA 1J0HA 3KXFB 3KEDA 3OR6A 1J18A 2BSCA 4QAWA 1CG9A 3O3AA 2WWOA 4Y1AE 4NUGL 4QRUB 4WFFE 5DZVA 1JYWA 4PJEF 5I1GH 2JK5A 1CDBA 3D3VA 5E1AB 4MJ4A 1KGCE 1TQUA 2CALA 5JXAL 4FTDA 3WLWD 4ZSOE 2ZXEB 1JV2B 4GSQA 4APQB 2YD3A 5K69A 5H94B 2CHNA 3O45A 1MCFA 4AMXA 2PP9A 4F7PB 1YC7A 3FQ2A 1ULVA 1SF3A 3MOAH 1T5XB 2CQVA 3E9UA 4TULL 5KSAB 1KJ2H 1F5WA 1ZHLB 3RAJH 1R75A 1DUYA 2LFGA 3TOPA 4KJYA 3DHPA 2GB2A 2FX8L 4FFWD 1TZ8A 4G5ZL 3LNHA 4YPJA 3AJ7A 3ETBF 2AXFA 4XXDA 3WSQL 2R1XA 3V4PA 1KEGH 5FHAL 3TBTB 3I9IA 1NGYA 3OKEB 1A02N 5DEZA 2B08A 3S7GA 3HLAA 4HGKC 4AM0Q 3OKNB 5HPOA 3NVQA 5C0AD 5FEBA 5GRYA 1BV8A 3B34A 3DGGA 1A47A 1J1OH 3EGXB 5TH2B 1N5AA 2XWJA 3IPFA 3P4OA 4FCAA 2XNAB 3VH8G 5HHNA 4QHNB 2BMKB 2GBVA 4CSSA 5A16A 4F7EA 4MYWB 1HYSD 3BEWA 1R3IH 5KS9F 4PG9A 5LXVA 5IB2A 2H32H 2XTJD 1OM3L 1F86A 1CMOA 3BSZH 2X4OA 3MLVH 3O6KL 1A64A 3VD5A 2O5ZL 4KX7A 3NABL 3B8SA 1E4WL 3BP6B 3ZTDC 1MLBB 4Z95H 1UASA 2AEIT 3ZKXC 4XNBA 4QRRA 4PLOB 4TMPA 2AGJH 5FGBA 1DVFC 2HVBA 1Q1PA 2P8LB 2FUQA 3ZE2E 4X5XA 2EXTA 1A1OA 1PAZA 4EIZC 3VXRB 1P53A 1E5BA 2XIDA 1B4JL 3MRDA 2WBJA 2WP3O 3FUEA 3MRNB 3U4BL 1MDAA 4ZMZA 4J3WA 4QHKJ 3VXQA 3QDGA 3L5XL 2XBTA 3P0VL 4GMTH 3TV3L 5D5MF 1CS6A 1TYEB 3FUDA 3A3YB 4X80H 4FTVA 3GHBL 5IZ7A 2RTTA 3S4SA 1BF2A 3QDMA 3KXFA 3N1PC 4ZFFB 4WEUD 4QRUA 4XVJH 1JSYA 3VRIB 3V8OA 1BZ8A 4FGMA 5DQDL 3T8XB 3JZ7A 1G6VK 1MI5E 2CK0H 2XETA 4P9HL 3ZZQA 1YNTF 3HRPA 3KVDD 4PJGF 1KCWA 3S5LG 2VSMB 5TD4A 5K9OB 4BA8A 1JV2A 1XD0A 2I60L 4APQA 5H94A 3N55A 4F7PA 2H2SD 1YC8A 3P02A 4YE4H 5KSAA 1T5XA 3MSPA 4FJZA 1ZHLA 3S2CA 3NOIA 1RXLA 1S9WB 1WEJL 3QEQD 3QR1A 2AKRB 1DDHB 4LFHD 4M8RA 3D4YA 1OZUA 5DEFB 4LKXB 5CLXA 3LNFA 4MD0B 1SDYA 5DK0B 3MV7D 2K6WA 3CJJA 4TQPA 3VO0A 4EZMA 4Q0XH 1A3LH 1J9QA 4V33A 5CR1A 3TBTA 2Y4SA 3OKEA 3FRUB 4PJEE 4QXGL 4WU5B 2ZKXA 3US1A 1GR7A 3OKNA 5CGYC 4YXLL 1HNGA 1NA8A 2F5BH 2ROYA 3IFPB 15C8H 2J88H 3O9WA 4XWGH 3EGXA 3OL2A 5TH2A 3SDCD 3ZTEA 3IMWA 2XNAA 1I1FB 2BMKA 4QHNA 5T3ZH 3WIHA 2IH1B 1CLZL 2EC8A 4JPWH 4IM8A 4CUCA 1FH2A 3IFLH 1RK1B 3GZPA 4A1RA 2YD1A 1KTDB 4NZDA 4XMPH 5KVGH 1JF6A 5D1QC 5D2NE 2X05A 4KRLB 1UZ6F 1BEYH 2J72A 4AK2A 4BZ1A 3BP6A 4KO5A 1JNNH 4CMHB 3HJEA 1MLBA 4TPRH 1U8HA 5E95B 1T03L 4OQTA 4OD3L 4LK4A 2P8LA 4H1LH 4FD0A 4R6UA 1L9MA 1UM5L 3N5AA 1MFAL 5BO0D 2ATAA 1AHWC 1HJCA 2IPKB 3UTOA 5E51A 3VXRA 2HWZH 3MRNA 2VMEA 1C5DB 1E5AA 2DLFL 4DGWC 4N2DA 1CR9L 1SLVA 2BIOA 2GAZB 2GIMA 5DO8A 3RY6C 3BO8B 5BRZD 4LCIL 4NKIL 3MV8D 1QHOA 4YN3A 3VNYA 3O8XD 3FAXA 3DDGA 1GIGL 2O30A 3WIAA 2BIQA 2HJKB 3SOBL 5FUOL 1FGVL 2FT8A 5AYTA 1TENA 3CMGA 4ZFFA 2EDOA 2JJSC 3PUCA 1JV5B 3U9UB 3GF8A 4RFOH 3VRIA 4ANVA 3T8XA 1FZJA 1E27B 1TTAA 5DC0A 1RUKH 2EDHA 3CC1A 3DVGB 4H20L 2Y9RT 3U7YL 5K9OA 3GJEB 1JRHH 5J1AB 1FL5B 2CLRB 5D5ME 3S35X 3EADA 2WVSA 3CZGA 3BGMB 4H7VA 3VDAA 1H0DB 3AM8C 3L2NA 4DFHA 2AKRA 4CU8A 5C86A 3FTXA 1DDHA 5F3BB 1EIBA 3DX9B 4LKXA 5DEFA 4MD0A 1NICA 1GMIA 4NQEB 4P23A 5ALBH 3UBXI 4GAFB 5DK0A 2VXQA 2HPTA 5GGUB 3UGEA 3U2SB 3CIAA 3FRUA 4WU5A 4ZNEE 1I85A 5EU7E 5DD3H 4Y5XB 3JT0A 5LN4A 5AW4B 1AHMA 3IFPA 2HH0L 2WGNB 3MO1B 3HC2A 1QFUH 3LQMA 4LIQH 2UY6B 1FWXA 1T1XB 1G94A 1I1FA 1XCXA 2G3XA 3NJLA 3TBBA 2X89D 4AYBA 4UIKL 2IH1A 2ZTBA 3MLZL 1ACZA 3NSYA 1RK1A 3HB3B 2AK4D 4PMFA 1KTDA 4NAQA 1XF2B 5C08B 3IGKA 4WWKD 5IMOB 4GUPB 2CKBL 3DV4B 2NSMA 3FO0H 5BQDA 4JJ5B 5TDOA 3QULB 2VJXA 5SWSD 4M1GH 3GJFB 2BHYA 1OOWA 1MWAH 1E4KC 2IH3B 3IWVA 4GSRA 2IPKA 1QLFB 4KO6A 1C5DA 3F2LA 1T0PB 3GMQB 4QR7A 2ZXWB 2GAZA 3LPFA 3OXSB 1CTOA 5EPMB 4S1SL 3C60A 3ZHLA 3JWNE 1KMGA 2R23A 3NMEA 1JN6A 1RK0B 3U9WA 4ODTH 3ZQWA 3VGGA 3OZ9L 1TVBB 2HJKA 1UZ6E 3SO3C 2HVKB 3ZL4H 1PIFA 1NBQA 3LVTA 3QZWG 4JGJA 1JV5A 3U9UA 1KF9B 1OSPL 1XCTB 2B4CL 3ZDXB 1E27A 4N24A 3I3EA 1NFIB 3GXDA 3WEOA 5DU7A 5MI0B 1SXAA 4H0IA 4J3OD 3GJEA 1SBSL 3QUXC 4POYA 3ISYA 3L5HA 2XZCH 3OHXB 4RMTA 5J1AA 1FL5A 2CLRA 1G9MC 3NK3A 2E46A 3BGMA 1H0DA 1EO5A 4XP1H 1DBML 5F3BA 2XJLA 3VQ2C 1ET8A 3DX9A 3IAPA 5I0VA 4NQEA 4OFVA 1I7UA 3IF1B 3U2SA 3E8UH 5GGUA 4ADJA 2BHZA 1ZTMA 4K71C 2FX9H 3CVCA 5J6SA 4E9LA 4GXVH 5L9DL 3LD8B 3FSZA 4Y5XA 1A6AB 3BP5B 4LVOB 3MO1A 4PJDB 1KEML 2FWUA 3SKOA 1F3DH 2UY6A 1T1XA 2ZQKA 2NX5D 4S1DC 2QHLA 3BQUD 4O9HL 1OCOB 4XP6H 3L5WB 1JYXA 1KXVC 2YGPA 2ZAGA 1XF2A 4KUCD 5C08A 4KJWC 1RUAH 4L37B 2ZKHL 4GUPA 5IMOA 3RPBA 5KYWB 3DV4A 4NRXB 4N9GB 4JJ5A 2P9RA 5DRWA 3QULA 3TTYA 4FA8A 1HI6B 5I18H 1WWWX 2R51A 3B2UC 1J87A 1UKQA 4CKVX 2GJZB 4N8VG 1JZDC 1IFGA 5IBUG 2G2PA 3FRPB 2ED8A 1SN2A 2MNJB 2VW4A 3I9GH 4XNUH 4J6IA 2IH3A 3HS0C 4G1MA 1QLFA 2JJTA 4MQ7B 3GMQA 3TVMD 4CSZA 3OXSA 4TLTA 5EBGA 5EPMA 4UQBA 1TJGH 4KROB 5IB4B 1RK0A 4YHML 1M2OA 2IANE 5FYJL 5HJBA 4I0KA 1TVBA 1R6VA 1BD2D 2HVKA 5HY9B 1TQTA 1N6VA 4FXGB 4YBHA 2IAAC 4K7PL 3OLDA 5DSCB 5AOKA 1QRNA 1XCTA 4NWTL 4XR8C 2ADIB 3D69B 5DFWH 1NFIA 3M17B 1KFAL 4PJIB 3U7WL 4KV5F 3NCJH 1XCWA 1EFXD 2HKFH 1PZSA 3LMJH 1HNYA 2NY5H 2B5IB 4JQVC 5C0CB 3OHXA 1NIAA 2Y0SA 2M8XA 1GGTA 3KPMB 4JG0H 3WKMH 1GJIA 2XQYA 3B9AA 1KTCA 5K39B 3TEYA 4ZO8A 4JQXA 2Q1EA 1OVZA 3IF1A 3ZGHA 1BQHB 4AVHA 1KPRB 1U3HD 2H1LM 1TZHB 2XWDA 4G7VH 3UAAA 1A6AA 1W72B 3BP5A 4HOZA 4Z78B 1NGQH 3SEPA 4NN6B 2DQEL 3K4DA 1K3ZA 3VWJD 4F8QA 4PJDA 3VM7A 4ELMB 1GKOA 5JHLL 4GW1B 2Z8RA 4OKDA 1JHKH 3U82B 3EDFA 2VL4A 5J57B 3L5WA 2W88A 5AZ2L 3PAYA 3LKSA 4IKNA 1UENA 3JWOL 3FCGA 3F04A 3FTWA 4L37A 5KYWA 2P5PA 3CSPA 4NRXA 4N9GA 3EYOB 4KI5C 4Q9BA 1A7QL 1RUPL 4GIAA 5F7YC 3UDWC 1HI6A 3KPQB 5FW7A 2GJZA 2ZE0A 1QBBA 2WZ0A 2G4GA 3FRPA 5IF0B 2DJSA 2CA3A 1A6UL 4DTGH 4MQ7A 1CE1H 1AJ7L 3G9VA 1FORH 3QXWA 5E56A 1DL7H 3F85A 1NCOA 5IB4A 4EJ1C 1NCWL 3GDCA 5LXGH 2QKIC 1WE5A 3QK0A 5D8JL 2AJVH 3GBLA 5CJXC 5I0XA 4X5QA 5HY9A 1N26A 1QFWM 1OK8A 1KG0A 4FXGA 4UTAL 5DSCA 1GVIA 1L6PA 2V8MA 4ES9A 4NAJA 1KCUL 2ADIA 3D69A 2A99A 3M17A 4PJIA 3HAEG 3VGHA 5AW8B 2H1PL 2NY2C 4HIHB 4JJHA 4WFEE 2IGFL 2CCLA 3EYSH 4POUB 4CNIB 5FKPB 3KPMA 5HGHB 1AE6H 4M7ZB 3MOBL 1BJMA 1F41A 1C5CL 1P2CB 2JKWA 2EIEA 1ZKAA 3MNWB 5K39A 2UWEB 4R8WL 4MAUL 2NY0D 3CE1A 5HHOD 5HYJD 4M93B 1HK6A 3BMWA 1UEMA 4Q58C 5ILTL 3W0WE 4BH7B 1KPRA 2WJ7A 4ZD3H 4G6FB 1TZHA 3NGBC 4XNDA 2Q7NA 1JS4A 2X1XR 1W72A 4Z78A 1W16A 4I0PC 1VGEL 5GGQH 3A5VA 5LAXB 4I3GA 4KV5E 4OJDH 4H8WC 3LRGA 4TVPE 4ELMA 1OAZH 2FZ3B 4I4WB 4GW1A 5I1EL 2F8XC 5K1NA 2IV9A 1GKEA 2FECL 3O2VL 4HWZB 5DS1A 3K3QA 2BIMA 5JXEA 1OOAA 4I3SH 3VFPB 1Q0XH 5I8CB 2BY1A 3ZDWA 1PS3A 3NZ8B 4JFTA 1LO4H 2EC9T 1JZGA 2AJ3B 5I1JL 4M4PA 4NZUL 3FT9A 1OALA 5B1KA 2MOGA 1WIUA 2DM3A 3EYOA 4EMZA 2PLTA 3KPQA 4LDOB 2NY1D 2MQCA 3N91A 4WSKA 1INQB 3DMMD 2QQKL 4QXUH 1A4BA 1J9SA 2YAEA 3MV9B 1KWGA 2BIHA 3ZUNC 1B2WL 5IF0A 2Q87A 3NJGA 4FZ8L 1O6SB 4YHPA 2IPUG 1Z9MA 3MRGB 5IVXB 1F3RB 4MTMA 1L7IH 4DVBB 5KVDH 3ATFA 4V11A 2F8OA 2KI6A 2BNQA 4PJBB 4UIMB 4JFDD 3FT1A 1IAMA 4K7FB 4P4RA 1KJ3H 3GS4A 2CO3A 5C9JB 1T1WB 4TSBH 1OQXA 3OVUB 1BAWA 2GABA 1BVNT 1MG2C 1P6AB 3MJ7B 4OZFB 5DMIH 5TE7L 4KVCH 5GZNA 3TYGH 4NDMB 1PIGA 4J3BA 3D9AH 5SWZD 4HSAC 4FDWA 2EUVA 2R15A 4NLAA 1MCIA 4YHIB 1MAKA 4HIHA 1KY7A 2VE6B 1VDGA 2AW2A 2VWEE 2VDLB 4CNIA 5FKPA 5HGHA 3B9KB 4KC3B 1IZKA 1DEEB 3BPOC 3PWPE 4FS0A 1P2CA 5KJRL 4OCMC 3MNWA 4W4NA 1ZTXH 4FNQA 2UWEA 3MC0A 2Z8WC 4MXWH 3ZQXA 2L7QA 4A6YA 2DJMA 4OLXH 5GS1B 1X5MA 2F1BA 4LVNB 4BH7A 1HCYA 3V0VB 1WFMA 2MH4A 3CZUB 3AU1A 2YGOA 2D2CC 1WZKA 1WZMA 3OAUL 5FK9B 3S98A 4JFYB 3MPCA 2AC0A 1RZKH 4PVMA 5HGBB 4JRYE 2AJXH 3FUJA 3HCVB 5LAXA 1LO2H 3P9LB 4S0HA 5IW1B 2N59A 2FZ3A 1C8QA 4I4WA 3GMOB 2FBJL 4HWZA 3X13B 2AZUA 2ESVB 3VFPA 3GSNL 2M26A 4QUOA 1ADWA 1MQ8A 3DOHA 3NZ8A 2OFQA 5FHBH 2ZG2A 2AJ3A 4X6DF 2PPAA 4F8PA 1ZEAH 3UAJC 4PHZA 2ZNXA 4DJMA 4M3JA 4HZ1A 1F3DJ 4LPYA 5TPWL 4HPOH 3ROLB 5ITBH 2CXGA 5I2IA 1AR1C 1INQA 4QRQB 3VSTA 2QVMA 4IJTA 4WW2C 3F58H 3MV9A 5F1SA 3QPXH 3KEHA 4KU1A 4EAEA 4X6CB 1O6SA 4NBXB 3MRGA 4TQEH 5IVXA 3TN0C 4MB4A 4DVBA 3WLBB 3D2TA 5CFAA 3HFML 4ISVB 4PJBA 4UIMA 1BVLB 4ZXBB 1JVOA 4K7FA 5F89B 3RVWD 1F8TH 3HG3A 5C9JA 1T1WA 2XKUA 3C5JB 4OZFA 4RISH 3MJ7A 5CILH 2APXA 2BP8B 5JQ6H 4KKAC 4MGXA 2H4EA 4NDMA 3UH8A 4FQXC 4JKMA 4LHUG 3EFFB 3W2DH 1OP5K 3MRKB 4BYHA 4WI4A 5D72L 1A3RH 1F90L 2H5UA 2K6ZA 5HGGS 3WEBA 1AR2A 2VR9A 4JO3L 3KLHD 4YHIA 2FQEA 3NCXA 3JYBA 2VE6A 4Y9CA 4L18A 4QTFA 1UM6H 4TUOB 3B9KA 1DEEA 5BS0E 4B50A 5AOJA 3VGAB 4GFXA 1MIMH 2OCFD 5CP7B 4FG0A 4NLHA 2KZ1B 4DEPB 5GS1A 2O4EA 3SKNB 3TBWB 1MFNA 3V0VA 3WTUA 3ZYIA 4R3SB 4XMLH 3GRWL 2PYEB 2J8OA 2YS4A 1AKJD 4JFYA 2YQGA 3N9GH 2EIKB 4YDJB 5HGBA 3SDAB 3CQQA 1OHZA 3HCVA 1LWHA 2YPVL 4LZKA 2D0HA 2RR3A 4RGOH 1EHLL 3P9LA 4F20A 5IW1A 2EXYD 4PB9H 1OWRM 2KZBA 1UEYA 3GMOA 4Z7UE 4C56B 2QGEA 1W0WB 4AQZA 3CDCA 4XPGL 3X13A 1TEGA 2QZ5A 1IIIA 4GSUA 2ESVA 5C0AE 4ODWB 3QUZC 3WUZA 1UOVA 3V0DA 1CLOL 3V6ZA 4BWWA 4JN2B 4PIRF 2BY3A 4AKOA 3F62A 2YXVA 1KDIA 2QQQA 2WLIB 4F3FB 1AS6A 3B9EA 4ZTPL 3ROLA 4NPYB 2GC4C 4IMLB 2XTJE 1DQDL 4ZFOL 3FCUB 4NIYE 1SY6H 2IQ9L 5EZLA 4QRQA 2OR9H 4ZW6A 5DUPL 3HVNA 1QNIA 3ARFC 4X6CA 1YECH 4XMKL 4Q2ZB 3BUQA 1RSFA 3WLBA 2VMJA 2PNDA 1JGVH 3JVFC 1GCYA 4ISVA 2R4SH 1UGKA 4Y1TA 1BVLA 4ZXBA 1CBJA 3ORJA 4D9LL 1G7HB 3D7PA 5F89A 3PY9A 1SEBB 4X6DE 5D7JC 5E08H 3LQAL 4KY1L 4B6ZA 4N2LA 3C5JA 4DERA 5C0NC 2BP8A 2N3JA 2R0ZL 3HI5L 3TZVD 1N59B 3RY4A 2ZUTA 4XB8A 1CO1A 3EFFA 5HDBF 3QCTL 3MRKA 2K3HA 1F6FB 3W11D 4ANUA 4Z3GA 2EDDA 1VFMA 4FQPA 2CUAA 2OCJA 3X11B 3P2BA 1IC1A 1TZIB 4ZNCD 4JFOB 5DMGC 4LKCB 4N86A 4NHCH 3PIQB 4IRJD 3ZHFA 4TUOA 4HOMA 1BZ9B 5T3XL 2ITDB 3WNIA 4FG6C 3QUMH 2JV6A 3CFBB 1CFQB 3WS3B 3K2UH 1DJZA 1CTNA 2JWYA 5CP7A 5CZVH 4EI0A 5KBKA 5EF2A 1A6TB 4WUKL 5AKVA 5L7XL 3S36H 3SKNA 3TBWA 4EOWH 5K9KB 4NQUA 1VLXA 3QEQE 3RWIB 4KKBD 1UWGL 4R3SA 1BBDL 5CIPB 2PYEA 3PL6C 4JG9A 2VR3A 3WIIL 5T1MA 3L9EA 4YDJA 3S8WA 2A6KB 4HV8B 2DH2A 3MV7E 3SDAA 2D4DA 3E1ZA 4GI8A 2B3IA 4HGWB 4NQCB 5EZJB 3P9MB 3DK2A 3ETBJ 1UM4H 4RWYL 5EULV 3GMMB 4C56A 4KAQH 1W0WA 2R83A 3BDYH 5B1JC 4GNKB 3NIDF 4ODWA 1DLFH 5HI3D 4DOHB 1MN4A 2KUTA 1AP2A 1U36A 3JVGA 2VMCA 1RLWA 3WNJA 4IOIB 4OV5B 4NJ9L 3FK3A 5E2VL 1GHFH 4JN2A 4BM7A 3IU4H 1KZYA 3H3PL 2YQ3A 2WLIA 4F3FA 4YHYB 2Z1KA 4KK5C 2ISDA 3N0PB 4OLEA 2IXQB 3WY4A 1ZK9A 2P46B 1AIFB 3FJTA 4X6BB 1W15A 3BX7C 3DARA 5AALA 4Y2DB 3CLEL 2AJUH 4Q2ZA 4GMSL 1IM9B 2VABB 2VXUL 2DQHL 4UV7H 3HE7B 5D6CB 1BWWA 5AD0B 1CDIA 2IG2L 1J5CA 2D4FA 1G7HA 3ESOA 4U1HB 1SEBA 1F42A 4FNSA 3N6YA 5E1QA 5BRZE 4PV1C 3O3UN 4X8JB 4D2NA 1HL8A 3MV8E 5I8KL 1N59A 4KTGA 4EI5B 4PJXF 1QBMH 2VXSH 4TVPH 1NCIA 1U8LB 5CUSL 4A2FA 3X11A 1TFPA 1R33A 1TZIA 3CN3A 4JFOA 4LKCA 4NP4H 3PIQA 2BDNH 1N70A 5AYUL 4XOCA 1BZ9A 3WG7B 1CXIA 2ITDA 3UG3A 3ARPA 3CFBA 5I1DB 4FG4A 1CFQA 3WS3A 2D7NA 4HK3J 5IQLA 4IBYA 4OSUL 4OLWH 1OKEA 1A6TA 4BFBD 1NKGA 3BSGA 1A4AA 4RVBA 3SKJH 4Q9QH 3RWIA 5BNXD 5CIPA 1XB6A 2J43A 3CVDA 1SM3H 3S6CA 1X5XA 4KUCF 5HDBE 4UNTA 2A6KA 4JO1L 4HV8A 2N4IA 4HGWA 4NQCA 5EZJA 4TOYH 3P9MA 5LGHL 1U58B 4G11A 1U8QB 1XH0A 1HXMB 3W1ZA 4AWJC 3UTSD 3GMMA 4GI6A 4R7XA 1XSIA 4Y4KB 4AIEA 4J12A 3V0WH 3HE6D 4RRPA 1IAIH 3ZKMD 3DIVA 2VERA 3WU1A 3L13A 5IR1B 4OV5A 2Q9OA 4IOIA 3MCKB 4R4FL 3ARGC 4F57L 1Z9OA 1QFWI 3QIUC 2FEJA 3ARVA 4JB9L 3IKCB 5CN2A 2AK4E 3IWUA 2QV2A 1OAKH 4H2CA 1LYQA 1O5DT 4E9WA 1IGFH 2IXQA 1NAKL 2HLEB 4WJKB 3L4WA 1AIFA 3CPUA 3FC8A 4J3UA 4X6BA 3ARWA 5SWSE 1FFNB 3BAEH 3RB5A 3QORD 1IM9A 2VABA 2IFFH 3V4UL 3HE7A 1AZZC 1F4YL 4XMZA 5D6CA 2FEDD 3NIDE 5AD0A 1GGIL 1NDGB 1IGML 1QABA 3U0WH 5D2LF 4QLWA 2CR6A 2OMTB 4W9CC 3IFOA 3CFIC 4B27A 4U1HA 2ZOTA 3WMSA 4WEBL 1UJ3C 5SX5H 5BV7L 1A5FH 5HP5A 1HZLA 5ES4B 4GP8B 4ZUSB 1OK0A 3QE5A 3R7RA 4M48H 5ERWB 4EI5A 4EVNB 4MAZA 4JPKL 4LCYB 1P5UC 3EG9B 2WZAA 2MKWA 3QI9B 4PI2A 4IBVA 2F53B 3ZE0F 1IKNC 4HQQL 4ZO6A 3FS9A 1UD4A 3GIZL 1T0MB 3C87A 3H1ZA 4K7PY 4XB7A 4PJCB 2ROXA 3K81A 5B39G 1QWHA 3V5DB 1NWOA 5GISH 3UJTH 3Q06A 5I1DA 4CMMB 4TQHA 1MQKL 2GUYA 2YKKA 3NA4A 1NLDL 4ZAKC 2Z8VC 2QEJA 2GBUA 3WS6A 3IDGB 4NKDB 1KCRL 3MUY1 2OI9C 4AVJA 3NSDA 1IC5H 2EILB 3UROR 1K5WA 4W70A 4PJXE 1TTFA 2X4NB 3FUIA 4ZUVB 2R0WL 3OB0K 2R2HB 2NNAB 4UB0L 4PBXA 1U58A 2YMXH 3MRPB 1HXMA 2NY7H 5B3JE 3KE0A 3H53A 3RTQC 1SF5A 2H47C 1C8PA 4CDGC 4W9KC 4KHXL 4HC1H 2Y69B 4P49A 5E2WL 1XF4B 2LAAA 3ALXA 5IR1A 3MCKA 2B7DT 4X9YA 4YSOA 4YBQD 3RVXC 2NX5E 1XQ4A 2BZ7A 3IKCA 4QJ5B 4Z3HA 3IM1A 3FN0H 1IBHA 5K1JA 4Z18A 2CKBB 2G60H 4GKOA 1INEL 5AZEL 1DHKA 3N43F 3GXNA 3GK8L 5JW3L 4UM9B 1TO4A 3ZO9A 1FFNA 1CZ8L 4LGRB 4P9MH 5AAMC 3UIYA 4AYFB 3STLB 3MU3A 1BVZA 3E6FB 1SMDA 5F93C 1NDGA 1FLRH 2VRQA 3QZOA 5IP4A 2OMTA 3BYTA 4RMVA 5TQ0H 4GB9A 2VUOA 4JO4H 4KKQA 5DLML 3A23A 4H1LG 2X6UA 1QOKA 2FX7H 2G3NA 3B83A 5ERWA 5A1AA 2XQYK 1RZFL 4KRNA 2JKNA 4LCYA 3EG9A 3CVHB 4NQQA 3ARDD 3QI9A 2X2JA 1BD2E 2E59A 2F53A 3V0GA 3J7HA 4YJZL 4MNGE 3N1MC 4K3EH 4Q14A 2DYPB 4R97B 1DQLL 3ABGA 2BSEA 2I7SA 5ALCH 3ZE1F 1T0MA 2VDOL 4PJCA 4MDIB 4OGAD 4TV3A 4KDTA 1N4XL 3Q2WA 4L3FA 4MZ2A 1SBBA 1J8SA 2YEVB 4NWUL 4YR6B 5D2LE 3V5DA 1KB5B 3ZSTA 3WXWL 4CMMA 5I1HL 2JJVA 1FL3B 1A7NL 3PP3K 5KANI 3AWGA 2P45B 3QDHA 3BDXA 3BPLB 3IDGA 4NKDA 4DSYA 4WUUD 1JXJA 3N1FC 1MCBA 1JP5A 2MJWA 3CVBA 3OKYA 4NJAH 2F15A 4IGBC 1S5IL 2X4NA 4ZUVA 5GRVK 4OF6A 2P3YA 3ZE0E 4PFEA 2R2HA 2NNAA 4S10A 3FO1A 4NRYB 1K85A 1VESA 2PN5A 3MRPA 3QBTB 2BSDA 4F5CA 2G0LA 3N85L 3L7FB 5C6TL 3BN3B 3AG2B 2VM9A 1U2CA 3UAEA 4LSQL 3VUAA 5F9JB 4KUZH 1TEFA 1XF4A 4ZMTA 1X6LA 4HIEB 2X4PB 1WT5A 4QWWD 1NCGA 3DX8B 4OAWB 4QOKD 2R0KH 4DF9A 4PRPD 1OGAB 3JYCA 3IDYB 5TQ2L 1YSOA 5B3SB 2CKBA 3O81A 3PS6A 4E36A 4KKZA 2FK9A 3A4EA 3GXMA 5CSBA 3MNMA 2CZNA 4FQ2L 1ZLSH 1CF8L 4UM9A 1PG7H 2L7JA 3LIZA 4OU3A 4FX5A 1J0ZA 4AYFA 4R4NC 3STLA 2DLGA 3NTCL 2VXTH 3QJFA 4NAMA 1FA4A 5GS0H 3E6FA 4K5NA 5BO1L 5EF0A 3DGCR 4D94A 4YXKH 4DPAX 1BAFH 2WTRB 5EOQH 5B4MD 1ZGLB 2XA8H 5IBLD 2EIJB 3WIHH 3FU3A 4WU7A 1SVCP 2XA3A 4AGOA 1IBFA 4PGEA 3EHBB 4ZFZB 2DWYA 1E4HA 3OJMB 4F7CB 3CVHA 4ZUWB 4ZMQA 4BZ1H 2GG1A 3MRCB 2CBMA 4K3JL 5AW2B 1WZLA 4MBOA 4PWEA 2DYPA 4AQ8A 1RZ7L 4A68A 2XFXB 4WF7A 3BUBA 5F96L 4MDIA 4YR6A 4DUXA 1KB5A 1FL3A 5I19H 3B2VL 3QEGH 4X7FC 4G82A 5C7XH 4N0UB 2NY4D 3IU3B 1A9VA 1INDH 4ONOA 5F7FA 2ITFA 2A9AA 5KSBB 2ZCKL 4M02A 4NQDD 4RBPK 5HHOE 5HYJE 4AL8H 1HC1A 1TJIL 1WUZA 5GRWA 4NRYA 3JSSA 3CX5J 4N1HB 2NW3B 3LEVL 4RZKA 3V5HB 3ZYOA 3LEYH 3K46A 5SV3A 2YUWA 5AW0B 3HMXH 1ONQB 3HZKB 3ZE1E 1TG8A 3M45A 5LNGA 2MCPL 3VXMB 4OLZL 5F9JA 4WSGA 5SWQB 5KYUB 3U1QA 3BESR 4TLUA 4HIEA 2X4PA 5IQNA 5CJ5A 3R8QA 3DX8A 4OAWA 4LNVA 3HN5A 2IDCA 2GJ6E 1OGAA 5FC9A 5C0BD 3OHMB 4NGHL 5C7ZA 3AZUA 2DB8A 1EQWA 2IF7A 1ZHBA 2VXQH 3NJXA 3TT1L 4G7RB 1MFEH 4G6JL 4S1QH 4YUEH 4XNAA 4I3RH 4X83A 5CJOH 2DQ6A 4WI3A 4F2FA 1E9PB 2ATPB 3V8CA 1JIBA 2X87A 2AXGA 1XBRA 1QD0A 1GW0A 2WTRA 2FLBT 4POZC 1ZGLA 3KLKA 1EBPA 4FHJA 4JHAH 2EC9U 2GIXA 4M43H 4ZFZA 5C3TA 2X3BA 2QGCA 1PCSA 3APDA 1T66D 4J4PC 5JHDD 1O9ZA 4F7CA 2IWFA 4ELKB 2ZWZA 4ZUWA 3Q9PA 3ABLB 3WL9B 2HB0A 3BVXA 4LCWD 2F54D 4RGMB 4ABVA 5H35B 3BKJH 4M29A 3NPZB 2WIIA 4EF3A 5SWZE 2XFXA 3JTSB 4XPBL 1T5WB 4WI8A 5CMAB 3BVVA 1AGCB 3QQ9D 5LG6A 5CJ8A 4ADGA 1S2EA 1XHHA 1I9RH 3L7EB 5I1CL 4N0UA 2TAAA 2V2TB 3IU3A 4QRSB 4X7SH 5TE6H 1NANH 4CL7A 4GSDL 6TAAA 1MEXL 5KSBA 3QJZA 2C9VA 1FP5A 2WGXA 4DT2A 1XV8A 1H9VA 4YEFA 4LE8A 2A7BA 3CK0H 2D7TL 4G8FB 4WI0B 2NW3A 3FTZA 3MJGX 1BSIA 4PTTB 4FEMA 3V5HA 4BHUA 4ZZFA 1ONQA 3HZKA 1I8LC 1P7QD 4WGKA 1IFHH 3D2UB 1M2VB 3VXMA 4QKTA 1KN4H 2QVTA 5SWQA 5KYUA 1FRGL 3IJSB 4LOEA 4FQIL 2R69H 3HI1B 2ITCB 4XHJD 4PLJC 1RZKC 2BRRL 4U7MA 3VD3A 1J1XH 4KOCA 4P59H 2Y5TB 3VH8B 5FM5M 4I2XB 1TT6A 3MHZA 5DVPA 4MLSA 4UQAA 3RGVD 3WJJC 3UCQA 4YIQB 5HYEA 1J5OL 4RMSA 2A6JB 3QHZL 4BCZA 1RU9H 1AGDB 3GBDA 1ET7A 2CCVA 4LPWA 2ATPA 2HRHA 3VA6A 3FQTB 5IIEB 2FWLB 5C07B 5DD0H 1KBBA 4X4ME 1DZ0A 4OR1A 4MQSB 1BREA 2FGZA 2ICEC 2NQ3A 3Q3GB 5DJCB 2JKXA 5AAWA 1D5IH 3D12B 4IMKA 4ELKA 5FGCE 5D7LB 4WGWB 5HPMB 2X09A 4JR9H 4UTAA 1E5YA 1ODAA 3WL9A 1TMQA 5H35A 3LPWA 1EPFA 2O1AA 2WQUA 3HG5A 5LJYH 3JTSA 4JREB 1T5WA 5MP6H 4ZG1A 5CMAA 1AGCA 4AG4L 4Q7DA 4MA7H 1MCOH 3ES6B 4BFJA 1KCSH 2DTML 2BIIA 2MNWA 1CURA 4M5ZH 4K15A 2AABL 3L7EA 2WV3A 2GCYB 4F58H 2V2TA 4CBZA 1XGZA 2YD5A 3PXJA 1A2YB 4OLYL 3NRFA 5A2LH 4L2LA 1FBIL 2Y1AA 4AZ8A 1WP6A 3OR7B 2ALAA 3THMH 4G6AC 3SE8H 2YPLB 3LDBB 1MRFH 2D03H 4G8FA 4WI0A 3QIWB 4EDWL 5CEZL 1IRAY 1OT2A 3SCMC 4XPFH 4P3WA 1RI8A 4JDEB 3DVIA 4A55A 1BOYA 4K73A 3D2UA 1M2VA 4M9OA 3BI9X 5IJVB 4A37A 3GXPA 4AEHL 3IJSA 5C9KA 3F05A 3ZDZB 2BINA 3HI1A 1TOXA 2ITCA 3NCYP 1ACYH 2MEJB 4XP5L 1RZJH 4OB5L 3NFSH 2NQCA 1A6VH 2Y5TA 4H26B 3VH8A 3LH2H 4I2XA 3TC9A 4KHTH 4YIQA 4PJFB 3EBHA 3NH7H 2A6JA 5D1ZC 4HG4K 3O4OC 1TQVA 2NY3B 2E7DA 3VXRD 1AGDA 1YDPB 3ARRA 4G6KL 3U48A 4EZLA 3VCLB 2G30A 4ZMOA 2FATL 1FO0L 2BFVL 4OLUH 4YHOL 5KWYC 1U3YA 4OW6A 4Z7OB 1NMBL 3FQTA 4OGYL 5IIEA 1WUNT 5C07A 2GJRA 2YA1A 1L9PA 1WWCA 2O5NA 4RSVA 3WFZA 4XC1H 4OJFH 1GOFA 4R5VA 3Q3GA 5DJCA 5EA0L 2NMSA 2NXZC 2WTPA 4B5EA 1A9EB 3BH4A 5D7LA 4GRLC 4HMCA 2HMIC 3N04A 1ZK5A 3B56A 3CHOA 2VC2H 5K59E 2BCKB 1KJVB 4HUMB 1UC6A 4DP6X 1BHGA 3N42B 1G0YR 1VFBA 1M3JA 4ZMPA 1MHPH 5F0JB 3EFOB 3ES6A 3POCA 2DBLL 3NFPB 1PW3A 3MCLH 3DJSA 4O2CB 2GCYA 1RHFA 1A2YA 2OYKA 2G5RA 5E99L 1S7TB 2XX0A 4EN3C 1A4JB 2DZEA 5E03A 3OR7A 1EEUA 2IGLA 3Q2VA 2ZJSL 2YPLA 4XN8A 3W56A 3GUTB 4W9FC 3CDZB 2VDKB 3QIWA 1XT5A 2CNZA 3EOBB 3OMNB 2DKMA 1FSKB 4H4NA 1EO7A 4JDEA 5DFAA 1THCA 1E2WA 4KKCC 1CTMA 3VD0A 3II2A 1OGTB 3IXTB 3ARED 4EKJA 5IJVA 2V8LA 1Q9KB 2R0LH 2A9ML 3LVEA 3D4ZA 4MXQC 4QXVA 1IC4H 1G1KA 3GKWL 4OJAA 1PF3A 1MCPH 4YDIL 4H26A 4ACTA 4M5YL 1HHKB 3FAWA 2EYTB 3PP4H 3UGUA 3VTMA 3QXAB 2F68X 3HBPA 3GWJA 4NQVB 2SEBB 4ZFOB 4PJFA 5AWNL 3NIGF 1Z1WA 1CYXA 5KUKA 2EUZA 2VQ1B 4B60A 1JG9A 2WAQA 1YDPA 4YDZA 8FABB 5E8EB 4XPTL 3VCLA 1LO0L 1VERA 1JPST 2XZQL 3NQKA 2NXYC 4V2BA 2ZWLT 4JQIL 4HAFA 2VJ8A 4PJ5B 5J0BA 2QTEA 4HMDA 3BKYL 3LH8A 1UOLA 5FOBB 2Z93B 5C2BH 1FN4B 3CVIL 3T4AC 1BYNA 4UV4H 1W0YT 1A9EA 2VKXA 5L4FA 1KXQA 1T6BX 2CPUA 1ZLWK 3AT8A 2BCKA 2DQDL 1KJVA 1KIPB 3CDGB 4HK3N 5T5NF 5GRXG 3OC8A 4XE0A 4AJYV 1L9QA 1DJYA 1NOAA 4PYHA 1M71B 3GPEA 2UV3A 1ADQH 3CFKB 3PGFH 2YEZB 3EFOA 2KC0A 3VW3H 1IGTB 3LN5B 3U4EB 3NFPA 1MCJA 3UACA 2P52A 3T2PA 4O2CA 2AHIA 3K6SA 2WW8A 4PRIB 1SN0A 4NQED 2BWIA 3SGJA 1BJ1H 1KBVA 2GY7B 3C6LC 1S7TA 5H8DA 2WLNA 4RMQA 4U1GC 1A4JA 5K93A 4P0DA 4KFZC 2YMOA 3SD5A 3GUTA 1BW8A 4J5VA 4ZMNA 1H5BB 3CDZA 4FLHA 3EOBA 4JM0A 3EOTL 4NZTL 1TR7A 4ODXB 5DC2A 5BW7A 3MGAA 5CCGE 1Q72H 1OGTA 3IXTA 2BVPB 5CZXD 5C0RL 3UTSE 1F1DA 1Q9KA 3OSVA 4P2OC 1H3WM 5DYFA 3HB3D 1KULA 3H54A 1MUJB 1DEDA 2EDJA 3MZTA 3S35H 2V3DA 4AQ1B 1G7MB 4A6YH 3SBWA 1CUOA 2R59A 1HHKA 3MRMB 2BNUB 1O0VA 3AG1B 1ZMYA 2EYTA 2C8NA 5MEQB 4NQVA 2SEBA 4ZFOA 4E41D 4G8GA 2VQ1A 2ZUVA 1MCRA 1RPQA 2DF3A 2I32A 5DUBB 8FABA 5E8EA 5BUAA 3L4ZA 3LB6D 2K1MA 2QKSA 4PJ9C 5F2FA 2JKLA 4JL2A 4UAOC 5KTEH 1XR8B 1UD6A 1QEWB 2XN9B 4J3SA 4WK4B 1L5GB 4ALAL 1AXSB 4Z7NB 4XZ4A 4PJ5A 1D2PA 3ZTJH 4E9TA 1AHWB 1NBYB 5IBUB 5T3XD 2EH8L 5E4OA 2DM2A 4TQIA 1F0LA 3FDWA 2QQLH 3NACH 3F5WB 3SBRA 5FOBA 2Z93A 1ZIAA 1FN4A 3F12B 4F2ME 1WIPA 4YH6A 1DVQA 1G6RL 1CL7H 3NIGE 5GHWL 5KG9A 3IMBA 3CDGA 1KIPA 2QQNL 4E9XA 1EAOA 1M71A 1XIWC 3KWVA 3CFKA 2YEZA 4WCYH 2G2NA 1UH3A 3LN5A 3ZPDA 3IBOA 1RAMA 3S37X 4KZDL 1IZJA 4PRIA 4N2KA 2CU9A 2AMGA 1GL4B 1QLEB 4L3AA 4DAGH 4TNFA 3VXPB 1QFPA 3ILQC 5IFHH 3B1TA 4NN7B 1M7XA 5ICZB 2ZYIA 1H5BA 3RWDB 2ZX7A 1WBZB 1NAMH 2Q3ZA 2VW7A 2WQAA 3NCYS 4ODXA 5AKRA 1NCAL 3MRHB 1F4XL 2YN3A 2BVPA 3MXVH 3QISA 3FU6A 3SE6A 4DN3H 2VDLH 2CG9X 4P04A 3LPGA 4UNUA 1HL4A 1MUJA 1MW0A 1E8XA 2H8PB 1AQKL 3CFCH 3VRJB 1T66C 4NM8L 4UAHA 4ECNA 1NGPL 2DI7A 2JCWA 4AQ1A 4RGNC 1G7MA 4WO0A 4LOFA 3MRMA 2BNUA 3WXVH 4FFZA 4TUJB 1RLBA 4BRVA 5MEQA 3AQZA 3GI9L 4M6OL 1NGXB 1ROWA 3BRGC 5DUBA 4ERSH 2ENSA 2QFRA 4WY7H 1IT9H 4GKLA 2HXAA 2BH0A 4M62H 3HNVL 4LOUC 3WFCH 2CRZA 1XR8A 2XN9A 1QEWA 5F6HI 4L3EB 3DJTA 1L5GA 1D3CA 1OARH 1AXSA 3OPZH 2FIRT 3W82A 1AHWA 2EJ1A 1RIVH 3UABA 3CHRA 1QASA 2H0JA 3QHFL 2VZ1A 4C83B 2C34A 1R5WB 3F5WA 3F12A 1UXLA 3CBKB 5BV7B 1UKSA 1J1PL 5EHFA 3P40A 4P48A 1E50A 4BIKA 2X1PA 4QHMA 5HDQH 4NO3B 3MLXH 3QZNA 4Q97A 4WTQA 3EJYD 1QYGL 1LWJA 5AVYB 4EDXB 1BF8A 4PD4J 2JJSA 5C0CD 1JTOA 2W91A 4AV0A 1BGXH 1YY8B 2RBLA 3DUUB 4ZMXA 4CN6A 3CMOL 1BXAA 1EJ8A 3HAEB 4ADIA 1U21A 1E43A 4KZCA 4KO7A 4RQQB 5TE4H 3VXPA 5FGBC 3VG0H 2QVIA 1R4XA 3RKDD 4ETQB 3KPTA 4WUUE 3RWDA 1DTUA 1CICD 1WBZA 2WBJC 5FW8A 4MJ5A 1IBGL 3QUGA 4OCXH 3VXSB 4IDJH 3U1SH 3MRHA 4Y16B 4GEJA 3VFGL 1H3UA 2ZWKA 5ADPL 2IALB 3V6FB 5AW3B 1WD8A 3QRGL 4K94H 3BWUF 4HCRA 5D71H 1PEWA 2UZIH 2H8PA 2XCMC 3VRJA 4KZ0A 2Y07H 1MJUH 3FQNB 4IBWA 2QADB 2X28A 3QWRA 5IREA 4QOKE 2A5UA 2A6DB 3FUNA 3JV5A 4PRPE 1J8KA 3TCTA 4TUJA 2IH8A 1GYVA 3WI9A 1G7JB 1F1AA 1T22B 1NGXA 4APQC 1TDQA 1ZE3H 3AVEA 5KSBF 1E6JL 1GRWA 1BQKA 1P9MA 5JNYB 4O2EB 4PRHD 2KDYA 4HJUA 5KSAC 2A9CA 1L7TH 2VN7A 2LTQC 2A77L 1J0KA 3GPSA 4L3EA 4UT9A 4YO0B 1E28B 4AM0B 1EZUA 3N41B 3SB3A 1Z3GH 5JA8B 4C83A 4QDGA 1R5WA 2CLVB 3QUYD 3DHMA 2HYMA 1D6EB 1N7MH 5FYKH 4UMGA 2AQQA 4ENEC 3UZEA 3NA9L 1QZ1A 5F44A 4NQXB 1CGYA 4ICWA 3VI3A 5GS0C 4NO3A 3O9WC 1KYFA 4OJEH 3WNLA 4IKJA 3J07A 4EDXA 2ZUUA 4FQ1H 1XBDA 4PW3A 5DD1L 2W59A 1K3IA 1GGBL 2VDOB 1YY8A 4W9LC 4AE0A 3DUUA 1LMIA 4DP0X 1UFUA 5KVFH 3HAEA 1TTGA 2QGDA 4A63A 1U8OB 5HI4C 2W5PA 3WFEL 1TZOA 4WKZB 3KJ4B 3TA3B 1UOKA 1FFRA 1MCQA 4ETQA 3QPQD 1DBAH 4XCCH 1Z66A 3RHWK 4NQDE 3DX2A 5CN1A 4NUGH 3VXSA 1W6WA 1BJ1J 4HDIB 4UUJB 3TJHD 4Y16A 1B0WA 3NT0A 3X3FL 3WUWG 4N0YH 2IALA 3V6FA 3WN5A 3MJ9A 5JXAH 3TO4B 1MZYA 4ONFL 2WIMA 5GSVB 2ZSVB 3ALWA 4KH2A 3T08A 4PP1C 5F9DC 2J1KA 1KB9J 3LZOA 3G5VB 3FQNA 4BRJA 4HHWA 1E9OB 2H6UA 4TULH 3VA2C 1MG3C 4LDEB 3WNOA 4W9EC 2KYIA 2A6DA 2N1TE 3PUUA 4GO8A 4K8RL 3ZIMA 1H9DA 5C0BE 3QQ3B 2FX8H 4WAFA 3D30A 2KPNA 1G7JA 4G2AA 4G5ZH 3B7YA 4NUQA 1T22A 5CIPH 3T9WA 2QJDA 5F9OL 4JFVA 3TM6A 3WSQH 2BVTA 4LCCB 5D96B 5JNYA 1HCFX 4O2EA 4MB5A 2GI0A 3T4YB 4NUJA 4KXCA 3H7BB 1P84J 2G2RA 3MRRB 1PKQE 3TT3L 1V3MA 4YO0A 2LR4A 3TLRA 2R4RL 3OD3A 4AM0A 2VM3A 1IAKB 4Y4FD 1F00I 2R2BB 4FEIA 4P23C 3PQYB 2EH7L 4JFUA 4PGCB 4YSUA 2B8OT 4MS8C 2CLVA 2ZWYA 1R5VB 1D6EA 1I85C 4AXWB 3H9YA 1OM3H 3EO9L 3SE4C 2YBGA 3DETD 3O6KH 4FJ6A 3QNZB 5JHDE 1YEFL 3NABH 1E4WH 5E1HB 4Y4HB 1WLHA 1WC7A 2OTPA 2GFBB 2F54E 4HXAL 3D87B 4LCWE 4LL1A 4PCYA 3SYAA 3B9KD 2VLRB 5C0IB 5IQ7L 3Q0HA 5IHWA 4LHUB 2HTLC 3AQDA 4LHJB 1B4JH 1I3RB 4B9PA 3Q01A 3U4BH 4N6QA 3QXVA 1UH4A 3P0VH 4CMHC 5CF3A 2BCMA 3VFOB 5JPNA 3GZKA 3SGDH 4AJVA 1PGRB 4WKZA 3QQXA 5DURD 4Z76B 3TA3A 4IKLA 2DOCA 4XMVA 4F80A 3RZCD 2NDFA 5JQHC 3C8HA 1JXFA 3A6OA 5FGSA 1F11B 4HDIA 1HWWA 3WDJA 3C60C 2JI2A 3OKKB 5A3IC 4P9HH 4P07A 2A3TA 3GQFA 4Y19B 5EIIG 2KZKA 3DXAB 3TO4A 3WFHB 2PO6D 5GSVA 4KXAA 2ZSVA 2XZZA 3KDPB 4BD4A 2HSIA 3G5VA 2J7LA 2WXMA 4DZ8B 4HWBL 1E9OA 3RLSA 1WEJH 2FDBP 5C97A 1HCZA 1HL5A 4Y2OB 4A7VA 4N87A 4U0RB 3QQ3A 4U7SA 2R1WB 4N2AA 2P5WD 1XTMA 3MLTB 4LCCA 3QZPA 1MSPA 2ZAIA 1NFAA 4QXGH 4KJQC 3EAKA 5JW4Q 4GRWF 3T4YA 4S0TD 3G5XB 4QMEA 3H7BA 4YXLH 3MRRA 4QTIL 4XAWL 3JUYA 3E80A 4C4KO 5DS8B 1IAKA 2R2BA 3PQYA 4PGCA 3SJVB 1OCRB 3GIVB 2WPGA 1C7SA 1UWXK 3FB6B 1CLZH 4P57B 2V2WB 3Q44A 2OYLA 1R5VA 4BZ2A 2V9TA 4L0ZA 4AXWA 2XI9A 4Z3TA 4Y5XC 2DLIA 2EABA 4M3KB 3QNZA 4G71B 1G4RA 4KX8A 2OXGB 2VQUA 3IN0A 4BUGA 1QHQA 2FJFB 4Y4HA 2Z65C 3OG6B 1XGRB 2GFBA 2MQGA 5H4ZA 4KX9A 1T03H 4JPSA 4OD3H 2VLRA 5C0IA 1G7PB 4PJFF 1MFAH 4LHUA 4W6YB 1U4EA 4X0KB 4YHKH 2GITA 2WHVA 1I3RA 2DLFH 5JYLA 1MRDL 3KYKL 4HBCL 4WFHD 2NUPB 5I5MA 4PJHB 4AC4A 3VFOA 4LCIH 1X5LA 1W0VB 2BP3A 3C2AL 4NKIH 3M7FB 1T0NB 2A9NL 4ODHL 4Y8AA 4Z76A 1ZGLM 4XMUA 2AXJA 2O6CA 3SOBH 5FUOH 3TCXA 1FGVH 3RNKB 2JJTC 3V55A 3Q8BA 1NIFA 1LP9F 5LCVL 1P1ZB 4AW7A 1F11A 4O2FB 1FNEB 3OKKA 4Y19A 4H20H 3CQFA 3DXAA 4PJ7F 3TH4T 3VM5A 3WFHA 3E6HA 4UQ9A 3U7YH 4FZEL 3QEUB 3UTTB 3IAQA 4DZ8A 1JWMB 2A74C 3Q05A 4UQCA 4Y2OA 1P4IL 3K2MC 3IGLA 3DPDA 2Q10A 2R1WA 5FCUL 3WTSA 1V55B 5MI0C 3MLTA 2GTZB 5F70A 3SDDD 5I8OL 2FBRA 2ADFL 5FYLL 3KGRA 1QTSA 1NDMB 2NY6B 2PPEA 2Z34A 4JS7A 1AR1B 3G5XA 3A47A 3M07A 4ES8A 1H3PH 1RZJC 4H8HA 1DYZA 5BZXA 2MSPA 5DS8A 4JQXC 1U8IB 4NCDA 3TCLB 1DQQB 4NB7A 1D9KB 4H0HB 5LBGA 3LRLA 3GIVA 5EO1B 3SJVA 1A3ZA 3FB6A 4UIKH 3O6FB 5EU3B 1RH8A 4P57A 2V2WA 3MLZH 3VMOA 1F4HA 1S7VB 4TRPL 3LD8C 4B95C 1Z9SB 4NYLB 4N2OA 4RNRA 4LVOC 4PJ8B 2CKBH 1ECYA 2OXGA 2R9HC 3FOMB 2R56L 3O4LB 2FJFA 3RI5F 5DD5H 1XGRA 5G5DA 1N0XL 3S88L 4GRWE 3O11B 4FQXB 4Z77B 3LIZH 1Y07A 5GRUL 1BQLH 2YZ8A 4X0KA 1S9KC 5I16B 2XV3A 2NUPA 1BFOB 4NPJA 1KTBA 3EBIA 2X4UB 4I89A 4S1SH 3M1BB 4PJHA 5CCJA 1W0VA 3LSOB 1T0NA 1K6QH 3OZ9H 3BISA 4CN4A 1KCKA 4XMXA 4NQCD 3RNKA 2E9JA 2X53A 3K1KC 4HK0B 3BIBX 3LCYA 3MRIB 1P1ZA 2BIPA 1OSPH 4O2FA 2B4CH 1FNEA 5DZPA 4RETB 4KROC 3U83A 3E9TA 3QEUA 3FN9A 3UTTA 1SBSH 4JRXB 2OULB 4A2HA 1X9RA 4FXGC 4P2AA 1C9SA 3ARXA 2PWHA 2OMYB 2ICCA 1DBMH 1PD1A 2YMTA 1FI8C 4F92B 1BQUA 5I9QC 4B5ZA 4NFBA 2GTZA 4X9HA 4XN1A 2Q3AA 4B9IA 1LP9E 4Y2DD 2XG5B 2B5IC 4PR5B 1NDMA 2ZUSA 4N5ED 4FXKB 5GGVL 4MQXD 5L9DH 2WKOF 2VN6A 3T0ED 2VNCA 4PJ7E 3F84A 1FO0B 1RMFL 2PR4L 3A67L 2WZPA 4MA3B 3K6SB 4KPHL 1KEMH 1UUSA 2RD0A 1U8IA 3ARFB 3FCSB 1DQQA 4HYTB 5FUZL 1D9KA 2MOQA 3TCLA 2IAMC 2AQ1A 3K6FA 4YSEA 1CVRA 5CJQH 4DGIL 4KKLD 2OYPA 3O6FA 2KQNA 4WZ9A 1A7OL 5EU3A 2H32B 4O9HH 1N3NB 3K72B 4R5TA 1KIQB 1S7VA 5DJ0B 1Z9SA 2VQTA 2DMCA 5DR5L 4NYLA 4N2IA 1S7WB 4P2RD 4PJ8A 4M7LT 1YYML 1HDMB 5D7JB 4UTBA 4U1SB 3FOMA 1HKLL 3DI3B 3O4LA 1N0LB 4DQOL 5ICUA 2Z31B 2YD2A 2VLKB 4W6WB 1A25A 4IOFD 3QJOA 5JXEC 3NAAH 3O11A 4FQXA 3T3MB 4Z77A 3TH3T 2HFGL 4F27A 1PLCA 4TF4A 2Q8AL 2KDGA 4LPXA 3PHAA 3CBJB 3ARBD 4BJLA 3TFKD 1GZHA 3KLDA 1BFOA 3EYQD 2X4UA 1E8WA 2B15A 3M1BA 4ANKA 3EJRA 3LSOA 4G7SB 4YHMH 3KPRD 3US0A 5FYJH 5B39B 2Y2TA 2D73A 1KSRA 3BT0A 2JKSA 4NX0A 1BIHA 4QRFA 3Q43A 4OZ4B 4HK0A 4K7PH 3MRIA 1S7UA 1TZGL 1KYOK 4Y4KD 3QFGA 4NWTH 4GO9A 3SZKC 3ZDYF 1CFNB 3PL6B 2E0PA 4GXFA 1JZJA 4NXKA 5LBSA 2CGRL 4XNYL 3U7WH 3VWKC 1UZGA 1OO2A 2EVIA 1A21A 4XX1E 1DQKA 4JRXA 1G9ML 3LNDA 4RX4A 5GZNC 7PAZA 2OMYA 2MFNA 4HHGA 2D8KA 1VGKB 1VJSA 3WO4C 2GSGA 1MFVA 3NIFB 1QWNA 3VJ6B 2F7OA 3JV4B 3QIBB 4I5BB 4FC3E 4XCYA 3V9CA 2XG5A 1NMCC 5C09B 2QZQA 4PR5A 4XOBA 1XGYH 2WLLB 4LDCA 3M1OA 4FXKA 2CUIA 2O6FA 4HS6B 4PBVC 4E41E 5L4JA 5CU5A 3UC0L 3HG0A 4FNPA 2H0PA 1FO0A 2XOTA 2DQEH 43C9B 3CN0A 1ITCA 4MA3A 1QSEB 3BW9B 3CN4A 4TN9A 4ZS6D 3FCSA 4BKLB 5JHLH 2IDUA 4M93C 1UB5B 1UXMA 1FV1B 1CD8A 1RERA 4K9JA 1FIGL 2H32A 4MAYB 1N3NA 1U8NB 3K72A 3BSZA 1KIQA 5DJ0A 3QNYB 5T3XE 5AZ2H 5EEWA 2WCSA 1S7WA 3GT6A 3JWOH 5DYOB 5LN8A 1YA5A 2AEQL 1HDMA 2ILLA 4R7LA 4U1SA 2EKJA 4OF5A 5DQJB 3RE0A 1N0LA 2OX5B 1A7QH 1CFVL 1RUPH 3L9YA 2Z31A 2QSVA 2VLKA 2OZ4L 3PHSA 4P46D 1R19A 5LB1A 3KPNB 5FDWB 3U6XA 1MFUA 1LK3H 4U6XB 3NP3A 1A6UH 3L6FB 5HHXL 1AJ7H 1XZ0B 1M42A 2XJKA 5HD8D 2C26A 4JGNA 2JLLA 5CR8A 5E5MB 1NIDA 3TWCL 3UL4A 4KRPD 2MCAA 1NCWH 4TSAL 2ZX6A 5B39A 1ZT7B 2HUHA 2YQBA 1P6WA 1BM3L 1XB8A 4P2QB 3BP4B 4OZ4A 4KITB 5L8KB 4UTAH 1DJSA 2Q86B 3B9DA 3ZGIA 2I07B 1CFNA 1KCUH 2APBA 5F7EL 5B7MA 3PE9A 1AC0A 4KMTL 3N0AA 3KBHE 3VI3F 1MFBH 4L9LB 3ATDA 5BMFL 2H1PH 4WENB 2QSCL 3QXTA 2FLRT 1U8PB 2BNRB 2IGFH 4QHLB 5EUOB 1BFSA 2ZOKB 4BFGA 1U2YA 3VGFA 3WTTA 1Q90A 3OV6A 5B1JA 3MOBH 3BRFA 1C5CH 3COOA 3M86A 1VGKA 5EZPA 4R8WH 4P5RA 4MAUH 5I15L 3VJ6A 1J88A 2EE6A 3JV4A 3QIBA 4I5BA 3GHEH 1CFMA 2E56A 5ILTH 3QIUB 2LGNA 5C09A 5JW5B 4M8QB 2P49B 2WLLA 1CD0A 4TNVF 3ZDYE 3B9KC 4AW4A 4HS6A 3RWHB 1URZA 3LTVA 1VGEH 5EBWB 4GOSA 3ISWA 4DIXA 43C9A 1M57B 1CJYA 3WAJA 3BW9A 3ABZA 4BKLA 3MUHL 1OTUD 2IWKA 1UB5A 4N3UA 3C5ZD 5GS1C 1FV1A 3O2VH 3D51A 1BDYA 3P73A 4XTRC 4MAYA 1U8NA 4PS7A 4RZCB 4JFEB 4ICXA 2WTOA 3QNYA 5GZOA 2NR6D 3QWOB 1IGCL 2P48B 4NZUH 5DYOA 1F02I 5DQJA 4HJSA 2YRPA 2OX5A 4D0DB 2O6DA 4O00A 3V5KB 3T0BA 1MWAB 3H6JA 2QQKH 4A7GF 2OL3B 2MPAL 1Y1UA 3ATBA 5FDWA 5E00B 5MERB 3FB5A 1CD1B 4U6XA 4XPAL 4FZ8H 2IWGA 2CE6A 3L6FA 5DWUL 5C0CE 1K8DB 4JCMA 1XZ0A 2AMUA 5KSUB 1M53A 4B97A 1XH1A 2OJZL 1MREL 3WBDA 5E5MA 4FA7B 4KDWA 5FO2A 5LUMA 1WF5A 1ZT7A 3N41F 1WHOA 2ZF9A 1UYWL 3U2JA 4HH9B 3OF6D 4IIZA 4WFGE 4P2QA 5AVRB 5TE7H 3BP4A 4FKKA 1MFMA 4I85A 4OM1L 2Q86A 2I07A 2VDRL 3I6SA 2YAPA 5DJ6B 1LEGB