1KDIA

Reduced form of plastocyanin from dryopteris crassirhizoma
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
102
structure length
102
Chain Sequence
AKVEVGDEVGNFKFYPDSITVSAGEAVEFTLVGETGHNIVFDIPAGAPGTVASELKAASMDENDLLSEDEPSFKAKVSTPGTYTFYCTPHKSANMKGTLTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure and unusual pH dependence of plastocyanin from the fern Dryopteris crassirhizoma. The protonation of an active site histidine is hindered by pi-pi interactions.
pubmed doi rcsb
molecule tags Electron transfer
molecule keywords PLASTOCYANIN
total genus 22
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 1998-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1kdiA00
3DIVA 2QT6A 1OE3A 2YAQA 4GP5B 2GSMB 2VW4A 4M3HA 5IY5B 4G7RB 4KOBA 5ANHA 1V10A 4KO6A 2PP9A 1NIEA 1XB3A 3SQRA 3V9CA 2P80A 4JHUA 3BVDB 2H5UA 1SHWA 3WNJA 2H47C 2RACA 3OMNB 3FYIB 3S3CB 4JKNA 4KO5A 4F7KA 1BXVA 2DYSB 1L9SA 3GYRA 2DWTA 3H4HA 3N55A 1OOWA 1A4BA 1ZPUA 2BP0B 3HB3B 1GW0A 1AIZA 4DP0X 2GHZA 3X1BA 4YSDA 2UXTA 4HCFA 2VMJA 2BP8B 3AY2A 2J5WA 3HEIB 1ZIBA 1A65A 4YSPA 2XU9A 2I7SA 2BW4A 3ABKB 4G71B 2UX7A 1OCRB 4HZ1A 2PPDA 1M56B 1NIBA 3IEAA 3X1FA 2CAKA 4KOCA 2FNWA 1ET7A 1F56A 4WKXA 1HAUA 4A2HA 3NJIA 2AZAA 2H3XC 1IBYA 3SBPA 3UADA 4KNSA 4HAKA 1ILUA 2EIKB 2YAFA 3OD3A 1NWOA 2GC7C 4N4YB 1B3IA 2EILB 6PAZA 2HX7A 1JXFA 1HFUA 3H56A 2VSMB 2B08A 2UXFA 1QLEB 1SFDA 4NB7A 5I6LA 2FQFA 5I5MA 1GY1A 3UAAA 1PAZA 2GBAA 3H4FA 1PMYA 4E9RA 2QPEB 2IDTA 2XX1A 1GS8A 5I26A 2X88A 3EH3B 2QDVA 4DPBX 4KO9A 2A3TA 2PP8A 3NJGA 2YAPA 3AG1B 3T6VA 2OJ1A 4F2EA 1IBZA 5I6KA 5I6MA 1AZRA 1RKRA 3CDZB 1BXUA 1OCZB 1OF0A 4HHGA 4UF7C 3IN0A 3X1EA 2VSKB 3NYKA 3FU8A 5PCYA 1A3ZA 3NT0A 4BWWA 3NSFA 2I85A 3QJSB 2IDFA 1JXGA 2JXMA 2BP0A 4P5RA 2ZOOA 3S3DB 3IE9A 4RH4A 2XXGA 2HRGA 1GY2A 1NTDA 1SNRA 1JZIA 5TK2A 4X4KA 1QNIA 2Y1AA 4HCGA 1AS6A 2IWFA 3X2QB 2HLEB 4GP8B 2J57A 5FC9A 3MX0B 3MBWB 4PCYA 2PCYA 3NJLA 5I5JA 3T9WA 2BHFA 1PNCA 1ZDQA 2TSBA 4N8UA 1KGYE 3V9EA 3NJJA 1OE2A 1GYCA 4DP9X 3WKPA 1OCCB 3FU7A 4DP4X 1AZNA 1M57B 4A2DA 1NIFA 3ERXA 4GXFA 4AKQA 6PCYA 3UACA 4ZK8A 1ZDSA 3AW5A 1AANA 1PF3A 1BQKA 3AG4B 4YSOA 1GSKA 2GB2A 1MG2C 1AS7A 3FQ2A 3X1GA 1T5KA 1X9RA 2FWLB 2HRHA 2QDWA 4E9VA 4YSAA 4HIPA 1I53A 1BEXA 2PPCA 3ASNB 1BYPA 3CZUB 2FT8A 4DP6X 1BQRA 3OM3B 4ENZA 2CALA 3KW8A 1JERA 2XV3A 4YVNA 4CSZA 1PY0A 1WA1X 2YAHA 1E5YA 1N70A 2IDUA 3CVBA 1URIA 4E9TA 2GI0A 1HAWA 2HX8A 1SDDB 1PZCA 1NDTA 2AZUA 2HX9A 1J5CA 1AQ8A 4FAAB 4A68A 1J9TA 2XYBA 2YXWA 4NERA 2TSAA 4JHVA 3NP3A 2EIMB 2EINB 2FQEA 1OE1A 1MDAA 2XVBA 3ABLB 2PPAA 2UXVA 1KBVA 3PPSA 3ZBMA 4UANA 1JVLA 3FU9A 1DZ0A 1RZQA 1TEFA 3SBQA 1NZRA 1TU2A 2XXFA 4G7QB 1L9RA 1L9PA 4HALA 1KDIA 4K9JA 1OV8A 3NSDA 1ETJA 2CUAA 3DKHA 3FS9A 3KW7A 2P80D 1KCWA 2XUWA 4EF3A 1KDJA 1PLBA 4MFHA 4DPCX 4HCIA 2OCCB 1PCSA 2J55A 5I5IA 1WS8A 1CYWA 1EZLA 4E9WA 5B1AB 2FT6A 1JZHA 2J56A 2W8CA 3EF4A 3FT0A 4L0PB 3UABA 1BXAA 1ASOA 2WSDA 2YXVA 2IDSA 4DP1X 1AG0A 1MG3C 1NINA 1PLAA 1AG6A 4QLWA 1XB6A 3X1NA 1NWPA 3TBBA 1ADWA 4BWTA 1MZYA 5B1KA 2W88A 4AX3A 1CC3A 4FA7B 3CVDA 1JZEA 5I28A 1WS7A 2BO0A 2YARA 4BXSV 2YQBA 2JKWA 3EH4B 3FSWA 3S3BB 4E9XA 5D4JA 1SJMA 2AFNA 2GIMA 3ZDWA 2QPDB 4E9SA 1IC0A 7PAZA 1AR1B 2PLTA 4F2FA 4AZUA 4YSQA 3D12B 2UX6A 2BWDA 3TASA 1GS6X 3U25A 5F7AA 4GY4A 3ZX1A 2DV6A 2R7EB 3DTUB 1KCBA 4P5SA 2FQGA 2FTAA 2MRYA 1J9SA 1NPJA 2PPEA 4YL4A 3WIAA 1SF5A 1ID2A 2OV0A 7PCYA 3PXLA 2YAEA 5A7EA 4HHWA 1L9QA 3TBCA 1VLXA 2IDQA 5B3SB 2BW5A 1J9QA 2VM3A 1BYOA 1M9WA 3T71A 1JZJA 5B7MA 2VM4A 1XMEB 3UAEA 3S8GB 1RZPA 1JVOA 4Q89A 3QJTB 5B1JC 3NJKA 3TU6A 1A8ZA 5D4IA 2UXGA 4GYBA 1DYZA 1PNDA 2EIJB 2CBPA 1A4CA 1NICA 1ASPA 4A2FA 3IBOA 4AI7A 4BWUA 3CVCA 4AKOA 2XX0A 3NSYA 4AKPA 4E9YA 1AZBA 5AKRA 2FJSA 2ZXWB 2BZ7A 3FSAA 1GR7A 3WI9A 2E86A 2I7OA 5F7BA 1AZUA 1JXDA 1V54B 1R1CA 1NPNA 3ABGA 4KNTA 4BDVA 4E9QA 2MTAA 2GC4C 3ASOB 4CSPA 5I6NA 2BP8A 1JZGA 4YSTA 4DPAX 5B1JA 3RYMA 1RCYA 4DP7X 3QJRB 2XV0A 4W9ZA 1ILSA 1UATA 2DY2A 1EHKB 2BWIA 2PCFA 3S8FB 3WKQA 3NJHA 9PCYA 1L9OA 3FQ1A 3JT2A 4DP5X 4WTQA 1W8EA 3FPYA 4YVUA 4M4RB 1ZIAA 5B7FA 1ET8A 3IN2A 1X9UA 3NJNA 1A4AA 1AAJA 3T6XA 2BZCA 1BQ5A 4W1TA 1KBWA 4NAJA 4BXVA 1YLBB 3G5WA 3NP4A 2ZWNA 2Q9OA 2AVFA 3PAUA 4G72B 3T6ZA 3AZUA 3OMIB 2DYRB 4BK5C 1FA4A 2PPFA 1E67A 2Y69B 4YSUA 2WO2B 4UAHA 1CUOA 1KV7A 1SHXA 1KYAA 5D4HA 3PCYA 1CURA 4A2EA 1IKOP 3UGEA 2NRDA 1J5DA 5E9NA 1FWXA 1SF3A 1PZAA 3GXUB 5AFAA 3CG8A 3OQRA 3AG2B 1AACA 4QKTA 3NJMA 4TXVB 4A2GA 2ZONA 2IAAC 1AZCA 2HXAA 3TA4D 2YAOA 2X87A 1PLCA 1JZFA 3CDZA 2XLLA 1E65A 2IH8A 3EH5B 1E5ZA 2AANA 5I6PA 2XWZA 1NIAA 3PAZA 1IUZA 2FQDA 1CYXA 1ZV2A 3QQXA 4G7SB 3JTBA 2IH9A 1WAEA 1TKWA 3T6WA 3FQYA 1ET5A 3C75A 3ZIYA 2VW6A 3QPKA 2IWEA 2PP7A 5AZUA 4KO7A 2Q5BA 1MZZA 1W6LA 2IWKA 2CCWA 3WNIA 1WA2X 1NIDA 5TK4A 4A66A 3PAVA 4DP8X 2LLNA 4Q8BA 4YSRA 4YSCA 5I6OA 3N2JA 2CJ3A 3QJVB 5LDUA 1AS8A 1FFTB 4PAZA 2VN3A 3EHBB 3NSCA 3FSZA 5PAZA 1AOZA 4YSEA 3PLYA 4A67A 3AG3B 5B7EA 3FU7B 1BAWA 1SDDA 1QHQA 3FSVA 1N68A 3GDCA 3SBRA 3BQVA 1SFHA 1V55B 2N0MA 3ABMB 1OCOB 3QJQB 3FPXA 1E30A 3OMAB 3QJUB 2R7EA 2WO3B 4GP4B 3WG7B 2B3IA 2YAMA 5B1BB 3L45A 4G70B 2XV2A 4DP2X 2DWSA 2FT7A 5EHFA 1GS7A 1L9TA 4YSSA 1W6WA 2HZHA 1TEGA 1ASQA 8PAZA 3FYEB 1J9RA 2VW7A 1WA0X 1PZBA 4KNUA 3NJFA 4BDVB 1JOIA 2JFCA 1XB8A
chains in the Genus database with same CATH superfamily
2NNAB 2DEYX 2OMZA 3W38A 2OK0H 2DYPB 4OF3A 2VQ1A 4ZTPH 3C09B 1CDCA 1XZ0A 2GK0B 1UOLA 2W91A 2WAQA 3VXSD 5ISZE 1NIEA 4HKJA 4WTWA 3HG0A 3BKML 2YPLA 1U2CA 4RNRA 5CZVL 4KO5A 4AYID 1NPUA 3KHOA 5D7JC 2DYSB 4OLXH 3IVKB 1GRWA 4KX7A 2Z1KA 5DFWH 1KXQE 4I9WE 5MEND 1GKOA 3LV3A 3Q8FA 3H53A 4FKKA 4N0UB 1TZIA 1ZVSA 1SMOA 1WC7B 4PJCA 2EXSA 5HVWA 4HPOL 2LTQB 3IJ8A 2KZWA 2Z35B 1FO0H 2J8OA 5HYJA 1HYSC 4BCZA 3BAYA 1SM3H 4PY7A 1ZGLM 1YNLH 3T2OA 2DJSA 5BV7H 2DPKA 4DKFL 2DIAA 4BSJA 2ZCHL 3G5YA 5CP3A 3IWUA 4G6JH 4NM4L 3ZMRA 3D0LB 1QBLL 4TLKA 4DGYH 5IFHL 1J8KA 2D4DA 3KWVA 3ZY7A 3F7VA 4KKAC 1RJYA 5GRWA 5EA0L 5AVWB 1TJHH 1HXMB 5I1HH 4Y1AB 3MLZH 2DYPA 2YAFA 1I8AA 5IB1B 2GC7C 5LG6A 3QXDB 4C59B 3OJDB 4XMTA 3QDMA 3FU6A 3MFFA 4HJUA 4GRWE 1CXIA 2OXHA 1QLEB 3D69A 4L3CB 4NB7A 4NQSB 4X4MA 2O6EA 4KQ3H 3VB9A 1NCIA 1X7QA 2EUWA 5I6XB 3NACL 4C56B 2A9AA 3RIFF 3JWNH 3EDEA 4FG0A 4OQTH 1GTFA 2IDTA 2VDRH 3L5JA 2HYMA 1BD2E 1NEZB 2V17H 4GXVH 1CT8A 4OKVA 3BH9A 1CE1L 4JB9L 1U58A 5KSBF 2A6DA 1MHHA 4U31A 2Z1PA 5JHLA 5EEWA 3BAJA 4ZDHB 1PG7W 1QSEB 4F1SA 4XP5H 2IFFH 4E42A 2LVCA 1P4BH 2NMSA 2Q7NA 3U2SB 4ETYA 1B4JH 5DO2D 2GIYA 3E3QC 4LLYB 5FO8B 2IFFL 1E50A 4IRJA 4PJFE 2ZOTA 1P7BA 4KAQL 2BVUA 1KEGL 4LNRB 4RH4A 1JNHA 1VFMA 1E2ZA 2CDEA 2BNRE 4KK6C 5CGBA 3EH1A 5C0IB 1OTSC 2W0PA 2VLLA 2L04A 3LRHA 5JW5A 3NK3A 2EEBA 4EKJA 3D2TA 1SXAA 2CHWA 5DJDB 2F7RA 2Y36L 3CIQA 5FC9A 5T5FA 1BF5A 3HW7A 4YXHH 3L3OB 3KWUA 3CE1A 2FSEB 2OX5B 4AYGA 5B38B 1SY6H 2WJ7A 4HS3A 4JGUA 3F6IA 4P5TD 3REWA 5IVXE 3IMVA 4LSTH 3OR6A 1X9QA 1JXKA 4X0NA 4FFYL 1H15A 2D03L 4L05A 4K15A 4LLDA 4J6RH 1LYQA 2WZ6A 1I9IL 1YY8A 4Y16C 1X5LA 1OM9A 4Z7UB 2R0WL 1XF3A 1MFEL 1AO7D 5ALCL 3UZQA 3PP4H 1GGBH 4H40A 1NOFA 3VXMA 3RGVB 4F57H 2L7UA 4J4PD 2OZ4L 5F96L 4JW3A 3OWEA 4TNVF 5EULV 2W0FB 4MNGB 3THMH 3PWNB 1TUPA 5EC1A 2V8MA 5MP6L 2R1XB 4YNYB 1EZVY 3BPCB 3GXTA 2HG5A 3EDJA 3CN0A 2Y22A 1NLDL 4PJ5A 2IQAB 4WCYL 1D9KB 2PO6C 2OTWB 3NA9L 4FQ1H 4O02L 3BZFB 3KPOA 5JXEC 3RFZA 4RBPK 3LPPA 4MJ5B 1GAFH 5C0NC 4HS3B 4UQ3A 1ZLWH 4Z0BH 2ZX5A 1JMXA 3SY0A 2QFRA 5GPRA 1PYWA 2EDBA 3HMWL 1AD9A 4OCXH 5E2VL 4LSPH 3V5HA 3KVPA 3RNQB 1QLFB 1A0QL 3LN9A 4QHMB 1CZ8L 4GRWF 3NCWA 3T8MA 4N28A 2QLVB 1M7IB 4D9QD 1UWXK 1J0HA 4Z77A 4TVPL 4CBZA 5C6TH 3RUGA 1W2KT 1HWGB 4NZRH 4WW2C 2XUWA 3U36B 5GRXG 2YGOA 5M7QA 4L9DA 1KULA 2UY7A 3O2WH 3VXTB 4PGJA 5JR1H 4I3SL 1J87A 4JQIH 5TFSL 2WVTA 1OF2A 4IEFA 4E9WA 1MWAH 5D96B 1RK1A 2CXKA 2FZ3B 2VLJD 3EJQA 3MRFB 2YXVA 1GHFL 5HVHC 5EBWA 4P2QE 4N0CD 1OW0C 4Y4FA 1N5AB 4Y2DB 3SE6A 1EO7A 1FN4A 5KYWA 1CXHA 1CC3A 2E8ZA 1I7UA 5EUOA 4HWBA 4MA7H 2CO2A 2ERJC 3FSWA 3CU7A 4ZUTB 4XNBA 3DWTA 4Y5YA 1FNEA 3PUCA 4XPGH 1CD1B 2EEXA 4M8QA 5C09A 2VMCA 2YPLD 2PLTA 3PL6B 5HDQL 3K2UL 3CC1A 2UX6A 2AABH 4L1LA 2EE3A 2WXGA 1MFUA 5BUPA 1NBQA 3D48R 1CWVA 2WTPA 4GAYB 4V2CB 1AY1L 3SQBA 1ECYA 1MCEA 4ZPTB 5E51A 3KPOB 2WWKT 3RFZB 2MRYA 3MRRA 4WU7B 1MCSA 2VIRA 5C7ZA 1YEDB 4PJXE 4OZFB 3SN6N 4FNUA 4HGWB 2XC8A 3LDBB 3D4ZA 1KIPA 3VFSA 5B4MC 5E2WH 2VN6A 2WNKA 3NIGE 2WQ8A 1V8HA 2D03H 3EGDB 1JF1A 3PHSA 1RZGA 2PO6A 1LD9B 3FFCD 4X4ME 1MRFL 2FJFB 3LKPB 1XF2B 3QJTB 1KELH 3NJKA 2DJUA 1SRDA 4OGAD 3IBEA 5TDPB 1JHTA 4IGBA 2DQDH 5D2NB 2EIJB 2G2PA 4NP4H 3AGVA 4NNPL 1OZUA 2AP2A 5ID1B 1PTZA 2F54E 5C07A 2AK4E 4TQEL 3CVCA 4FFWD 2YA0A 5F88B 3VG0H 5AKRA 1CLZL 2BH0A 1J5HA 4GSDL 4N26A 1KB3A 4JRYB 1NCJA 4DZBA 2ORBH 4WW2B 5HHXL 4Q9QH 2DD8L 2VL5A 4RX4A 5E8NA 4YDZA 1NFDB 3CVIH 5FUZL 2VLME 5KWYC 3A0OA 5E2TH 4DPAX 5FO9B 3FUNA 3B2VL 4DP7X 4GBXD 1F00I 1BFSA 5DUPH 1MIMH 1KPRB 1O7SA 2VDOB 1IAKB 3UBXG 5F7WC 4Z7WF 2EZ0D 3N5AA 1M71A 1EHKB 4X5XA 1G0YR 4JANA 4RDBA 5IMOA 4P4KC 4D9QE 2CH8A 2XN2A 4UQ3B 5D6CA 5JQ6H 5A6IA 4TSAL 4M7KH 3FQ1A 4G5AA 1W8EA 1GYWA 4JG1L 2FJGA 5D7IE 1D2PA 4QF1A 3WEAA 1WIOA 2CU9A 3AS2A 1ZLVH 3OXSB 5IWLC 2G0KA 1OSPH 4TYUA 1NCNA 4NO0A 5GS2H 5J6SA 3BLKA 5JHDD 5AW3B 3LIZA 2AV7A 3PAUA 2DYRB 3V6OA 3NEXA 2ICWA 1BW8A 5TF1H 4OF0A 5FYJL 3FN9A 3SKNB 3R8QA 3VFUA 1OD7A 4M6ML 3FRUA 1K85A 4LASL 1J5DA 5M94B 2WWNA 5SWZE 1TJHL 5B1CA 5HHQB 1C08A 4OLVL 2Q3ZA 4D7PA 5EIQA 4XPHL 1G7MB 3ORJA 3CAFA 3WXWL 4EXKA 3U7YL 1KLUB 4LLWA 1MJ8L 1BBDH 4NENA 4TNWF 5EZIH 3DX0A 4X6DB 5DFVC 1VFAA 2VO8A 1D5ZB 1UD6A 1Z9OA 3FUKA 2HAZA 3ILQD 2BDNL 1S9WB 3DK0A 5FK9A 2OYPA 1I1YB 4CN1A 2B5IB 3CSYB 2X87A 3P73A 4JFFB 2XLLA 1VCAA 2R0KH 5JXEA 1P5VA 3KBEA 3NCJH 4C56D 4GAJL 4MRBA 25C8L 2B4CL 3A6OA 4LEEA 5JPMB 1JFQH 3VFNA 1WAEA 3B7YA 4XNZC 2ICWI 4URKA 2E46A 2Y2YA 2QKSA 3CLEL 2EO9A 5HHPA 2FX9H 2J6EH 4F2MB 3ILPB 5DRWA 5BVJA 1SBSL 1FZJA 1UXWA 4PVNA 4OLUH 1PSKL 4R6UA 2X6AA 4L8BB 3QS2A 5T1LD 1LO0L 1CDUA 1VGEL 4NRXA 1OK0A 3PL6D 4UMGA 1JYVA 1KBGL 3SHSA 5LXGH 4MYWB 3RL2B 4ZFFA 2C9XA 1NAML 5KSAD 2VN3A 1P6FA 1V3LA 3ECVA 2AV1A 2YRPA 1XVSA 2CLZA 4FE9A 4A67A 2COVD 1THCA 3QG6B 2HJKA 5DD0H 1N68A 3BQVA 5BS0B 4JMXA 2HT3D 1TG8A 4IBZA 3QPQD 2M83A 4H8PA 4HUCA 2N0MA 4LOFA 4MA3A 5B38G 1JZ3A 5CR8A 4QOKB 5IJKA 2V5YA 1G7IA 2YEQA 2B3IA 3GF8A 4NIKB 3Q1SH 3UZEC 2FBJH 3OHXB 4LHJB 4J6IA 2L7JA 3GHEL 2BSRA 4O02A 1X44A 2ICEA 1V05A 3HBQA 1EIBA 5IT2L 1GS7A 4L1SA 2WCGA 1WISA 5C0BD 4PJGA 3BVNA 2NR6D 4QRBA 1A3LH 5D1ZI 3VD7A 2ESVB 4XN4A 2G30A 4M61B 1J9RA 4M1GL 4HSQA 4YBLB 1I9EA 4K8RC 4L8SC 4ZO7A 5I73C 4QHLA 1L0QA 2DZEA 5I19L 1RK0A 3ZZ1A 2PMZA 3G5XA 1KENH 3OC5A 3OSKA 3TCLB 1UYWL 3ZKXC 1EXHA 4KRPB 1A1OA 4AENA 4U1SA 1QNZH 1TSHA 2Q87A 3MRMB 1I1FB 1V10A 4KK5C 2WXRA 4MAUL 5C09E 1KIRA 3STLB 1B88A 3I2CL 4JFYB 3BVDB 4PBWD 4LHUA 4Z76A 4IW4C 4QRRB 3S3CB 2O93L 1CIDA 1I3UA 3MRCB 1R3IL 1FZOA 2E47A 2F15A 2BNQB 3DPBB 2F7QA 4APXB 1CG9B 3CIAA 3MQIA 4ZXBC 2R56L 4ONOA 3A4AA 2Z31D 5SX4H 4PM1A 3D3VA 4FHBD 2AAVA 3G04A 1XGUA 2ZWYA 3NPSB 3MRPA 3V4PA 5J1AB 5JMRA 1QLEH 5AUMB 4MKTA 3GO1H 4RMTA 2FLRT 3VI3B 1B0GB 3K74B 3QO0B 2X5PA 2NW2A 3CXDL 3RQ3A 3SKUD 3TJHC 4A7VA 4YPJA 4AXWA 1KWKA 3HC3H 3S9DB 2YGVA 3E7JA 1BOGA 1JN6B 2QKIA 3BN9C 3QIUD 4TUJB 4D3CH 4LEBA 3BIBX 1NIBA 3IEAA 4LRIA 1NDMB 4NIYE 5IW6A 3OWRA 1MCOL 1JWSB 3K1KC 4P5TB 5D9SA 4AJ0A 2OSLB 1HSAA 3CZNA 1GVIA 4XOCA 2GJJA 4WWID 5EPMA 5D71H 4CW1B 5EEYA 1A3RL 5F6IC 4OJFH 2WKOA 4FQXA 4G6FB 4DETA 4TLSA 3HG4A 4TPRH 5C0EA 5EU6A 1AR2A 2DB8A 3LPFA 3T3MF 5ISZD 2EILB 3FNKA 3KPMA 4B97A 3FO9B 3UTTD 2BVYA 2GCYA 2YN3A 2IGLA 3CD4A 3HI5L 1HH9B 4U33A 3V0DA 4N2OA 3B2MA 5DR5H 2WQSA 2PW1A 5I6LA 4I5BB 1MFBL 1V7NL 1IVLA 3P2DA 2WXHA 3S35L 4P23B 1C08B 3KJ4C 4AY0A 2ATPA 3VFPA 4YHMH 5I26A 1J11A 3S34L 3GXMA 4FQHA 5L8KB 2AEQH 4OVVA 3WEBA 1JPGA 2XN9B 3D3VE 3WIIL 1U8HB 1MHEA 5D7JA 3VGFA 5MHSD 3TJEL 1J86A 1QFWL 4J28A 3KNBB 2OCFD 1WBXA 4Z95L 4RFNB 4LOUD 4AXWB 5C0IA 5KVGH 4MDRA 4Z5RA 2BY2A 2AITA 4XO3A 4KMQA 2EXWC 2XN1A 3NSFA 2AJSL 5GS2D 2C26A 2XI9A 3QG6A 4K5NA 4UOW1 2XXGA 2BWQA 5J9PB 5IQOA 2WLJA 4H1LA 3CVHH 1R47A 5SV3A 3PNWB 5T1KD 4LAQL 5C2BL 1E9OB 5IMOB 5MENE 3JTTA 4Y5XB 2BPBA 2A77H 5EDSA 4HUNB 3C2SA 1V7MH 2ODHA 1XL4A 3BPNC 5C09B 1E28B 5DURB 2YPKB 3ARYA 4LBAA 2KKQA 4HVBA 5JHDA 5EWIL 5E94B 1U8IA 2DJMA 2DI7A 3CZEA 1ULVA 3H42L 1XCXA 4WW1B 4YDLC 4GW5B 4DP9X 5I8OH 3RDJA 3S98A 4HMEA 4MNGE 5DUMH 2DMGA 2VLKE 4ENED 3ERXA 4M7LL 4RAVA 3C6SB 1VIWA 4PG2A 5EOTA 5CN3A 4JM2F 5GS1A 1KJVB 1XD1A 3UDWC 3IMWA 3ZKND 4AEHH 1RURL 1MG2C 5BZWB 1PJWA 2W9DH 5JIMA 3HRZA 1E27B 2PXYC 5TE6L 2C1OA 3TBTA 1AZVA 1INQA 2BP5M 3GMOB 5AWNH 3RUGF 5EUOF 4N22A 4WUUD 2H6PB 5IROD 5I8EA 1BGXH 2Y2WA 2YD6A 5KW9L 3X3GH 1CIUA 3L9BA 1FFRA 3QQDA 4B0MM 1L9MA 4HFUH 5C0DB 4N2DA 4EO5A 4MQ7A 1I31A 1PY0A 3NH7L 4CMMA 2AQPA 2RCSH 4UM9A 5FKAA 2CKBH 2VDPL 3P4NB 1PG7L 1UCBH 5F0LB 1H3PH 1Q0YH 3BEWB 3IJSA 1AO7A 1MLBB 3PAYA 4OGYH 4TOYL 1P5UA 3CLWA 4NO2A 1HAWA 3BE1H 1ZGLB 4QRUA 3LRKA 5B39G 4MDJB 4OM0H 2MOVA 3E2HB 3M46A 3MRIA 4UQDA 4NERA 1KUMA 2J8UF 4NLAA 3WN5C 2H3NB 2V5TA 3O4OB 1EZSA 2CO3A 1R17A 2XZAH 1A6TB 4U7SA 1G94A 4AC4A 3BWSA 2B4CC 4OZGB 4H0GA 3DX8B 5FGSA 1BD2A 4OTXH 1LO5A 4IBTA 1HHGA 2AJZB 1QO3B 3A67H 1WJ3A 5CUSH 1TU2A 1CDJA 2G75B 2P7TA 1QMUA 2JJTA 4OLZH 4EBQL 4JKPL 5EU3B 4FABL 1T2JA 4K7PY 3V7AE 4HG4J 5CS7A 4L8DB 1ZT1B 4AGOA 2IPUK 5CSGA 4AL8H 35C8H 1MJJB 5IFJA 4KH9A 1MELA 5HPOA 4JZOA 5L7XH 3E8UL 3QR1A 3T08A 1FE8H 4N0CC 2ATPB 3CSGA 3UBGA 2VQTA 2I60H 3Q9QA 2GJ6A 2L8AA 4PJEA 1E4XI 2PWFA 5CJQL 2XWTB 3HHSA 1TMQA 3NAAL 2NNRA 2XKUA 4L0PB 1U8NB 5GS1B 4LGRB 5C0BA 5DZ9A 4FQQB 2A74C 2IDSA 4P23D 3V10A 4DP1X 1S8DA 3HFMH 4Z7NE 4JZNB 2KZKA 4ZUUA 1EQWA 3MV8A 5CEZD 2EDKA 2K8QA 2C1PB 1OQXA 3VMPA 1P1VA 4EI5B 4BWTA 2CZNA 2DIJA 5KYYA 1DJXA 4BE5A 1KBGH 4YFEA 5IMMA 3K6NA 4JY4B 3KJ4B 3UAFA 2OR9H 2QR0A 3QIUB 3ZDWA 3BRDA 4ZX5A 1PG7H 1CR9H 2H8PB 4YDIH 1IC0A 2EO1A 4XWOC 4F2FA 3DSNA 1LO5B 4JFWA 1EJOL 5D1QB 1ORSA 4BA0A 4KBPA 2NSXA 3U25A 1BEYH 4G6MH 5CGYC 4IKJA 4PJ8A 2R0KL 4N0UE 1P9MC 1NPJA 1P4IH 4Z5RB 2XFGB 4MLSA 3MODH 1XO8A 1Z6JT 3FW6A 1ZLEA 2D3NA 5DURD 2OXGB 5GISH 2JLPA 5CLYA 1BYOA 3L7FB 5DMGC 3CSPA 2KZBA 4I18A 2DKMA 2ZUWA 4UQIM 4WSKA 4OUUB 4MNQD 1CS6A 2QPSA 4I13B 4KJWC 4C56E 4S2SB 1NEZG 4FXKC 4GKSB 4Q9RL 3IDYB 3PGFL 4QEGA 2JKXA 2YQGA 5A2KH 4Y9FA 1BP3B 1U8JA 2XX0A 3NSYA 3QHFL 2O61A 1AZBA 3BSZA 3LKPA 2FJSA 1R6VA 3KPMB 4HC1A 5C6WH 2OMWB 4PGDB 1QEWB 1LK2A 2NLJA 4LSQH 2X41A 3A23A 3ABGA 4ICXA 2EIZB 2DM3A 3OB0H 1BFOA 1KV3A 4JRFA 4I77H 1PYWB 3F5WB 1T0MA 3K0YA 3MLRH 1HI6B 2XV0A 3QH3B 1QKZL 4PJ8B 4HV8B 2Z0BA 1BAFL 1SLUA 4P48A 3SPJA 5E1QA 1YJDH 4LSVH 5JW5B 1Y0LB 1HNGA 3ARTA 3DV6B 4Y4KD 3WNNA 5JXAH 2J1YA 3K2MC 1NC2D 1L9OA 2ZXCA 4N0RA 4BHUI 4ELDA 4JFUA 4MHHI 1TQWA 3NZ8B 4M4RB 2H8PA 4YHOL 1IAIM 3MV9B 2WP3T 3GRBA 4P04A 3B9KB 1IJNA 2NOYA 1LP9F 5BS0D 5DD1L 4CU8A 3LKQA 4IOFD 4EN3A 4Q6IC 3ETBF 3GMRA 3LKRA 4XN9A 4X80L 4R26H 2E75C 4ZD3L 2RTTA 2GPZA 3LZFL 4Z18A 2Q9OA 1S5IH 4RDQG 3A24A 4TQEH 4BK5C 2VWEE 1L5GA 4Y2NA 1WK0A 2B3RA 4IQHA 3WN6A 1E67A 4X8JA 4JCLA 5CM1A 3MRBB 1IZJA 2EDNA 4LLUA 1L0PA 4UTBA 1XF3B 5CJ8A 3L7EB 5M95B 3GRGA 2R4SH 3RJOA 3SYQA 2R27A 4GFTB 2JI3A 1OGTB 4WSGA 2CUHA 1ZV5A 1IC5H 3H7LA 4NO0D 4WFFD 3K6FA 1MCDA 3WDIA 4QRPB 3KPLB 1IM9D 2FR4A 4LSUL 1YAIA 1ZWIA 2ODIA 2ZCKH 4CBPA 3FH5A 2YAOA 1SOSA 5DJXB 5T5FH 2E56A 3NFSL 3OJDA 1IE5A 2UZIL 4M5TA 4KZCA 4M7LT 4HDIB 4PJEF 4LL1A 2A6KB 4JPSA 3ZDXB 4M1DH 3US9A 1D5BB 4EI5C 1ZLUK 3TFKC 3CJJA 3TCTA 4B3EA 1LHZA 1NGYA 2WWMD 2NQ3A 5F6IB 1KY7A 4E41E 1BZ9A 5KBNC 3QPKA 4QTIH 4KRMB 3KCWA 2X3CA 2ZKWA 1I1AA 2D31B 2EACA 4MCNA 1FQ9C 2DICA 4EUPA 5BS0E 4K5MA 1TTRA 2HVKA 1ZAGA 2LFEA 3NSJA 1JD7A 4BZYA 1MCBA 4P59L 4X7SH 3UBFA 2YA1A 1GC1H 5CNHA 2YPVA 1JCKA 3WFEL 1AC0A 1EEYB 3ARPA 1CICB 1NFAA 2IAND 2P46B 1A6VL 4XP1H 5DUJA 3GHBH 2BIPA 2ZYSA 3C5ZB 3FONA 3DECA 3Q0HA 3TA3C 3K80A 3Q2LA 3BEWA 4OB5L 3WJLC 3DOSA 1IIIA 2Z3FA 3SKOA 1G7QB 2WBJD 2FIKA 4UOQA 3JV6A 1LL1A 1EEZB 1ZD6A 2YEZB 1SFHA 5LNDA 2GT9B 4JHZA 2HRPH 4QAWA 2QVMA 2K6ZA 2EC8A 2QJDA 2VAAA 1UXMA 1OCOB 5D6CB 2OQJB 4RGNE 3ECQA 3S4SG 1ZWIB 4AIOA 4MNHB 3ZT5A 5KJ7E 4QDGA 4CA4A 5BQDA 5IT2H 3T77B 1ZTXL 3UMTA 3C87A 1A5FH 2JQAA 2WQRA 3N1GC 3JV4A 2ZUVA 3UTTB 1EO5A 2ZX7A 1AQKL 1FPTL 1J8RA 4KMTL 1L9TA 3ZHKA 5BXFB 4YQXL 4XZUA 3WCYA 4PJ5E 5F3HB 2XPGB 3FQXA 5I30H 2WC7A 2YUWA 3Q9PA 4B95C 4ZFQA 1KCVL 2J2ZB 4UOW0 2X4TA 3QFDB 4JDZB 4RMVA 3UYOD 3NJFA 3TVMA 3K8KA 2H6UA 3O2VH 3VVWA 1CLOL 4HLZG 4PJGE 3IMSA 4N8PA 1QI5A 1A1NA 4FQCL 3BVNB 1BAGA 1YMMA 2BSTB 4H1LG 3NRQA 3VGBA 1F3JB 1SUHA 1TJGL 4QRTA 1AXTH 1XIWC 4GQQA 4YIQA 2WLIB 3I9IA 4GBXB 2PP9A 4AWJC 1XB3A 2P80A 1EMTH 3KXFE 3QNZB 4JDVA 4R8WH 2F53B 2ICES 4LLVA 3WJJC 5DQJB 5ITFB 4OLUL 4F8TA 5GSVB 2NYYD 2P45B 3NZSA 1U6AH 2CDEB 4K7PL 2FX9L 1K8DA 1KNOA 3MXWL 5IB5A 1AKPA 4TNEA 1JFQL 1HOCA 4IOIB 5AW7B 3AWFA 5C08E 4JQXC 5E5MB 3RU8H 1OP3K 5DEGB 3X13A 2GVYA 3IXAB 4AH2B 3RB5A 3V79C 5MEOB 3UAJD 5K59F 5IQLA 2UX7A 3MACH 4TULH 5IROA 1M56B 3ILEA 4BGLA 1OSEA 5CEZE 1HE8A 1LWJA 2EDDA 2IGFH 4L18A 3KM1A 1ZA6B 1XGRA 2PCXA 3L1FA 3CZFB 3U7WH 4BQ9A 4Q6IB 1SQMA 2FEDD 4R96A 4NQXA 4UM9D 3F85A 5E6SB 3QUHA 4K8RL 2YWZA 3NMEA 1QHOA 2E9WA 5JOPE 1X4ZA 3K46A 4Q14A 4IJ3C 4FFZA 5DD5H 5A6LA 4OU3A 8FABA 4LIQL 3Q5YA 2YZ1A 3QVAA 4M6NL 4PJ7E 3WNOA 4G80A 5HHOE 5TH2A 4DGVH 3D34A 4FQXB 3UG4A 2VMEA 1KGUA 1BZ8A 1MXDA 2WMPB 4JDTL 4I2XE 1PAZA 3OMZA 4WJ5B 3UYRL 4G8IA 2JKSA 2XKSA 3LXAA 3EYVA 3FZUC 2O6CA 1RULL 1KBBA 2QDVA 4DPBX 2BVPB 4XH2B 1KEGH 4HMCA 2DLHA 1CGWA 3QDMD 4UT6L 2XTJC 4PJCE 3Q6GH 5K39B 1MY7A 3HMXA 5JW4R 3ME0B 3T6VA 4F2EA 1IBZA 5E5MA 3EFFB 1HSBA 2AXGA 4H8QA 4PW9A 4QHNB 3RWDB 1M6UA 2PYFB 4P5KB 2FLMA 4Y7OC 5DUPL 2VIRB 3IN0A 5IJVA 4PJBE 3NYKA 5IMKB 5D1ZC 5D1QC 1DFBH 4NO3B 2NY1D 1F0LA 3GUTB 2XKNB 3GJFH 3NCCB 1WFOA 4PRPE 4DTGH 2JXMA 2BP0A 3IE9A 1FVDA 5E2JA 2MPAL 3LV3B 3WEXA 4Y4KA 1RULH 1E7VA 4E5XG 1SLVA 1UB5A 2ZOWA 4ELME 3MA7A 2EADA 2OA9A 4GP8B 3CBKB 3H9SD 4W68A 2ALAA 1MVFA 2MQCA 1XF5A 3CDYA 5D7IB 5CSZA 1DUZB 1J05A 4JDTH 3TJHD 6FABL 4NNPH 4G1MA 4PJEB 2XWJB 3L9YA 3ZDXF 4FLRA 3RVUC 3ULVE 1OE2A 3RVTD 1IT9H 1X5YA 4Z7VA 4U6TA 1VEPA 2Y5TB 4WJ5A 3HRZB 3LEYH 4BFEA 3A6CL 5FV1L 3HHRB 3VAEA 1F18A 4YAQA 1CTMA 4Q4IA 4XI5C 2CO4A 4EIZC 3HAEA 3II1A 5DI8A 4NM4H 2JQMA 4JFXA 2Z8WC 5EIIG 8FABB 3MACL 3MCKB 2YA2A 3GLDA 4FZEH 4YC2C 3SE3A 4W4OC 4YHZH 3US1A 1AE6H 2QEJA 3K8LA 3V6OC 4WWKB 3CMOH 4M43L 3AT0A 3U9WA 3Q06A 2V2XA 1AY1H 4HIIA 1TETL 2WV3A 4WHTA 2OR7A 4UB0L 3KS0J 3D25A 3FU3A 1RUMH 4KROC 4PB0L 4WTXA 5ECJE 3K2UH 2H9GA 3VX0A 4OZIB 1UFUA 2IDUA 5LWYH 4NQED 3TBWA 4HPYL 1Q94B 1IC7H 3QS3A 3IMRA 1TCRA 5LQBL 1TZHB 2GYSA 4P4KA 4YHYC 1PZCA 2AZUA 4H88H 4XMWA 3RWDA 4FAAB 2WLIA 3EBAA 3GJEA 4I48A 2Z92A 2NY5C 4PJDA 4JM4L 2G5UA 3NCXA 3FFDA 1TVBB 3ABLB 4IMKC 4NQEE 5KVDL 3BZEB 5LDSA 1EEYA 2EH7L 4LNRA 5DRZB 2AQ2A 1RFDL 4HT1L 4U1MA 2KHAA 2RAMA 1MWAL 5HYIA 3HNVL 5DI8B 1EX0A 3EOTL 1ZANL 3UGXA 1BJMA 4Y16D 3FOMB 1NZRA 3MGOA 2PXYD 4PRDA 5GS0L 4NNXB 4BINA 1EGJH 1B6UA 4RMWA 5D2LA 3VVVA 1HKFA 1JPSL 2NT0A 4JVPA 3U4AA 1VRSA 3Q5OA 4L4VD 5T1MA 1HHGB 4Z7UE 4BKTC 1FVCB 2V9RA 2NY0D 4H0HB 2H0PA 3ZU8A 4WWNA 1NUFA 4CAGA 2B16A 3RL1A 1GGTA 3HNVH 1TMCB 2CGRL 4RA3A 1GCFA 4TSCL 2FT6A 3NN8B 4Q6IA 1CZ8H 2J56A 2YPKA 4HT1H 3ZKNC 5AW4B 4LLDB 3UABA 1ASOA 1WGOA 3HLAB 5DEJA 3GMMA 1I7RB 4X42A 4LL9A 2TRYA 3EAKA 4XO9A 3X1NA 3L7EA 5EF1A 3WBDA 4KK6D 3OC8A 1BVNT 4A38A 1WWWX 4FA7B 4PTTB 3QB7C 2F7PA 1JPEA 3H9SE 4XNQB 4OUOA 3KBFA 2B39A 2Q86A 3EH4B 3RKPA 3WFEH 1A14H 4GQZA 2J6WA 1C1EL 3RGVD 5FFGA 4H0IA 4HWZB 1XH3B 2EXWD 2QPDB 4QF1B 4JRXD 3VFGL 4LLMB 4YS4A 1ID5I 3LZQA 3TONA 1Z9MA 5FHBH 4ZO6A 4OM1L 3B9VA 3MROA 3TPUB 3CFQA 1TTAA 4MVBC 1BVZA 2E74C 3TTYA 3THML 3W37A 3BRFA 4NI6A 3AAZB 2DTSA 3CFNA 4WEMB 3T8XB 4S1QH 3W3BA 4U6VH 4EUPG 1IGJB 3GRWL 4P2AA 5F96H 3F84A 1CDGA 5DJ8B 3PP4L 5C09D 2OV0A 2WKOF 1RUAH 4G9FB 4F57L 5LNGA 2ED6A 5T3ZH 4W9LC 3ARUA 3AC0A 3I3EA 3LNHA 3ARBA 1ACYH 1LMKA 2CR0A 4GG8A 3ZW3A 1RZIA 1HVXA 4ISVA 4Y88A 3ZT7A 4Z3TA 3RVWD 5FDYA 4AQ8C 4P46B 3EOAA 4HEPG 5EBWB 1IM9B 1U8PB 2C9SA 1A8ZA 1FIGH 2D7OA 5D4IA 4TQPA 3MJGX 5I73B 4MMXB 1M2VB 4NZDA 2LLLA 4QCIB 2OYLA 2CQVA 1CGUA 4HCRH 4B0MB 3KAAA 4OSUH 3FT3A 5DK0A 2X1OA 2UV3A 4E9YA 3KBHE 3LKOB 2OQJA 2WLYA 4R26L 3D6GA 4ZD3H 4KHXH 3DX3A 3GXIA 1YVLA 3QXDA 2FE0A 2I7OA 3LTVA 5KBPA 1YEWA 1X7TA 5IESL 3WKML 5DZAA 2IAMD 5BQ7B 1DN0B 4BDVA 3QRBA 3LXBA 4TV3A 1SUJA 4BSVB 1NMCB 1Q9OA 4ZW5A 4OZHB 3TBYB 4OCNC 3ZKMD 3WEMA 3B5TA 4I85A 1T7ZA 3QULB 4PBDA 3RFZC 43C9A 1GL4B 5C08D 5DJCA 4OT1H 4DSYA 3KPQA 5J12C 1KTLA 2PTTA 3DDFA 5KAQF 2OL3H 4KKNA 5FECB 2V7HA 1KFAL 4FP8H 4Y5XA 3MRCA 3VG9B 3ARBC 2IOMA 4JO3L 1CLVA 5CINL 3OZ9L 2IEPA 4M8QB 1KJ3L 4S1RH 3DBXA 2YUZA 2XYCA 4MD4B 3TBWB 1BFVL 4WO0A 5I1DA 3LMJH 4KNQA 2F18A 4H8WH 4YHYB 1CFBA 5KSBB 3VM7A 2IQAA 4WFEE 5EORL 4NKMB 4XPAL 3OMIB 3QWOA 1K4DB 3H9SA 3L95B 1EEUA 5IJDC 4ODTL 4WWKD 1CURA 3FN0L 1IKOP 3AWEA 5DS2A 1IKFL 1OP9A 1IMHC 2YUXA 1EH9A 3EYQD 3LKNB 4K8RH 4NT6A 5D2NE 3IKKA 4MJIE 1DQTA 4HK3J 2R1WB 3N1PC 3MBEB 2XBZA 1SN0A 4A2GA 4QXTA 2W65B 1TYEB 2E9GA 5AAWA 3TA4D 4JM2D 4DKFH 5C2UB 3BKCL 1SHMA 3ZDYF 5A40E 3VFTB 5KYUB 1BVLA 5JUEH 3DK2A 1F1DA 2AANA 2XZCH 4QYOA 4XNAA 3SGDI 3K2IA 2QHRH 2YSSA 3RU8L 3CPUA 4NKDB 3DURB 4XP6H 4ZODA 4HPOH 3WY4A 3MXWH 2IWEA 4XXCC 1WZMA 4UINL 1CR9L 3Q43A 1E9OA 3IGLA 4RRPG 1T04A 3MROB 2JB5H 5TE7L 2F58H 4XO4A 2OR9L 4ATTA 3SGKA 4UQEA 3W2DH 1NCWL 1NIDA 1UWXH 2FUTA 3WY3A 3LY6A 5IR1A 2IANE 3NIGF 5BRQA 3VGGA 5LDUA 4X5XB 1AS8A 2BY3A 4YDNA 3T6QC 4HU2A 4A2LA 3MUGB 3KLQA 3M07A 3PLYA 5F7HA 4MAYC 4R2GB 4YWGH 5K9JH 1N8ZB 4X5WB 1HHIB 2VXVH 4IHBA 4BUQA 5FUOH 4G8GD 2Y9RT 4JL2A 4P9HH 5FUCC 2O61B 1SZNA 2N1KA 4LCWE 4CVXA 3L81A 5DFVD 1MJ7L 3S4SA 4PJ5D 3FQUA 2D7PA 4MCMA 2IWGA 1V3KA 1F3DH 5CILH 5KOMC 3HHSB 1W8NA 1WD8A 2UWEF 4JKPH 4OLZL 1E7UA 4EBQH 3LH8A 2FT7A 1T89C 2VZTA 2WXNA 3AREB 5F7EH 4LE8A 3UTSD 4DFHA 4KK9D 2VQ1B 4ANVA 3E0GA 2BXZA 4GG8B 4NQCE 3TH2T 3MSPA 5AVXB 4RGND 5JZ7C 1TJMA 2GITA 3N9GH 3P9LA 2QELA 2VABA 3VWJC 3QJZA 2Q7YB 5I17A 4MB5A 2ZWZA 1DVYA 2Y5TA 5CZRA 2Z7ZA 2VW4A 1UXSB 1B6DA 2DDQH 3B5GA 1CU4H 1JD9A 4J3OC 4MQTB 4HUXA 1UEYA 3QRFM 1E4KA 4R3SB 4O2CB 4KI1A 3V9CA 2DH3A 5AD0A 1FFQA 1G9ML 2A83A 1NGQH 5CWSB 4MKMA 4U3SA 3BQUD 4Y4HB 1XF5B 2WKLA 1QSEE 4PJIA 3QDHA 2ZD0A 2K4WA 5EOCL 2LR4A 1Y6KR 2LT9A 4PU2A 3NQKA 1KTKE 4L3ED 1OTTC 5BQ7A 3H9ZA 1QASA 2RCSL 2UWEE 3F7LA 4PP2B 4PWKA 4RMBA 5D93C 1KWGA 1DEEB 3SDAB 4G83A 4OZIE 4M1CD 4HULB 4NC1C 3D9AL 4NUGH 3RWFA 4LLVB 3VI4F 5ADOH 3L3HB 4K7PX 2ZUQC 1JUFA 2XU9A 4ZPVA 3TESA 2I7SA 4HKXA 4FCHA 3Q1EA 3CFUA 4ACTA 4J3OG 4Y4KC 4F80A 2HVKB 3FUEA 5IHHA 3ECBB 3AWGA 2HFEB 3EYFA 3V6FA 4NPJA 1RURH 1K6QH 4AEHL 4YBQD 5JNYA 2OM5A 1E8YA 2WVVA 3NJIA 3AQDA 3MRGA 4M7LH 2R4SL 3SBPA 4OFYD 4WFFE 5ES4B 5BCAA 5I6XC 3BUBA 3BAKA 3UTSE 1CVSC 1RP9A 3BKJL 4GRWH 3RDTC 1RPQA 2F5BL 3N3EA 4D0DB 2NUPA 1DL7H 2WLKA 2VITB 3DRQA 3RWJA 3FCSA 4ODBD 3INUL 3DJRA 3IDYC 5DHDA 5T5NF 2QGDA 3E1ZA 3WFZA 4DJMA 4UDUA 4WV1A 3V0WH 2VR6A 3I74A 5GJSH 1P4UA 3IS0X 1GY1A 2Q8BH 1IGFH 4NKIH 1WPCA 1NCDL 1RSFA 4G8EB 4Z9KB 4DNLA 1XGTB 3KEHA 2BZDA 2Z9TA 3CVHL 1HZHH 5GGTH 4NYLB 2E27L 3U0TA 5EU7E 3FU0A 3DPDA 3H9YA 4XPBH 2MCPL 2E0PA 4HIJA 1E4HA 2AJSH 3TN0B 4M4PA 5AUMA 4XVUC 1X5XA 4LSVL 3DVFA 4MDJA 1QKZH 4Z78B 2HMID 5IMMB 2Q20A 5I1LA 1NFDA 1MCWW 1UGNA 2YC1B 3VQ1C 1C16A 1FZOB 4A7UA 2IDFA 4XPBL 3DYPA 4R7DA 4F8OA 1ERNA 2FWOB 4QJ5B 4QHNA 1F3DJ 1KIUA 2JV6A 3QYCA 4Z1PA 5C0RH 3D3VB 4NX0A 2YOAA 2ZCLH 4Q56A 4P06A 4XVTH 3OAUL 4AG4L 5TQ0H 1H8LA 3P2BA 4MQSB 3RLSA 3U4KA 4HD9A 2AJXL 1MAJA 1YYMH 2VKXA 3ARFD 4KRNA 3IJYB 3U46A 5KUKA 5FA3A 3HMXH 3NJLA 2DWEB 3BWUF 5HI4C 3ZGHA 4NQCB 1JNLH 4TNWK 2FZ3A 5E5UB 4F3FA 1E4XH 1RUQL 2VXUH 1P2CB 2TSBA 5G4MA 5DC9B 5MI0C 2WP3O 3NDZE 4WY7H 1MJJA 3UZEA 2XJKA 1BVKA 5DD6A 1IAIL 2ITDA 4PJIE 3WJJA 2Z7WA 2YSTA 4IIZA 1OAQH 3HIZA 1ZTMA 4YK4B 1E42A 2BS8A 1MFNA 3LD8C 4GXFA 1KJ2L 4AKQA 1CK0L 5GRYA 3BP6B 4MNQE 4ZK8A 3QFJA 3FQNA 4QHLB 1VZHA 2AJZA 1YEDA 1DLFL 1IAII 2VZUA 3BD3A 3SJVB 4YFLI 1G7IB 4TVUA 3FQ2A 1I1RA 3AXLA 3H2PA 1T5KA 5KSVA 2Z91B 2QDWA 4G43B 1A6ZA 4KHTL 2X12A 4FI6A 4MSWB 3N0PB 5E5RB 1PBYA 1S6NA 4FS0A 4PLKD 3SCMB 1OSYA 3MGTB 1FFOA 5D1QD 2XV3A 3N44B 5E6IB 4Z0XA 3N1QC 3ESUF 2A4EA 3G08B 3EZJB 3BQUB 4H7VA 4Y4HD 5FHAH 1U8QA 2COQA 4YDIL 3V8CA 2FJHA 5C3IA 5CLZA 4NDMB 4V11A 2NXYB 4I89A 2HTKC 5J57B 1A6PA 3V4PB 1PY9A 1TNNA 1NGQL 1C7TA 2H6OA 5I75B 4JRLA 4CU6A 4LAJH 1AGFA 1J9TA 3UTQB 3MA9L 4Y2LA 1RJZA 2TSAA 3UO8B 1FYHB 2ZKHL 1Z2KA 2QGEA 4ZOCA 3UTSB 1WZLA 4NRXB 4UWQB 3W1ZA 5TE4L 5SWQB 4X6CA 2OP4L 5KANG 4O2EB 3LZPA 1FE8L 2GJZA 2GTZB 5DFAA 2D3JA 1DZ0A 3OHMB 1N59B 1Q72H 2XXFA 4WUUE 5I0YA 4CNIA 1R0AH 3FC8A 3FS9A 3RRQA 35C8L 2J2ZA 1VACA 3KPSE 3O6LL 1PLBA 4P9HC 4UDUB 5DYOA 4UTAL 1R3LB 2J55A 2MNJB 3A67L 3OX8B 4ODSL 4F8NA 3O0LA 2M8XA 2YOCA 4MGXA 4YH6A 5GGVY 2OP4H 4OD1H 5HVFB 1T6WA 2XZAL 1UT9A 2XZQL 4HKBA 5DA4A 5ID0A 3MLTA 2WZPA 3NTCL 3VI4B 5CN2A 3WIFB 3GUTA 2PN5A 1LQBC 1Q9LB 1TTUA 4AK1A 4N8CL 2H1PL 8CGTA 4LLMA 4RRPA 4U1JB 1MAMH 1MZYA 4F15B 3L5XH 3OXSA 4K94C 5E4EC 3O6FA 2GEEA 1KNOB 3EGSB 2R1YA 4JZJB 1N10A 2H3KA 3W2DL 3PGCB 4JGNA 3F12B 3SQBB 5E6IA 3LQZB 1SBSH 5JIQA 2ETWA 3L3JB 1RPKA 3KXFB 3QXAA 3ZRFC 2CSPA 4L2LA 4S1SH 4N1HB 2F74B 4TTDC 3SJVE 4QRRA 1H5BB 3L4TA 5FB8B 4H20L 2WLHA 4M62H 1HQRB 5L4FA 5AQ0A 2ZNWA 1N2RA 5BVJB 2GG1A 2PPEA 4YL4A 3VXSE 4TL5A 1ID2A 4JHWH 1U8MB 4CC4C 4OI7A 3G6AA 1EBAA 3EDKA 3FU5A 5CCKL 4GAGL 5LCVL 3QR0A 3MRNB 4QY8B 4TQHA 4XB8A 4ODVL 3T2NH 5TD4A 4PV1C 1U8CA 2MQ3A 4JFTA 5AL8A 4M29A 1WWAX 4WI6A 3V8OA 2AJYL 4YDMA 2XWTA 5ID1A 1WT5C 2GJZB 3MV7A 4WO4B 5J7CC 5E9DB 3QQNA 3PE9A 4X8CA 3TO4B 1G6RB 2ZSWB 1YUHB 2GSIB 5F2FA 3TU6A 1CGSL 1PZ5A 4JRYA 4WY7L 1FCCA 5FWRA 4PR5B 5DS8B 5KVEE 2VXUL 1E4XL 1AGBA 1ZT1A 3L9EA 1GZQB 2XG4B 4XBGB 3Q6FA 4PJAA 4AKOA 2IALB 4QOKA 1T21A 2G4GA 4NN7C 2HLAB 4AG4H 2BZ7A 2OS7A 1BX2B 3BMWA 3F83A 4HMDA 3RUGB 1OAUL 4DAGL 1X5FA 4MWFB 1U8QB 4ZW3A 4LLYA 5FO8A 4JO3H 1N4XL 5JHBA 4NO3A 3VCLA 2A9ML 5E2UL 3P4LA 4M7KL 3RILA 7CGTA 2NXZC 4I7ZC 1U36A 4HXBL 4MJHA 4GUQA 1H6EA 1ILSA 4GI6A 4OLYL 5A2CA 1E6OL 2DQUH 5C0JA 1QFWH 3PWJB 4LPUA 4FG4A 5T33L 4R2GC 1U93B 5EB9A 1SXZA 3TBYA 2Z34A 4AW4A 1YNKH 3MRMA 2Y5EA 4HZAA 2CLVA 3FXIC 4HIHB 3VTMA 3NJNA 5CIPH 5HHXH 4ZNEE 4J39A 1I7UB 4XC1H 1CXLA 1DJZA 3RVWC 5B8CA 1HIMH 2VCOA 3FHEA 3GI9H 1U91A 3N1FC 4GSDH 4DERA 5IV2A 5I2IB 2PR4H 1WFUA 1S3KL 4Y2OA 1I8KB 2X4UA 1T3FA 3MGAA 3R1GL 4X98B 1BJ1H 3MN8A 4F9PA 1FZMA 4NP4L 2VL4A 4XB7A 4JFDA 3GBMH 4JFHD 1ZGLP 1QVOB 4NENB 4W70A 4TPRL 4Y4FB 4OZIF 2MQ0A 2WCPA 1JL8A 4WJKB 1FL6B 1FDLH 3DX9A 1KCRL 1SDYA 2Z0UA 3OBAA 5KN5B 1WZ1H 3P4OB 1AACA 3APCA 3HZMB 4U4BA 5AVYB 5KG9B 1OAYL 4OJYA 1YQVL 3GXFA 4JFZH 3U1SH 4Y1SA 4CNIB 3ROLA 1WGVA 3ZGIA 2A74A 4QHPA 4DHLA 3MFFB 3KGRA 3M1BA 1PLCA 3U9PH 4BFIA 3GRWH 2WLLA 3X3FH 1QSVA 1KXTB 3HBGA 5I66A 2YO3A 3QJHA 3WIHH 2R2BB 4AGNA 1CI5A 3QA3B 4PI0A 4KY1L 5HHNB 4ZJ9A 2VW6A 4UM8B 4AYDC 4HIHA 1YEGH 5DHXB 3SDDC 2MKLC 2EABA 3BHBA 1JN6A 2QKIB 2J5LB 4NAQA 5D1QA 4FI8A 4X9FA 4AV5A 2QPUA 1CFTB 2CCWA 4OFYA 4H1LH 3QH3A 4A66A 2BERA 4JFSA 1XZ0B 1KTRL 5HHPB 3OKMA 4Z7QE 3SSGA 2WBXA 2J1ZA 2VN7A 4NHUA 3L8QA 5EIIB 2XN0A 5FO7B 1PEZA 3U6XS 1JDDA 2BIIA 4YSCA 2CJ3A 4N9GA 2F54A 5C07E 1A6UH 3TN0D 3JTSA 3AS3A 3NSCA 2EEAA 1W8OA 3BEVA 3MLUL 3MNVA 5IMLA 3AG3B 2WOBA 1YMHB 3FU7B 1U8HA 2C3XA 1Q9OB 2NUPB 1EXUA 2IO5A 4LCWA 3WFCL 1JGVL 4WU5A 4B9JA 3O9WB 1I7ZA 3TNNB 1ZEAH 3PWVA 4BQ6A 4POUB 3AREA 2ERJB 4RFEA 2YKLL 4H26B 3QE5A 2G2NA 3RL1B 1JZ8A 5EO9A 4D0BA 5DA0B 4G70B 4KVCH 5IIEA 2AC0A 3MRFA 4NZRL 5E9DE 1KF9B 4XNZB 2Z7YA 4KXBA 3VFPB 5DZVA 2R69A 4IBWA 1IGTB 3QNYB 1UJTA 3ET9F 4FQXD 1A0QH 1S2EA 1SBBA 1ZHKA 4KV5F 1UQSA 3B7RL 5JDSB 4W9IC 3HUJE 3PABB 2YAQA 4YWGL 5K9JL 5IROC 4OJDH 4R7VA 1GC1C 1BJ8A 4MMZA 1RK7A 3O3EB 5DK2A 3W9EA 3BGAA 1CGXA 4R97B 3CHRA 3RIAK 1I3VA 3RBSA 3SQRA 4Z7IA 1FHNA 4PJDB 5JHDE 5J11C 4K2UL 4GG6B 1RP8A 4M5YL 1MIEH 2H47C 2NDFA 5I0WA 3FYIB 4JKNA 1INDL 1KCUL 4NQEB 5LQBH 4NAMA 3QA3A 3FT4A 5BUGA 2FHFA 1ACZA 2BP0B 1GW0A 3UTZB 1C5BH 1AMYA 1AKJA 4Y0GA 2A9BA 2YUVA 2IPKB 5E8PA 2VLLB 1URLA 4DZ8A 4NFCA 1ZK9A 2IPUG 4AM0Q 5DMIH 5E6ID 4ZAKC 2OTWA 3TXAA 5C1MB 4PRHE 4QRQA 4JGJA 4PG9A 3R19A 5I16B 3N50A 4KKPA 5IIEB 5JUEL 2DEWX 1UZ6E 4QXTB 4LVHC 3ESPA 4XX1E 4U1KA 2BSCA 4EDXA 1NFIA 2IMMA 1OEZW 4U3XA 2WN3A 4IGBB 5IUSA 2EE0A 4J6RL 1PFCA 4ADGA 4KMLB 3IK2A 1OAXL 4KXZH 2KDGA 3HAEB 3MBED 2AK4D 3OB0K 4JN2B 4I0PA 3FQTB 5CP7A 1KZYA 5BRZE 4CC0A 4NPYB 4PS4H 1BLIA 1Y18B 2MPVA 1I8MA 2DIEA 3PPEA 4PS7A 3FB8A 5BOJA 3FFCE 2NX5E 3OPUA 2C4FT 1WAPA 2RH0A 5I5MA 1RLWA 3FO2A 4GUPB 1MCPH 2FO4A 5B3JF 4H8WL 1OB0A 5IHUL 3GGWA 2WUBH 4M48L 1SVCP 2P8MA 5DJYB 3UTZA 5DZOA 4PEEA 3UXFA 4K9EC 5FECA 3WFBH 3GINA 5DT1L 2FSDA 1DFBL 1F1GA 1GOHA 4OCYL 3VD3A 1HESA 1RZ7L 1B9ZA 4XOAA 4FQXC 3W9EB 3BZFA 2EKSB 3HE7A 3RJDA 4FRWA 3DXAB 2VDNL 2Z92B 3TC9A 3ALPA 1PKQB 5ITBL 1OALA 2NUTA 1HHHA 4N85A 3C5JB 1G0XA 3RPKA 1Q1JL 4JZNA 4ZUUB 5FYLH 4Y1TA 4W9GC 3WFBL 2KERA 3IYLW 2ZOOA 1UUSA 2YIHA 1GY2A 3AQYA 2IOOA 1XBDA 5GGRA 4PJCB 4PIRF 2PCPB 4LPVA 4B9CA 4G8GB 1K9TA 2HH0H 3K5SA 4JZJC 1NCGA 3KLLA 1MH5B 4L37A 3NOIA 2W9EH 4NM8L 4I87A 4DGVL 4N1EA 3ARGC 1HILA 1PNCA 2W0KA 1T4WA 2QVIA 4G59C 4PIBA 3V9EA 1KJVA 4G80B 1W91A 4MAYD 4JR9L 1D6VH 1A1OB 1HNYA 1XCTB 4QXWA 3U0WH 1KTDB 2OMUB 2YD8A 3EFOA 4XZ4A 1LE5B 1XGQA 1RZIB 5EBLB 1JPFA 4PUBH 3Q8BA 3T0VA 3F7QA 2ZXAA 4NQXB 3AW5A 5ANMA 4PJBF 1R24A 1WLHA 5JHLH 3FOMA 3MRQA 1GSKA 3EYFB 4YSOA 5DHEA 1XCQA 1GZHC 5ABDE 2WYIA 1QSFE 1DVZA 5TDPA 2EE6A 1TT6A 3A3YB 4FMKA 4LCYA 3I02B 3QHZL 2X6VA 3DYMA 3S5LA 5LGJA 3C6EA 2FT8A 3NIDE 3SYPA 1E6JL 4AEEA 3QO0A 2VMFA 4WRLA 4F7TA 1JCVA 1N70A 3K4ZA 3VWJD 3VFGH 4GAFB 1K8DB 5KVDE 4L3EB 3MV8D 3ME0A 1OO2A 4HIEA 4R8WL 1SDDB 1GH7A 4U3HA 2FO1A 2KC0A 1RIUL 3FJTA 2WYHA 1R5IA 5DHVA 3PHQA 4O2FA 2FUQA 3T4AC 1M71B 4P5KA 5IJVB 2YXWA 4WHYG 1JE6A 3SOBL 3WTXA 1P7KA 4CN4A 4HIJB 3ML9A 3SOTA 1NBVH 2ESVE 3VRLE 4XCYB 2LU7A 3DHJA 3KGTA 4FULA 5F1OB 2X05A 1CXKA 3BDXA 3D39B 2BVTA 1NBYB 1UJ3C 2CGRH 3A6BL 2VNCA 2VDLB 4JZOB 1A4JA 1WTGT 2R4RH 4G7QB 4PLJC 4MDIA 1MHPH 1YPZA 5A2LH 1ZCRA 3KW7A 4N90E 2QQNH 4G1MB 4X5RA 1EUUA 2X6BA 3S6CA 3AS1A 4ECNA 1ZTXH 4LDLB 5LNEA 1N3NA 3WD5H 3CFKB 3C8HA 3HJ0A 4D7BA 4PJFA 1WS8A 3LKNA 1ZANH 4J7RA 4NT6B 1E3XA 4O9HH 4V1DB 3NGBC 4WFED 4D9LL 4MXWH 1WRFA 2N59A 3QQ4A 3FT0A 3EGDA 4NC2B 1DDHA 3ABZA 3ZN6A 1RIHL 3MRBA 4NLHA 5HGHB 1MFAL 5C07D 1IFRA 2BS9A 1QQDA 1AG6A 1N6VA 2BIHA 5IQ9A 4LCUB 1UVQA 3UIYA 3VI3E 3C6LB 3GS0A 3P0GB 3QUYC 5IUCA 4ICWA 4QJ4B 1A9EB 1OP3H 2D73A 3MTXA 3PHQB 1IQDB 3VXRE 3HUJA 4JAMB 4PBVC 1NJ9A 2UWEB 5DZLA 1A2YB 2RFXA 2ZYIA 5GGQL 2X44D 3DO7A 3VX1A 4KTYA 1KJ2B 4P59H 4ZX4A 3W39B 1AD9B 2H9GB 3EYVB 3P11L 7PAZA 5D1XE 4X6FA 4GBXA 4YGAB 1Q0XH 4GG6A 1RUML 3RWHA 5F8QC 1JNJA 4MD5A 2FWUA 4OZHA 3BUTA 3EYOA 5BRPA 4JPQA 1BXXA 3CMOL 3VRJB 2XY1A 4K07A 4B53A 3QUYA 1FFPA 1JV2B 4JRXA 1YECH 4X7TA 3VH8B 4AV0A 4KPHL 2D4FA 5T5FL 5BO0D 1MFEH 1N3NB 2JQZA 5BZWA 2J5LC 4S0SD 2IDQA 4QHUB 3RWJB 2GHWB 1J9QA 4YZFF 1GTNA 3MDJA 4KJQD 1QACA 1IC5L 3SKMA 1KCRH 2YK1H 1JZ7A 1CXFA 1ROCA 1U8JB 3G5VA 3LEYL 4IIQA 4LLWB 1QUNB 4XCFL 3GZPA 4LSTL 2X53A 3WFHA 5FFOA 1IT9L 4ZFZB 3WGVB 3WJMB 3UZQB 4GIAA 4J2XA 1TO5A 3FUDA 5IKCA 1K4DA 3ZIMA 4X83A 2PXYB 4B6ZA 6FABH 4KFMA 4AI7A 2J4WL 2Y36H 4X5PA 2BVQB 1WCBB 5AVUB 4CSSA 3L16A 4WNJA 3WI9A 5FW6A 2K1MA 2YMTA 4LPYA 3KWTA 5FR3A 5IREA 3FONB 4FFWC 1DVUA 1LK3L 1W72B 1QFUH 3GK8L 1DEEA 3L3DB 4JRXE 2XQBL 4RGMB 2H2SD 3ESNA 5E24E 3SKOB 1W0VA 3GM0A 3OSVA 3FUMA 1BX2A 4JUTA 5FYLD 3SPVA 5IEHB 5HP5A 4FERA 3E6HA 3WELA 3B2XA 2DJ4A 5CWSA 3CBJB 4OCYH 5EF2A 5DD3L 5ID0B 4L0YA 2HN7B 32C2A 3QUKA 4XP5L 4HWZA 2XWRA 1S78D 3P9MB 5DT1H 2G0LA 4GINA 4I9WD 5AYQA 1ZIAA 5AAPA 5EU4A 1VGKB 2R29A 3WSQH 1OAUH 2X9YA 3LQAH 2Y1YA 2Z6FA 5EO1B 1J48A 1MFCH 2VDKH 4YFDB 3QHFH 1YEFH 3D39E 3JWNC 4L4VE 5I1GH 3VXRB 4QCIA 2JI1A 4I1RA 5I9QC 3O6ML 4HHAA 5FGCE 2PXYA 3IWVA 4RWHA 4IGBD 3MLZL 5DJXA 1U2HA 4AIEA 5AENA 3OKEA 4L23A 5GS1C 4QYAA 1FGVL 2BC4B 3MMEA 4XCYA 3DDGA 4JFQA 3ULVC 1S5HA 1AYOA 2R2CA 4XNUH 3OLEA 5C7XH 1DJYA 1QBLH 2BNRB 3U30B 4AVHA 3LN5A 3P0VH 4K9EH 1OW0A 1A9BB 4IMKA 4ANWA 5SWSA 4NNXA 4JHWL 4PWHA 4JO2L 2Q6WB 4WUKL 3LNEA 3U36A 4DK5A 5I1IL 4LBEA 2X3BA 1IFHL 4MMYB 3VXUA 4M62L 1ACCA 2DI9A 4PBXA 3T1WA 4PJIB 3T2PA 1TZGH 1QFWI 4UILH 1B4LA 3LX9A 2V3EA 1XXFC 4AVIA 2P24A 1SLXA 3UPRB 3DBXB 2ITFA 3N43B 4OJCA 3HG1D 3S5LB 1C8PA 4L4TE 2Q5BA 2EUVA 1MZZA 1DQDH 2NXZD 1W6LA 3COOA 3IFLL 3N04A 2EVHA 1CLYH 1VESA 3QCVH 4PV9A 3RIKA 4HIQA 3FDWA 3RTQB 5HDLA 3BKMH 5IB3A 5D1XB 4DP8X 3H6JA 43C9B 5C3LD 4GKZA 4H8WC 2WXOA 4NFBA 4PAZA 2CWRA 1Y1DA 4WENB 1TZOA 5EFIB 1LE9B 4YL9A 1KYOK 4D8PA 4YE0A 3ZE1E 5CD3B 3D3VD 2V6HA 4DESA 4F7CA 3WS6C 3A21A 3F5WA 3WMQA 1CLOH 5C08B 2HTLD 3GDCA 5KUMA 4WI2A 4JCMA 1I8MB 3PQYE 4E9LA 1Z7JA 3GIZL 3PG2A 2D9CA 3RAJL 3ZDZB 3K3QA 3CFDA 1O5PA 3FPXA 3VGAC 5I76A 4DKEH 2C9PA 1MWAA 1J8SA 4HK0A 4XBPA 1FPTH 4KMTH 3FSOA 1D7BA 2YAMA 3DVNB 3KPSD 4MJIB 1UTDA 3DMMA 2P48B 3EJPA 4KGLA 3EHBC 1NGXA 5CEZL 2J8HA 4MD0B 2VAAB 1NMAL 3L3KB 3GMRB 4N87A 4RQQA 1T1ZB 4OF6A 1W6WA 3BKYL 4Y2OB 5KBDA 5H35B 2XRAL 5KVFL 2NQDA 3D2UB 3ZQ9A 3S5YA 3ULAB 1E4WH 4YX2H 3HN5A 4F33B 5D7HA 1OHQA 2AGJL 1E5UI 5CGMA 3MLWH 2FJHB 4PLOB 1OAKH 3Q3GB 3R7RA 1DHKA 4OB5H 3ATDA 2ITCA 3FQRB 1BJ1J 2HJFA 1IRAY 3V52H 4KO6A 3R06B 3MA9H 4POZC 5IB3B 5EG6C 2F1BA 4G8FA 1CGYA 4RDQF 4DKDC 4ZFFB 3JV0A 2CCLA 3IFNL 3ZR5A 1PJ9A 1U95A 4ZAKA 3QSKB 1XCQB 1QTPA 1H3PL 1Q0YL 1UCBL 3QXTA 3EOBA 3O3EA 1XHHA 3E6FA 5K9OB 2R69H 2CKBL 3C9NB 1UENA 1S9KC 2OMVB 3MBXH 4FLSA 1NCOA 4DEPB 5ETUA 3GTVA 1OPGL 1DUYA 3TIEB 5JDJA 2DQHL 2DQTL 2OMUA 4N0YL 1T5WB 1B4TA 3POCA 3X3FL 4HEPA 4AGPA 1E90A 1MHCA 4LPWA 2D7TH 1GJUA 3ARVA 2L3BA 1OTUD 2AJVH 4G71B 5D5ME 4HOMA 1HWWA 1BZDA 4UCFA 2CAKA 2HJLA 3LDBC 3FULA 1PZ5B 4FCAA 5AW5B 4U6HB 2HVJA 1BZOA 5F7LB 4ZOBA 3NZUA 1G7MA 3MU3A 1KJ2H 3CHOA 3I9PA 4UBDC 4WSJA 2VR8A 5L88H 5DUML 3NDYE 3A4FA 2ADFL 1U4FA 2Y1VA 2HX7A 1G7QA 2F8VA 3VW3L 2RHEA 5G4NA 4PGEA 5E56A 3IF1A 4M8RA 3VFVB 4R5VA 2F19H 4BUHA 1U8IB 2B1HH 2I07B 2FQFA 5IJKC 3S7GA 4GO8A 4LKCA 3UEQA 2BOBA 2F08A 4JQXA 1YDPB 3O8XC 2FDBP 3B8SA 1XT5A 2X70B 1NCAL 4I0KA 4AQ1A 3DTXA 1KB5B 3UC2A 4LAQH 5C2BH 3V0VB 2ZNXA 4XN5A 3IJ9A 4BJLA 1SMAA 4J3XA 4LCCC 3L3JA 1KYDA 2WK2A 4XE0A 5K1NA 2JE8A 1MI5B 2QTEA 4Y2DD 1U93A 2BHYA 5C0AB 1FIEA 1QD0A 3F6JA 2VISA 3HE6B 5CGYD 3QDJA 4P2RD 3CH1A 1I8LA 1IGIL 4Z95H 4HXBH 1DN0A 1EUTA 4MMYA 2FATL 4UF7C 5D7SL 3VXUB 2X4QA 3U83A 3KLAB 4GSRA 3HTLX 3TJEH 4LCVA 5E2UH 3VWKD 1XEDA 4BWWA 3AXIA 1DQQB 1DJHA 2OSXA 1L7TL 4MXVE 3SDDA 3HB3C 5H4YA 4CILA 4N6QA 5TK2A 4PJ9D 4EN2A 1NCAH 5FWQA 3PJSB 5AZEH 2IAMA 4LU5L 1G6RA 2Q8BL 5EN3A 4AIZB 4LF3A 5I0VA 3PY9A 2VDMH 1XSOA 5EEZA 4NUMA 9CGTA 1FL6A 3V0WL 3DGCR 2N7AA 2F19L 2VT0A 2Q8AH 1FVEA 1MJUL 1MREH 3QEQE 4LEXL 3VDCA 4C8XA 1E8ZA 3INUH 3NJJA 3IB4A 3GSNA 3EJYD 3LB6D 1BVNP 2R83A 3SD2A 1JHKH 3D30A 1FORL 4P99A 4RZCA 5FCSH 5J1TC 4M8VA 3GMNA 3T0EB 3VGEA 1M05B 2Y24A 2ZG1A 2A1WH 2ROYA 3QEUB 2VDRB 4GT7A 3GSNL 1RZJC 1MVUB 4PRBA 5GZOD 3QQ3A 3OHXA 4XVUD 1TITA 1UT1A 2BOCA 2I32A 3D0LA 3EIFA 1R4XA 4HIPA 4ONHA 1BEXA 2O5YL 3CUPB 1U3NA 1ZA3A 3RWHB 3STZA 2C7UB 1QLEL 1V3MA 3K6IA 3PGCA 3D9AH 4G6ML 5EEXA 4PLNC 3FRPG 4XHJC 2LFGA 5IWLA 3MOBH 1UOVA 5AVZB 3T0AA 2PW2A 1XDTT 1CL7H 1YA5A 2DQCL 4XAKD 4FG6C 5D8JH 5D5MF 5E4OA 5F9WC 3VI4A 3WIFA 1MHEB 4HJJL 2R0LH 3MRLA 1LEGB 2X42A 4G6KL 2C1PA 1YEKL 4EI5A 1OT4A 4IMLA 3GXDA 3K2KA 1QHPA 2XYBA 1ETB1 4JFYA 2JELH 4GRLB 2A6DB 4TUKL 3CN4A 5MEPB 1HXYA 3MJWA 2JLLA 4L8BA 2LTQC 5ACZB 4MA1B 2E7LA 1YNTA 4OD1L 4Y9GA 5CJQH 1J0IA 3GLAA 2C5DC 3QFJB 4UANA 1F02I 2NSQA 5EOQL 3RWEB 2N56A 4KK8D 4HALA 4R5XA 3N85H 2YD4A 4K9JA 2OTUA 1PG7X 2XTJB 4OGXL 4OY9A 4XVJH 3KWWA 5F7EL 3DRQB 2Y7OA 2H4EA 4FN0A 2Q76B 2IF7A 3V5DA 4AMKL 5IHLB 3NRFA 1LP9E 3C60C 4W4NA 4ZX6A 3DIDA 3ROOA 3N85L 3IDXL 2BMKA 3J7HA 4GPVA 5SV4A 4F20A 1JMZA 1CYWA 2XIDA 3C5SB 5AW8B 1WT5A 2KMWA 1K8IA 2MWCA 5B1AB 5FUOL 3P30L 4XAKE 2PCFB 5TE4H 4XT1C 3T0DA 3FT9A 5CLXA 2DF3A 3L48A 2VR4A 1ZLSL 4BIKA 1WQVT 1PLAA 4HIXH 1S9VB 3W39A 1QSED 4RESB 4C83B 3S37X 4LEOB 3K6OA 5J11B 3IS1X 4O58L 3TPKA 2BY0A 1IAOA 4M7JH 4UDTB 4E9XA 1CLYL 5B4MD 1LO0H 1UH4A 2JB5L 1MW3A 3RY6A 2CXGA 4LCUA 1BM3L 3GSXA 5D8JL 4LCIH 3QORD 2Y5QA 3G08A 3Q2NA 4N8VA 4BH8A 2J6EL 3M17B 4DKTA 1TNMA 3IU3B 1DVFB 2BWDA 1VEMA 4HA1A 3PV6A 1GS6X 2Z7UA 4OIIH 5F7AA 2LE9A 4K8RD 3S37H 4GAJH 3DTUB 3ZR6A 2O5NA 4WFGE 1U3ZA 3MR9B 1MCJA 4ZT1A 3V5DB 2CR3A 2F68X 5BRZD 4ETQA 1AQMA 2LV4A 5DYOB 2J3SA 5BNXD 3WEOA 4DUWA 4KK9C 4IIQC 4BSWB 1M1XB 4BK4A 1OGTA 1XTLA 3BP6A 4IK7A 4NOBA 5CU5A 2VM4A 1SYSB 1T2XA 5KSAC 2YD7A 4LASH 1KSRA 4H26A 3FN0H 4KJPD 4JUSA 4UIKH 3QUYD 1RUPH 2Z8SA 2Y6SC 3IAPA 4LEXH 1MREL 4PVLA 4JFDB 3QWNA 4J12A 5DVOA 1EHLL 4PJ8C 4N25A 2A77L 1KXVA 3UYPB 5AZEL 3CQQA 4E0RA 3G9VA 3WNLA 3CTTA 5A3IC 4QXGH 5ACLA 4OFQA 4OD2B 5F7NC 1DANT 1HJBC 4N0UA 1D6EB 1U30A 1XF4B 3OZ9H 3DJTA 5I15H 5B1JA 1KFAH 1TJXA 1WYJA 1TLKA 4GH7B 5H35A 2X2IA 2B8OT 5KSVB 1MFMA 2DQJL 1FYTD 2R23B 1UZGA 4LEOA 4OV6F 4HKJB 1B3JA 1IGIH 1VZGA 1MIML 1NBZB 2UY6A 4FXGA 2BWIA 2ZP8A 3QNZA 4PV8A 2XN9A 2VQUA 4HZLB 3GMMB 5JO5B 3QJHB 1MFDL 2OPCA 2JI2A 5B7FA 4Y16B 1DLHB 1LK3H 2VJ8A 3GK8H 3QAZB 5ICZA 2R15A 3B9AA 3UPCA 1S7SB 5EUKA 1SYSA 2R0ZL 2RA1A 4NAJA 3S35H 4BXVA 1RZFH 5BRZB 3VG0L 5KAQG 2G5BB 3EFOB 3ZZQA 1LE5A 1TQBC 1W0WB 4XNYH 1K5NA 3AZUA 4J5VA 3WNKA 4P2CG 4G9FD 3JVGC 3GEFA 1S7RA 3MNWB 1AO7E 3A47A 4TNGA 4XBGA 1FJ1B 4B9YA 1MQKH 2X9WA 2E9IA 4AITA 4EOWL 1ZHNA 5L88L 3T8XA 2ZE0A 3V4VH 2E7CA 1GPOL 3NJMA 2I9TA 2B59B 1HCVA 1MCOH 4L4TB 4QTHB 3PDOA 2DLFH 2G75A 4TQ8A 3VNZA 3WS3A 4UOZA 1DVTA 1SJEA 1YECL 4I0CC 5I0ZA 4JLRB 2OYMA 5HPMA 4H25A 3LH9A 3CDZA 1IV8A 1VDGA 4QRFA 1E65A 4FXLA 4GKOA 1A6WL 1JI2A 1JHLL 1IAOB 3G04B 3S48A 5IJBC 1CYXA 2DQTH 1AGCB 1S78C 3T6WA 4AOFA 3UJTH 4UV4L 2WIIA 2ED9A 3TV3H 3ZIYA 2BNRD 3LRSA 3UAJC 2PP7A 5EF0A 1JXJA 1IM3D 3BDYL 4FADA 2AJ3B 3QFJD 4FNSA 4FFYA 2IWKA 4KQ4L 1YMMB 4NKDA 1JTOA 1OCWH 1P7QA 3T0WA 5EZJA 5E8DH 1DVFD 5I6OA 2ENSA 5BZZA 3P4NA 3EGSA 2CD0A 4Z3FA 3RVUD 1R5VA 3GIVA 4P2RB 4TNVK 2WINB 3RKDD 3S36L 5B7EA 4B9IA 1XCTA 5FEBA 1RJLA 4ZUVA 3M7OA 2Z8VC 4KI5E 1PU0A 2JKRM 2KPWA 3H9HB 4YAQB 1VENA 3B56A 3D07A 3MOAL 5JOFA 4LSSL 3KPLA 1XH2A 1PKOA 5AB1A 4PJFF 4KZDH 2VRAA 1YUHA 4MAYB 3P9MA 3PGDA 4HLJA 1MEXL 1TO4A 2WY3B 3SDDB 2XWJA 4WGVB 4AH2A 1HHIA 2WTRB 5HDBB 1TLMA 3ZE0B 5DUBA 1TQUA 1S7RB 3KLDA 2QQNL 4PGCB 3PWUA 2QZQA 2X0VA 2XWDA 5AYTA 2NY4B 4NO0B 5GS0H 2IAMB 1K2DA 2R4RL 4BKSC 3ULUC 4B27A 2HZHA 3GZQA 4N24A 3NIDB 3QNXA 4YO0A 1H15B 4KROD 3RAJH 4J3OH 2WWOA 1WA0X 1CGVA 5MEQB 3Q44A 2J43A 4LSPL 2DOCA 2FHBA 2OJEA 5L2KE 3VQ2C 2RFXB 2K78A 1EXGA 3VSTA 5CCJA 2EXYC 3DMMD 1BIHA 3HG2A 1UFGA 2Y06L 3X14B 3F7YA 1N64L 2JKTM 1TZAA 1NAMH 3IDGA 5IK3B 1C5DA 1QSZA 1T2QL 1FH5H 3PL6A 3QZPA 4XAWH 4EVNB 4HOXA 3PNWA 4QAMB 2EYRB 4TM9A 4HIIB 1SHWA 4RBPH 4UZGA 4XMLH 1ZJBA 4F7PB 5C92A 6CGTA 3OR7B 1AGCA 4UNIA 2YXFA 3FO2B 4GUPA 3O8XB 4OZHF 4GAYA 3SJVA 2AXHA 1NLDH 4U1SB 5SX5H 3VRIB 4ATWA 3HB3B 4R3SA 5FLVA 1BMZA 5FGBC 1N0XH 2CK0H 1FZKB 1NC2B 2XQYG 1D6EA 1EZUA 2EEDA 1H8OA 4PYGA 3AQZA 2YXMA 3KPNA 3DVIA 3HEIB 1DVFC 1U3YA 2QHRL 4HJGA 1BM7A 4HOZA 1N7MH 3JV5A 4WUKH 3CK0L 1Z32X 1KLUA 4XN7A 2PPDA 1AKJD 3QJXA 3MJ9H 4NCC1 4HUVA 3GSOA 3NSXA 5LVEA 1I9IH 1RD6A 2FNWA 4XP4L 3RNKB 4HEME 3MJ9A 2APBA 4R97C 3C2AL 1F56A 4L8CB 1F90L 2OL3A 3WO4B 2P44B 4A2HA 4AQAA 2AZAA 1UZ8A 2DMCA 4XO5A 1PW3A 1OTSD 5HI3C 4CDGC 4PQXA 5CEXB 1IBFA 1KFGA 2QVKA 2HJKB 4MLIA 3GLEA 4U1LB 1N19A 1FZMB 3QAQA 4K3HA 1I1AC 3FCTB 1HEZB 5TF1L 2EP6A 3HUJB 1WEJL 4JAMA 3WHXA 2W9EL 3P02A 1E9QA 3EJCA 2E7MA 5GIRB 3QZBA 1MFCL 2CO7A 1VFOA 2V33A 3UAAA 3H4FA 4O5LL 2VE6B 3L6FA 3CH1B 4CVUA 3OF6A 3UTQA 4RGOL 2I25N 4XO8A 4ZXBA 3HA0A 3FK3A 4IU2B 5HD8C 4A04A 2H3NA 1JWMA 1UD3A 2YAPA 3EZ8A 5GGSA 3MLYH 4UIMB 2F2HA 2LW3A 3GTNA 4KXDA 2XWXA 2ZUYA 5CEYB 3DTXB 3D2UA 4PTTA 3G5ZB 4P5MA 5IFAL 1XMWA 2P47B 3X1EA 1ZY9A 2VABB 3LXCA 4HKBB 4ZUTA 4QWWC 1JK9A 4JY5H 4RLDA 3UZVB 3GBLA 4FNTA 1ZOXA 1T4KB 1JXGA 3A4EA 3VFWA 3L4VA 4PSPA 4S11A 4P5RA 3WKMH 5C3TA 3V6OE 2TAAA 4AQAB 2ZSVB 1QNIA 4HCGA 5IHUH 5HSFA 4KKAD 4JREC 4O5LH 2IWFA 3V5KB 3X2QB 5GGUB 4QO1B 3UYRH 4J3TA 2F8OA 4KQ3L 3PGDB 2NTSP 1JHTB 3UO1H 1XBRA 3O3DB 2OULB 1N6UA 2E6PA 1KGYE 2Y3NA 4JJ5B 4L3CA 3B2UD 5ESAA 5EUKB 4NUPA 5KSUA 5AAWC 3GXNA 4LMQI 4YHLH 3FU7A 4FF9A 4TUOB 3PUUA 2UYLA 5CJBA 5I8KL 5I1HL 1HEJC 5DHYA 1M57B 4X98A 4PRID 1T5WA 3I6KB 4P3CL 1GXEA 2QADC 1UACL 3C2AH 5F7UA 1AANA 5E2WL 2NTFB 2VLRE 2XQ0A 2NZIA 1ACYL 3QHTC 4G11A 3V4VB 3BWZA 4GW5A 2GB2A 3PWPA 5T3ZL 5BV7L 3EOBB 1HCYA 2P24B 4NI3A 2VXTH 1S9YB 4FI7A 3I6LE 3E6HB 2K6WA 2M26A 3HPJB 4AQOA 2X4PB 2W60A 1ZHLB 3CZUB 1N9PA 1YN6B 4LVEA 3VWKC 4DO4A 1BQRA 1DBKH 3MRPB 3MUJA 1KJ2A 1HEHC 4K3JH 1AXIB 3AQXA 4QRUB 5LB1A 1CD1A 3IXTA 2YAHA 3ARGB 2X1QA 4JPKL 3ZDZF 1D5RA 3P11H 5E8NB 1URIA 1G6RL 5DJAB 1MNUH 4B50A 1RL1A 2FJUB 4XPGL 5I8CA 4G7YL 2XXMB 3VH8G 1O0VA 4CC1A 4K73A 2ARJA 4FFVC 2AXGB 3GSVA 2XTJE 4D94A 3EYUL 2NW3B 1IBGL 4MJJA 1BREA 4NBXB 1AVAA 5ILTL 4FTVA 1AIFB 2NR6A 3APDA 5IOPB 2EIMB 1M42A 4EIUA 5IHZB 1ROWA 4K3EH 3VI3F 4AGMA 2OR8A 3DXAD 3O2VL 4R4BA 4MASA 3RWGA 1EAOA 3WDHA