1KDIA

Reduced form of plastocyanin from dryopteris crassirhizoma
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
102
structure length
102
Chain Sequence
AKVEVGDEVGNFKFYPDSITVSAGEAVEFTLVGETGHNIVFDIPAGAPGTVASELKAASMDENDLLSEDEPSFKAKVSTPGTYTFYCTPHKSANMKGTLTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure and unusual pH dependence of plastocyanin from the fern Dryopteris crassirhizoma. The protonation of an active site histidine is hindered by pi-pi interactions.
pubmed doi rcsb
molecule keywords PLASTOCYANIN
molecule tags Electron transfer
total genus 22
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 1998-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1kdiA00
6PAZA 2BZ7A 3IN2A 1PMYA 1AZNA 1SF3A 2IWKA 2BWDA 2XVBA 2HXAA 3QJRB 3V9CA 3OMIB 1BXVA 2VN3A 5I5JA 4ENZA 1BEXA 3NJNA 3KW8A 4K9JA 1KBWA 4KO5A 4BXVA 2Q9OA 1UATA 3TU6A 1OE2A 5I28A 3WNJA 1BQ5A 4FA7B 1W6LA 1RKRA 5B1BB 1JZJA 1L9OA 1L9PA 2QPEB 2YAHA 4Q89A 1FA4A 2YAQA 4KNTA 1CYWA 5B1KA 2AANA 4E9YA 1RZQA 1AS6A 3N55A 4DP7X 2BP0A 3FQ2A 2YAMA 4KO9A 4DP5X 1NWOA 4AI7A 4G7SB 3WG7B 3PAZA 4AZUA 1BXUA 1MDAA 2FQEA 3FU9A 1IBZA 3JT2A 1TEFA 4YVUA 3WKQA 1PF3A 3CDZB 3CZUB 1EZLA 1ZIAA 3ASOB 3NJGA 4YSPA 2GHZA 2TSAA 1L9QA 4KOBA 4A2EA 1WA1X 3NP3A 2DV6A 1XB8A 4DP9X 2PPEA 4NAJA 3D12B 4DPAX 1JXDA 2CJ3A 3HEIB 1GR7A 2ZONA 2J5WA 3FQ1A 2CBPA 3BVDB 2GSMB 3FPXA 4QKTA 1FFTB 3X1EA 5B3SB 4YSQA 2Y1AA 1ET5A 3AY2A 2XYBA 4YSRA 3NSCA 1MG2C 4G7RB 3UACA 1X9RA 4E9RA 1BYPA 4HCFA 2DWSA 4BWWA 4P5SA 2WSDA 1W8EA 1GW0A 3FU7A 3QJSB 3ZBMA 3H56A 3FQYA 4DPCX 4RH4A 1KDIA 1IC0A 1NPJA 2E86A 3PXLA 3NSDA 1J9RA 2BP0B 2HX7A 3H4FA 4QLWA 3NJIA 5I6MA 2VM4A 2PPDA 3UAAA 2OJ1A 5B1JC 1J9SA 5B1AB 3WKPA 2UXFA 3UGEA 3FSWA 3H4HA 3TBBA 4A2FA 2ZXWB 1PAZA 1PLAA 2DYRB 1JVOA 2FNWA 1CYXA 1OE1A 1RZPA 2GIMA 3OM3B 4AKQA 3EH4B 2VW7A 1HAWA 2H3XC 1AOZA 2YQBA 1CURA 4HZ1A 4BWTA 3FSVA 1V55B 2UXVA 2IDQA 2IDSA 3QQXA 1GYCA 2IDTA 3EHBB 3S3BB 3ABKB 3X1NA 1N70A 1AZRA 3T6VA 2FQGA 3AZUA 2EIMB 3AG1B 4DPBX 4NERA 2IH9A 3S3CB 4E9VA 4E9QA 1ETJA 5I6KA 1J9TA 2J55A 4E9TA 2FQFA 1MZYA 1OCCB 4KO6A 1AS8A 1DZ0A 3FS9A 3AG3B 4G71B 3OD3A 2QT6A 2DYSB 1L9TA 4CSZA 5EHFA 3PAVA 4A68A 1PY0A 4UF7C 2J56A 4DP0X 1B3IA 3U25A 1N68A 2CCWA 2XX0A 3X1BA 5I6LA 5E9NA 1SF5A 1IKOP 1ASOA 5B7MA 3NJMA 1JZHA 2QDWA 9PCYA 1QHQA 5IY5B 1J5CA 3C75A 3NJJA 3T6XA 1RCYA 2YARA 2YAEA 1SFDA 2TSBA 1EHKB 1HFUA 1NICA 1PLBA 2B08A 2JXMA 3OQRA 2BP8A 2XXFA 4YVNA 3TA4D 2GB2A 3FSZA 4BXSV 4FAAB 1M9WA 1PNDA 4KNUA 1AR1B 4TXVB 5AKRA 1NWPA 2A3TA 1KCWA 5B1JA 2HLEB 2VW4A 2I85A 1ASQA 4HHGA 3QJVB 4KOCA 5I26A 1A4BA 1M57B 2BHFA 2PP8A 2R7EB 5AZUA 1SDDB 2XX1A 3PCYA 3X2QB 3ABLB 3PLYA 1WAEA 3IBOA 2NRDA 4YL4A 4MFHA 3GYRA 2P80D 1AZCA 1ZPUA 2UXTA 3CG8A 3PAUA 1E5YA 2X88A 2BW5A 1ILSA 3FPYA 4HAKA 3WI9A 2CALA 2PCFA 4GP8B 2QDVA 4GYBA 3ASNB 4JKNA 3ERXA 4HCIA 3EH3B 5I6PA 3S3DB 1BQRA 1OE3A 2MTAA 4PCYA 1E5ZA 1L9RA 2BZCA 1GS8A 1JXFA 1ET8A 3AG4B 1AAJA 1AZUA 1QNIA 2BP8B 3FT0A 2UXGA 4A67A 1OF0A 1OCZB 2XLLA 1BYOA 1GSKA 2XV2A 3ZX1A 1KYAA 2OCCB 1BQKA 5A7EA 4E9SA 3DKHA 4DP4X 4BDVA 2VSKB 1KGYE 1R1CA 1KCBA 1ID2A 4DP6X 2GI0A 5ANHA 2ZWNA 5D4JA 4YSSA 1MG3C 1NIBA 2FTAA 3L45A 4AKOA 1VLXA 1GS7A 4M3HA 2LLNA 3QPKA 8PAZA 4A2GA 3QJUB 2I7OA 4A66A 1AACA 4E9XA 1A8ZA 1SJMA 5PCYA 1SFHA 3QJTB 4N8UA 5TK2A 1HAUA 1M56B 5I5IA 4G7QB 3FSAA 1NINA 1KBVA 2YXWA 1AANA 2Q5BA 2VMJA 5LDUA 4E9WA 1CUOA 4EF3A 1CC3A 1T5KA 2BWIA 3HB3B 1PNCA 2W8CA 1SNRA 2YXVA 1SHXA 1TKWA 2MRYA 2X87A 2PPFA 1NDTA 5D4IA 1WA0X 3UAEA 2XWZA 4HIPA 4YSUA 3T6WA 1JZFA 1JOIA 2EILB 5TK4A 3NSFA 4PAZA 3DIVA 1FWXA 5FC9A 3AW5A 1AQ8A 1MZZA 4G72B 3NT0A 4G70B 4BDVB 3AG2B 2GC7C 2J57A 3DTUB 3FU7B 4UANA 4DP8X 1ILUA 2GC4C 2DY2A 2VW6A 4GY4A 3NYKA 3X1GA 2IDUA 2WO2B 1E67A 4GP4B 1ZDSA 2YAPA 2AZUA 1JERA 4JHUA 2H47C 4YSOA 1SHWA 4N4YB 3NSYA 4AKPA 3BQVA 1XB6A 3CDZA 1OOWA 2FWLB 1JVLA 3GDCA 1PZBA 4YSEA 3NJFA 1OV8A 3G5WA 4HALA 3T6ZA 3CVDA 1NPNA 2HRHA 2N0MA 1PCSA 2IWFA 3SQRA 1XMEB 2XV3A 2AZAA 1NIDA 1X9UA 1GY1A 3WNIA 2EINB 1ADWA 1KV7A 3IEAA 3NP4A 2HRGA 4F2FA 5AFAA 3KW7A 1NIFA 3OMNB 1JZEA 2BO0A 3ABMB 2UX7A 4HHWA 4DP1X 2XUWA 3RYMA 2FQDA 5D4HA 3MX0B 3T71A 2XV0A 3T9WA 5B7FA 4ZK8A 1PLCA 3NJHA 4YSDA 5F7AA 2QPDB 2EIJB 2PP9A 1KDJA 1TEGA 6PCYA 1J9QA 2RACA 1AIZA 4GP5B 2BW4A 1NZRA 2IAAC 2JKWA 3IE9A 3EF4A 1A65A 1PZAA 2JFCA 4A2DA 1JZGA 1BXAA 1AG0A 2UX6A 1PZCA 1NIAA 1GY2A 1QLEB 4W9ZA 2I7SA 1A4AA 7PCYA 1IBYA 2DWTA 2OV0A 2YAOA 1ZIBA 4KNSA 5PAZA 2CUAA 2HZHA 4UAHA 4AX3A 4Q8BA 4WTQA 3OMAB 2AVFA 3PPSA 4P5RA 4F2EA 4KO7A 1V10A 1ASPA 2FT7A 1WS8A 2FT6A 4WKXA 5B7EA 2Y69B 2EIKB 1AZBA 2IWEA 1URIA 1ZDQA 4F7KA 1XB3A 2YAFA 3WIAA 3CVCA 1AG6A 2IDFA 2FT8A 2H5UA 3V9EA 3N2JA 3X1FA 1OCRB 1ZV2A 1BAWA 2PP7A 2CAKA 3ZDWA 4GXFA 3TBCA 1I53A 1V54B 4HCGA 3GXUB 1ET7A 3TASA 3ZIYA 2FJSA 1J5DA 1F56A 4A2HA 3ABGA 1A3ZA 3FU8A 4L0PB 2ZOOA 3FYEB 4BWUA 1NIEA 3NJKA 1IUZA 3MBWB 2AFNA 2PPAA 4NB7A 1WA2X 2B3IA 2IH8A 2XXGA 2PPCA 4YSAA 2VM3A 3NJLA 2P80A 4M4RB 2PLTA 1W6WA 3S8FB 5I5MA 4JHVA 3S8GB 3IN0A 1GS6X 5I6OA 1DYZA 3EH5B 1YLBB 2R7EA 1E65A 3UABA 1AS7A 1NTDA 1SDDA 3CVBA 3SBPA 3JTBA 4X4KA 3SBRA 1JXGA 1JZIA 2HX8A 3FYIB 1E30A 2VSMB 4DP2X 2XU9A 2HX9A 1A4CA 1L9SA 1TU2A 4YSTA 2GBAA 4CSPA 2W88A 3UADA 4YSCA 4BK5C 1OCOB 7PAZA 2WO3B 5F7BA 1WS7A 3SBQA 5I6NA 3QJQB 4W1TA 2PCYA
chains in the Genus database with same CATH superfamily
3FCGA 5DK2B 3NH7L 4QXGH 3MJ8B 2KDYA 4DO5A 3HR6A 3PWVB 5ERWA 2VNCA 1JWSA 4K5OA 4P2RA 5T1MB 1MWAL 3BH8B 1BEXA 1IBGH 3FMGH 3HC3H 3KW8A 4J7RA 4OCYH 1N10A 4PJ5A 3BPOC 5EZIH 3WFBH 3G3LA 4HGWA 4XRCA 1PX8A 2FECI 1VADA 4NQVB 4N5UA 4PRID 2WUCH 3DX2A 2V5MA 5IWLC 3BPNC 4HV8A 3WKNA 1VACA 3T4AA 1YY8B 3WO4C 2Z35B 4MMYB 2NY0B 3DI2B 3QIUB 2BIQA 3TN0D 5FWQA 3HR5B 5JA9A 2X44D 3PGDB 3ZMEA 4FLOA 2X7LB 2QR0A 4U0RB 4DP5X 1MJUL 3GWJA 2B77A 4U1IA 4YGVA 3TN0C 3VQ2C 2X41A 1WITA 2IXQA 3OLDA 2E3VA 5DD0L 4PY7A 1O75A 2IF7A 1KCRL 5IESL 2IBZY 4JZJA 1INDH 1ORQA 3LN4A 4CVZB 4OM1H 5I8CA 4QHNA 5AUMA 5JO5B 3FUFA 3KPQA 4YHYC 1C8QA 3U2JA 4M8RA 2EDOA 4PP2B 1YJDL 4AV5A 2DV6A 3F6IA 1OAJA 1IE4A 3BZ5A 4AENA 4UB0H 3QUZC 4RMWA 5DZOA 1K2DB 1RZJH 3C08L 2E46A 2BOLA 1EVUA 2Y36H 3FPXA 3IJ9A 2WMPA 4IJ3B 5CJ8A 1BJMA 2UVFA 1G6RH 1NM4A 1SJXA 3DARA 3EJYC 1JTPA 2QBWA 4KY1L 3NZUA 2Z31B 4MNGB 2O6EA 5L2KD 2XT1B 3HNVL 1NAKH 3GUTA 1QZ1A 1I75A 2WNXA 2X2IA 1PG7W 1NFKA 4WI6A 3JSSA 4FFTA 4NQUA 3UG4A 4I48B 1ZHBB 2HX7A 5AVRB 1KB9J 3QI9B 3IDIA 1KTLB 4MD4B 2VM4A 3UAAA 1IFHL 3C09C 2B39A 2R4RH 3O3EB 5BQDA 4DK6A 3QZNA 1NBVL 3VXRD 5KG9A 4NQCE 2RB8A 5E5UB 4XNYL 1EBAA 5ADPH 3UERA 2V7NB 4JZNA 1BZOA 2GIMA 1BFVL 3TEWA 5D6DA 1IGMH 3IKCB 5F9JA 2VWEE 3I9PA 1IC7H 3UROR 2BNRD 2PCPB 4AYGA 4HZ1A 2LV4A 5CBAA 3HCVB 3IVKA 3DUUB 1OY3B 5JLZA 1F86A 5ILTL 3S4SB 2E27H 2HFGL 2YGOA 2X53A 4YDKL 5I1KL 1CTOA 4IS6A 3QCUH 3QUXD 3EJRA 3HN8A 2VABB 1Z5LA 4XP6L 2EDDA 5JOPE 3CJJA 1J0YA 3GMQA 4ZSOE 4JN1L 2DM7A 5HDBF 4NRZB 3SY0B 4R9HA 4PV1C 1RJLB 3QUXC 2VQ1B 3X13B 4ZZFA 1SXBA 3UZVA 3UDWC 4XVTH 4L5FL 2A77H 2WHVA 1OP3K 1Y6MR 5F0LB 4KZCA 1XDTT 5D96B 1D7FA 1QP1A 3U25A 2P5EB 4AWJC 3U36B 3X1BA 3QDJA 5DZJA 2E59A 1RLWA 3MFFA 3QUYA 1J87A 3PF2A 4GKLA 3VWKB 3GS4A 2LVEA 2ZOWA 1NFDE 4F24A 1J5CA 5DRNA 2C1OB 2YAEA 4HWZB 3V5KA 3DMMD 2B08A 3DECA 1CE6B 3QUMH 4YPGB 2BP8A 4YLBA 3SD2A 3SDCB 4C47A 1AGDB 1U42A 4M7LL 4GUPB 4HUMB 1B90A 1DTUA 4JY6B 3HE7B 4WWKB 3DMMC 2C3GA 4F1SA 1WFTA 4IRSB 4LK4A 3S36L 2BSCA 2JI3A 5I23A 4KOCA 1ZLWK 3O11A 2XVGA 1M57B 3DI3B 3NMEA 3LVEA 3U30B 3IFPA 4QHLB 4FQXC 1ES0B 1XF5A 3E6HB 3IFNH 4LEOB 5ESQB 1PGRB 2Z8VC 1MCDA 3MRLA 3TV3L 4PRPE 4H13C 1TQUA 5C07E 1T4WA 1H8NA 3SGEI 1RK1B 2NY2D 5JHMA 4KRNA 1TU2B 4N85A 2OBGA 1JFHA 3CZKA 1ZA3B 3V0JA 3ATAA 4H8HA 3CDCA 2X88A 3E6FB 4X8CA 4HF5L 3BLBA 3QFDA 2NY2C 1C5CH 4V1DA 3CCHA 3GMMB 2XZCL 3BPLC 3ILPA 4R4BB 2Q3XA 3IXTB 5I6PA 5EC2A 3AREA 3B3BA 3GTVA 2CA4A 4XCCL 1FDLH 5LGYA 4Y88A 5JOFB 1NKOA 2LGNA 3K6IA 4P2OD 4W4OC 5IROC 5CF3A 1VGKB 4K8RD 2JVUA 3GK8H 3W2DL 3W57A 3POHA 3D3VA 2BS8A 4O58H 4I3SL 4NENA 1JGLL 1EO5A 3P54A 4RZCA 2FGWL 4OQTH 3PJSB 3QIWD 3MRNA 1TXKA 2O26U 1KCBA 2WVVA 3L4XA 3P1VA 4MXVF 4OKVA 3KPPB 2EDJA 4U1LB 5AVUB 5IKCA 2ZWNA 4YSSA 1HH6A 3PABB 1K4CB 4O02A 2NY4D 3W39B 2VXSL 4L1TA 4U31A 3K8KA 3PY9A 5ACMA 4PJFF 1E4WH 4AMKH 3UX9B 4KTGA 1J7VR 5TK2A 3UTZB 1D3CA 1V7NH 3MKGA 1KBGH 5IFHL 4QCIA 3D8MA 1P5UA 2DQ6A 5BZWB 1CUOA 2XQYG 5D7JA 5DFTA 5TDNB 4M6ML 1Q9OB 1MCLA 2K45A 3CDFA 1SHXA 3A67H 2MRYA 4LEXL 1QFPA 5DSCA 3SGEH 1XR9A 1K8DA 2DQGH 3VFSB 3BJLA 5TDPA 1BHGA 5JHLA 2ZOLB 1Z9NA 1MREH 2J71A 4K3EH 2VLRB 3LCYA 1RIUL 3IMUA 1TJHH 5T5FL 1J8RA 3ARPA 3QUGA 1EJOL 1AQHA 2UYLB 1MZZA 1E8ZA 2YKLL 1HH9B 3NA9L 3UTQB 4AIOA 4DERA 5F3BA 1C08A 2DLFL 4JFXA 1RUAH 3L3OA 2DPKA 3N43B 2B7DT 4EI6A 5HYJD 2WO2B 1A6AA 1XGUB 1ZDSA 4OF7A 1M2OA 4WI0A 4OIFA 3R19A 4G43A 4HCRL 1TLKA 4F8OA 4B41A 3RDTC 5J13B 1UWFA 5GGSA 1UD3A 3B2PA 2MNJB 1IGJB 2IFFH 2A5UA 3GMRB 2H26A 4I0PB 5FHBL 1R5VA 5IMKA 4XAWL 1LWHA 1FIEA 3M6DA 5CILH 1S9WA 5IBTH 2Q8BH 3BGMB 4H8UA 4Z7NE 2OK0L 5FA3B 4F57H 1EHAA 1SY6H 3ASWA 1RHHB 4EKXA 3RWEB 2BO0A 3IKKA 3Q1SL 1C7SA 2B4CH 3BT0A 3DJRA 4KVCL 2FQDA 3X3GL 1HZKA 3ZO0A 3ZE2F 2FVNA 3TF7C 1YEWA 4XBGB 1QPKA 3DVIA 4R5VA 2D4FA 2OXGB 1F6FB 2PF6A 4FG4A 1AFVH 1EANA 2BK8A 3EF4A 5EIQA 3BUQA 3P4OB 1WHOA 4Z7VA 5AW1B 1UM4L 1KFGA 3DNKA 3QNXB 3VXMA 3UXFA 3U6RA 3ZQWA 1FF5A 1E6OL 2DWTA 1XSOA 3IDJB 2OJEA 4YEEA 3DHMA 3TM6A 4Z7WE 3HE6C 5GS3A 4GXVL 4AX3A 2X9ZA 3DGGA 4WTQA 3FT2B 3MRJA 2CUMA 4P5RA 1NCAH 5T1KA 2JWYA 1ASPA 4NHUA 1E5CA 1OP4A 2FCBA 2IPUK 4J3WA 4C8XA 4G8IB 1WPCA 1XAKA 4U6TA 1IQWL 3GBEA 3QE5A 2CIKA 5F72S 1TITA 3QARA 2ATPA 2R23A 3L9EA 2HMIC 2VN6A 1A47A 5F7DA 3SKOB 1T7ZA 4R5TA 2QADB 2ZX9A 2IJ0C 3EJPA 1UUSA 3L95A 1Z5HA 3D39A 2ZF9A 2OMVA 3NRQA 3OJMB 4MHHG 4PJXF 5DRWB 4GRLD 3E8UH 4FE9A 2P43B 5GRJL 5FGCB 4B27A 3G9VA 5KSUA 1QPXA 4NWTH 2XY1A 1ONQB 3TBCA 2MEJB 2XN0A 1S7TB 3R06A 3RVWC 3COOA 2EEXA 3DHUA 1JK9B 5DC4B 5E8NB 4E2OA 4Z7OF 3NEEA 1NM9A 5CD5D 3IJYB 4WRLA 3REVA 1F4HA 2ICEC 5CEXB 4PH8A 4JLRB 4ZUWA 4FNLL 1F4AA 4OLWL 3QEHB 1II4E 3IDXL 1D5RA 5BRZE 2XG4B 3P3UA 2A1WL 4MAYD 5IB5B 2WXHA 5CD5C 4JPVH 2XXGA 2E9JA 3GBDA 1NGZA 4WGWB 3VRLF 1DFBH 1MUJA 1SEBA 4PR5B 3CMGA 1OQXA 3F6LA 4MVBD 3ZZQA 1UZ6E 1J1PH 1YLBB 5I71C 3UABA 1SDDA 4KJWC 1D9KA 3JTBA 4DETA 3RVXC 3EO0A 4OD3L 4UIKL 1QTPA 4XVJL 1UG9A 4QHMA 3I9GH 4S1DC 1MFUA 5G5DB 4MVBC 1MW3A 2OMNA 4JKWA 4XN2A 5DS8B 1Z9MA 3ETBJ 5EUKB 3VXUB 5I2IB 3MUY1 4WV1C 2GBAA 2XWXA 1MHCA 3LKNA 2YPKB 4A38A 3SZ6A 4J3OC 4BIKA 1B9KA 1BQHG 2XKUA 4HZAA 1OCOB 3PQYD 4HUVB 5DK0B 2NXZD 2BJML 4LSUH 3KPRB 3FOLB 1JNHA 2OJZL 3UAJA 1M71B 3QJQB 2WBXA 3H1ZA 3Q3GB 3RIAK 2P8MB 4KX9A 2VERN 4B9FA 1IB5A 5DHYB 2JCCF 4F1ZA 2IWKA 4NO0D 1AHWC 5LGJB 2VAJA 5C0DA 1S7SA 4YHKH 2XVBA 4M48L 3TZVA 1MIEL 4MA3A 3HFML 3HC0B 5FK9A 1VRSA 4HWBH 4FKHA 4JFFE 4N2MA 2FJGA 4JO2L 3ZE1E 1M05A 1QMUA 3UZEC 3BFQG 2I9LA 3ISWA 1F18A 1S8DB 1RKRA 1ITBB 3ENEA 1GGCH 3MRFA 4B97A 4G7VL 4YFLF 3G5XB 4LCUA 3ULUL 1KJ2L 5LAXB 3U46B 2YGQA 3KGRA 1T3FA 2VZVA 1XGYH 2YAMA 4HUUB 4NN6B 4OV5A 5E99H 1HHIB 2QPSA 4J8QA 1IRAY 1NWOA 4ZS7H 3FFDB 1JWUB 4NNPL 4W9HC 2APFA 2Z92B 4WFGE 1NCHA 2WLNA 1NGXA 3EYSH 3DSNB 4NUJB 5MEPA 2LT9A 4OM0H 2DWXA 1BZ8A 4PS7A 3JWNH 3P2DA 5F44A 1L9QA 3F7YB 1P4UA 2HLFD 3HC4L 2BIPA 3RE0A 3FO0L 3GHBL 3PRZA 2PMZA 2BY3A 2GJZA 2E4TA 1AXTH 2Y07L 3D12B 4I77H 2I27N 3HG2A 5LBVA 2WLHA 4P2RB 3BVDB 5DMJB 1ZXKA 3O2DH 3ULVL 4JDTH 2Z64C 4NP4H 3L8QA 4PJ5B 1WZ1H 3VG0L 4EIZC 4GS7C 4HGWB 3MO1A 2IG2H 4XRCB 1MG2C 1G7QA 2R0KL 3D4CA 25C8L 4PRAA 1TR7A 1JV5A 1N6UA 2X6AA 1BYPA 3MV8D 4QRRA 4KUCF 4M9OA 4BA8A 2P5WB 1VACB 3CU7A 5IW3A 3T4AB 1JMZA 1DBJL 3H56A 5JR1L 2DWEB 5DR5H 5E2UL 5AW5B 5IV2A 4NFCA 4KNQA 3NJIA 4BFOA 3O4OB 2QR0B 3NUKA 1UENA 4LNVA 4YHIB 1VFOA 3QFJE 4XWOD 5HGHA 5A6LA 5C6WH 3HBGA 1SOXA 3RGVD 1U8QB 4X6EB 4YGVB 1AE6H 3FSOA 4OZFH 4PWEA 2X4PA 2IXQB 3BD4A 4R90L 1SBSL 1QO3A 3GI8L 3NZ8A 4KXZI 4PY7B 4UDTA 1WBYA 5BMFH 4OD2A 1IFRA 2BFGA 3F83A 2VRAA 4M7KL 3DJZA 3LN4B 3SE4A 1HOCB 5I8CB 4WIQA 3RGVC 2ZUTA 4QHNB 3ZTCC 1KIQA 3RILA 1P9MC 1RZ7H 4BSVA 3RZCB 2CDGB 1AGBA 1ZEAH 2ZXEB 2IDQA 4OIBA 2ZUUA 2EYRA 3S3BB 3L3KA 4FULA 4LL4A 4IHBA 4KXDA 3PNRB 3BGFC 5FYJD 3UAFA 5E4EB 3GGWA 5B8CB 2JKIS 4LHUG 4Z7UA 3ESVF 3MRQB 1QSFD 2Z0BA 1MIMH 4ZT1A 4KVNL 5JXAH 2W5PA 1M7DA 4LLWB 5GGVY 1OP5K 2B9AA 2O5XH 3RUGA 3ESMA 2AGJL 2Y1YA 4RGND 5J4MA 2I69A 4J3SA 3NZHL 1QFUL 1BWMA 3OB0K 2P8LB 4KKLC 2UZIH 4NNYA 5C0AB 3DC0A 1S78D 3W82A 1ETZA 2AITA 3IDIB 4OVUA 4A6YA 3ULUF 3B8SA 1ZVNA 2BIOA 2A6DA 2QL1A 5B7MA 4JREB 4P48A 1QEWB 4F20A 4UBDC 2XWJB 3W37A 3TEZA 1B0WA 2NX5A 1PG7L 4RAHA 4F9LC 4BFGA 3NA4A 5JPNA 5CZXD 2DJUA 5BVJA 5F9JB 4F7PA 2ROYA 4B0MM 4W9KC 4HLJA 1EWHA 1JNLL 3HG0A 3AROA 3LN9A 1TIUA 1NLDL 3UH8A 4I9XA 1NMBL 2I85A 3ARDC 3U1PA 3UTTA 3IVKB 1DDTA 3FRPA 2W80C 3VJ6A 1XCTA 5A2JH 2R29L 3IPFA 5FCSH 4ZTOL 4A7GA 3BVWA 4HX1A 4D7PA 4AE0A 4KXZH 3ZDZB 1Z5LB 3GMQB 2PYFA 5KSBF 5ICZA 4MFHA 4X6FB 3ULVF 1XF4A 2D0GA 1AZCA 4U1SA 3UZVB 3KYNA 2H0EA 5CWSA 3VSQA 1E5YA 5GJTL 4AEHL 1DVFA 3X14A 4ZS6C 2WNGA 4J3OF 4M6NL 1JCKA 5KS9B 2DQHH 3QDGD 2FR4A 2VC2B 3NIDB 5HHOA 5GS0L 3QDJB 5EC1A 3DV6B 2CR3A 3EH3B 5GZOD 4RBPH 1PSKH 2YLKA 5K5YA 3BZEB 1ZJAA 4HEPG 3GMPA 3QUYB 5JNYB 2W38A 3DXAE 3PP3H 4TUUA 4YHOH 4PCKA 1H3WM 5DRNB 1U3JA 4EDXA 4Q0XL 3WIIH 2BP8B 4FYRA 3BXNA 5GZOC 3GKWL 3AM8C 3FTVA 4DKFL 5GRYA 5AAMC 5LNDA 3LH8A 4JDZA 2JCWA 5HI3D 1NCUA 2VGLM 2LU3A 4Q6IC 4AQZA 5FGSA 4GJTB 3OR6A 4ZOBA 5DT1H 2EDQA 4A7QA 4WO4D 1XIWD 3GF8A 3DGDA 2WLJA 1GGUA 1I8UA 5HI3C 4DFHA 2QLYA 1SDAB 1XF5B 5IQ7L 3WLBA 3MRLB 1VLXA 3H9SD 3QPKA 1RURH 7FABH 4OLZH 4XNXH 5EU5B 4Q9QL 1VDGA 4WO4C 1NAMA 2EXWD 5F9AC 3T2NH 4PRIA 4N8UA 3NCYS 1CLYH 3F2LA 4Y4HD 3QPXL 5H4YA 2UV3A 4XO8A 3RWCA 1TNMA 2AJVH 2RD0A 1BVZA 3ARSA 1ZLVH 3QFDB 1QR1A 3ILPB 1BQLL 4WGKA 3TN0A 3IFLL 4D9QD 5GGUA 5AVSB 1DL7L 2WQWA 3CFDA 5I30L 3TFKC 3AREB 3O2VL 1BFSA 2FO8A 2X4RA 2JKNA 3DTXA 3U83A 1V3LA 4K4KA 4R7NA 3GLEA 4EUPB 4DQOH 2Y5TA 3R7QA 3S0PA 1LDPH 1S7XB 4QMEA 3D3VB 4YR6A 2XRAL 4JG0H 1RIVL 3N41F 3P2BA 1ECZA 1RUMH 2EIBA 4JGUA 2FBRA 4ODVH 4RZCB 4QRTA 4M62H 4OVVA 3W56A 2WVVB 4JQXA 1XO8A 4K5MA 1E2VA 2H8PA 1GA2A 2HG5A 5IKCB 1BBDL 3CHXA 1NCOA 3DO7A 5J6GB 1VAHA 1CD1B 1HH6B 1MKFA 2K1MA 3FB8B 1MCPL 4RMBA 4MMZC 3PGFH 4FMVA 1F1GA 2A9NH 4JS7A 5BS0D 2LU5A 1XB6A 4WFFE 1QPPA 3EFDH 4PBXA 2IPUG 4G8AC 3WIFA 1JVLA 3IJ7A 4FABL 2XTSA 3MRMA 4QYOA 3VG9B 1WFMA 4BFFA 5L2KA 1ZHKA 4L1LA 5DC0A 3U9PH 2CKBA 4XCNA 3KGTA 4Z95L 5JORA 4AIXA 1P5UB 1W16A 1NIDA 1FGNL 2WQSA 2XKNA 4L0ZA 5D7JB 1DDHA 4P3DA 4K71B 1J18A 1Q9KA 3CC5A 3P11L 2D3NA 5C0NC 1VFMA 2VDPB 2DYPD 5DSCB 2F6AA 4NJAL 1L0XA 1XR9B 4PB0L 1UJTA 4X7DC 5DUPH 1CLZH 1K8DB 4Y2OB 4RQQA 3KR3L 3FUMA 5TDPB 4NRXB 3VXRA 1WD8A 1A7PL 2QKSA 3VD4A 4HXAL 3QXTA 2WZ6A 2ZUQC 2R2CA 3FTYA 2QGCA 3WY2A 4JAMB 4K3DL 1WZAA 3L3GA 1MH5A 2YD0A 1ZANL 2VT0A 4UNTA 5KW9L 4XOCA 2BNRA 4JQVA 4PPTA 1C08B 2XA8L 4GKZA 4N1HB 4Q9RL 2WWMC 5EU6D 4EI6B 3N1FC 4Z78A 2KQNA 1A6AB 5F93C 3QUXA 1JGDA 4G43B 1U8PA 4NM8H 1Q0YH 2RIKA 2KUTA 1NOFA 5GGSB 3MUJA 1B4LA 2WB7A 3ARZA 2H26B 4FLQA 1XZ0B 1R5VB 2FT7A 5IMKB 3VI3A 4BUGA 2FT6A 2BIMA 5HYEA 2FEEI 1WUZA 3OKYA 4AZ8A 5EOCH 5DQDL 1R46A 2XFGB 5CR1A 4OF0A 1MRDL 1I4FA 4ZTEA 5A2AA 3EDFA 4MQXC 3H7BB 5C0CB 2BP5M 3Q6FB 5CN3A 4NKDA 2A6KB 5KVEL 1PFCA 3E2HB 5E1GA 2ENQA 4LAQL 2VUYA 2YPLD 4TPRH 3IMVA 3DMMA 2PP7A 2CAKA 4FFWC 3CBJB 5ES4B 3ZDWA 3W0WB 1A6TB 4TSCH 3FQWA 3GXUB 5AB2A 3MV9E 1OSZA 2DQTL 3L4YA 3H85A 4ESKA 1BF2A 1FHNA 1XHHA 2DM3A 2GJ6D 1MCOH 2W9EL 2RALA 3IJHA 2MTPA 3HLAB 3U6RB 5DQJA 1INQA 4K23H 3SPHA 4BZ2H 1QWNA 2OJEB 3B37A 5T1DL 1H6UA 5HHMD 4BWUA 1I9IL 3H42H 1IUZA 3MBWB 3NN8A 4P2QE 1FL5B 2EJ1A 2DQFA 3P2TA 3DGGB 3EGDA 3NACH 4EPSA 3MRJB 5AYUH 5LXGL 4M8QB 1F2QA 2F19L 4S0TD 3O6LH 4QNPF 4M4RB 4NHUB 2V17H 4R26L 2MWCA 3WUWG 5I15H 4X5LA 5IHZB 3ARGC 1OAKL 1XCXA 1SQMA 5E08L 2W59A 4JPQA 3H3PL 4OV6F 4HHAA 1BG9A 2CNYA 2EH8H 2R23B 3CVBA 4W4OA 4OLUH 3ZRFC 1DN0A 4RDQF 1T80A 5E1QA 3L95B 4ANKA 4NUQA 3HBZA 3S5YA 3D39B 1OB1A 3HB3C 4NO3A 1LO3L 3TCTA 4IRZA 1O7VA 1Z3GL 4FP8L 3QAQA 3RWJA 4P2OA 3MZTA 2W88A 4AL8C 4MKTA 4ZFQA 1QVOA 2EDYA 3QZLA 3ZRSA 1U58A 1N5AA 4UOQA 5D7LE 5A1AA 3MPCA 4K94L 2Y7QA 3UTSD 3SKUD 1CK0H 3MRGA 2ATKB 3NFPA 1UA3A 4HJGB 1JD9A 4MCZA 3C2AL 3DBXB 1LP9E 4U3SA 3WXVH 3QIWA 1PMYA 2FYVA 2R51A 4X5XA 3GZKA 1T0NA 4LVNB 5IM7A 3REVB 1G1YA 1U8OB 1TCRA 2V3FA 4ZUWB 2GY5A 1IBFA 4M8UA 4N8VA 1N8ZA 1XXFC 3TU6A 1OE2A 5CUSH 32C2A 4V2BA 1LO0L 2AABL 4N90D 2D73A 1MUJB 1NOLA 1SEBB 2DI7A 4RMQA 1GTFA 2MQCA 3C6LD 5AZEH 5D7IE 2IALB 5E2VL 2BP0A 1QFWI 1S9KC 4MBOA 3ATFA 3VGAC 3QG6B 1JCVA 1R9FA 4QHMB 2QTEA 3MRKB 2V5RA 3QO0A 4U6VL 1HINL 3JT0A 4N6QA 2E7HA 3GBNL 1TEFA 3JT2A 3NIGB 4UT9L 3LKSA 3LKNB 1MHCB 4RFNC 1T7YA 2AS5M 4BFKA 2R1WA 3AABA 5LWYH 1N6QH 3JWOL 1PKQB 3Q5TA 5K1JA 4KROC 3N44F 1UZGA 1ZA6A 2Y25A 3MTRA 2EE2A 5C0DB 1S7SB 4DPAX 3G5VB 4WW2C 5HYJA 3TZVB 4EMZA 1U8IA 2B59B 3BO8B 4MA3B 3DOHA 1PLGH 2IPTL 2FJGB 1FORH 1M05B 1U0QA 4AL8L 2UY6A 1RV6X 5IBLD 4GQZA 1V7MH 4A1RA 4HJ1A 3M8OH 2VLMD 4JB9H 2H41A 3K0WA 4KTEH 4HETA 1K9TA 1U8KB 4R96A 4LCUB 3UO1H 4DPCX 2J4WL 2X2UA 1W72A 5IBLC 2DBJA 3F7VA 2AQSA 4Y5YA 4OV5B 2AK1L 5D72H 4X50A 3PG2A 5B1JC 3TS8A 4FF9A 2WOBA 1WDAA 3FSWA 4N9GB 2F58H 2J8UA 2JLPA 3MLSH 3NCFB 5SX4H 3TYGL 3KMDA 1AKPA 3ZE0F 3S36X 2YFOA 1VKXA 4JFDD 3SN6N 1NGXB 3L5WA 1N4XL 5IB1B 5LBSA 2BY1A 4M93B 3WXWH 5EBWB 5MEPB 4UNUA 4WF7A 5AVWB 1NPUA 2WINB 2LQRA 4CRPA 4D94A 1GGTA 5H8DA 2NY3B 3QK0A 1RVFH 2DJMA 2OXHA 4BWTA 3MJGX 3GXTA 3G6JA 2OYLA 5C7ZA 2OYKA 4FQCH 5AKVA 1T22A 2FJFA 4F7CA 4QTHA 5AALA 1W91A 2GJZB 4XXDA 1IFGA 1A7OL 2FLBT 4HWEL 4DPBX 4LIQH 5BOZG 1Y18A 3WCYA 4HLZG 2DEYX 3MO1B 3M88A 5E6ZA 1GL4B 4FXGB 1JZ5A 1SJEA 4FQ2H 5LNEA 1CGXA 1JV5B 4QRRB 2K6WA 4G71B 3OD3A 5FLVA 2NOYA 2L04A 2Z8RA 4CSZA 5ADOH 1LL1A 3CPUA 1YNTB 2HRLA 4OLXH 4WK0B 3SDAD 4KMTH 1D7CA 4QRQA 1EZSA 5IV2B 2VXUH 1ZGLP 2BVOB 3E0GA 3VRJA 5LBGA 2C9PA 1M6UA 3QQNA 5HGHB 4QJ3B 2ZXGA 2AVGA 3SDAC 8FABA 1K3ZA 2YPVL 3B5GA 5CJQL 3UJIH 4LVOB 1QHQA 2HUEA 3C75A 3T6XA 2PYED 1QO3B 3NZ8B 4JGJA 4UDTB 1DJYA 1WBYB 3GHEL 2DQCH 5CEYA 4GRLA 4OD2B 5HPMB 4KKZA 1L6XA 1EJFA 4PJDF 2XN2A 4N8CL 4L9LA 4TXVB 5JW4Q 2BNQD 5KVFL 3SGKC 4WHYH 1KIQB 1FVCB 4ODXA 4BSVB 2ICEA 4XMLL 4U0QB 2C4XA 1P4IL 3VSUA 1VZIA 1WBZA 2EYRB 5AZUA 4JKPH 3L3KB 2V7HA 4B9KC 3RY6C 3WYRA 1DUYA 4FNRA 3GGWB 3OAYH 4JFOA 4P4KD 2F53E 4Z7UB 5L4IA 4FX5A 3MCYA 4DEPB 5H35A 3PLYA 4FZ8L 1D5MA 4L8CB 5J3HD 1CL7I 1AR1D 3HMXA 2J6EL 2L8AA 3MOBH 4MAYA 2AMUA 4J1UA 1TQWA 4P4KC 2XTJE 3SEPA 3LEYH 3C60D 3RUGB 5F9OL 1YA5A 4AYDC 5J3HC 4HUWB 1HL9A 3BAJA 2ZKWA 3MA9H 4GO6B 4NNYB 3GSWA 4HFUH 1ETZB 2HKHH 4A6YB 4FFVC 4LEBA 4WV1A 3GIZL 4AGOA 5HGDA 4IIZA 4Q14A 4XPBH 1QBBA 1G9EA 1J8HB 4TOYH 2NX5B 1CXFA 3DUSA 4ORGA 3VACA 3NFNA 2C1PA 3VWJB 1ANUA 2ICCA 3P0VL 5BVJB 5C3IA 4F7PB 4PS3A 1OAUH 2I24N 3PQYA 1A4JA 3CDGA 1FNFA 1E8YA 2IOIA 3ALPA 2VXQA 2ZCHH 3IU3A 4NCC2 2HG0A 2FJHA 2YOAA 1T1YA 4XHJD 4LF3B 4QRAA 3VJ6B 1ZSDA 3P3RA 1HL4A 5ESVA 3QSKB 4NO0A 5IUSA 4NO2B 4JM2B 2EDFA 4F37F 2DM4A 4HX1B 4I87A 3ZUCA 4B3EA 5DVPA 3VXOB 3NIFE 4NQXA 4XNUL 4HS3A 2PYFB 2PWEA 5ICZB 1XF4B 3CN2A 1HHHA 2CO2A 4IIQC 4U1SB 1BF5A 2ADIA 5F7UA 3KYNB 3KL0A 2UWEF 5EB9A 2HT2D 3X14B 1P7KA 5C0BE 3SKJL 1L0YA 1N59A 1QFOA 5T33H 2X4TA 4Y4KD 5IB3B 2HFFA 1E40A 4NQCD 3IGLA 4CU6A 4ETYA 4X7FC 1N5YH 5EC1B 3B7YA 2JKJA 4ZFGL 1KTKE 3CHRA 2A0LD 43C9A 3GMPB 1Q72H 1IAIH 1YQVH 3N1GC 4TVPE 1KCLA 3DYOA 4Y4KC 3UYPB 4DTGH 3I2CL 3WIHA 1PZDA 3W1ZA 1JHKH 4FYTA 4EDXB 5IBUG 2CGYA 4HDIA 2XPYA 1EERB 3GRWL 3L6FA 4R7XA 1HZHL 1INEL 5IGXH 1EH9A 2XPGA 1WAAF 3IS1X 5JIDA 2QSCH 4NEHB 2J57A 4PJGA 3IS0X 3U7YH 4U1NA 4MDJB 3WN5A 1P6WA 5JOPD 4AVJA 3OR6B 4XMXA 5BQ7B 3BPOB 3I50H 3F7KA 4NN7B 4PJBF 2NZIA 1QBMH 2AZUA 2YAPA 3MODH 5AVVB 4R0LC 4M6AA 2WLZA 1YEEL 1G7MA 2H1LM 3EHBC 1TVHA 3WLBB 3BPNB 3GRBA 4GFTB 1RMFL 4JRXB 1KEGL 3WO4B 4NZRL 1NAMB 4DZBB 3AWGA 4JG1L 1G94A 2CIIA 4UOJA 1NDGA 4PJCA 4JZOB 3MV8A 4HPYH 5FO7A 4PRBA 3FJTA 1PCSA 3TJPA 1QR1B 3D87B 2A6JA 5HXMA 1YYCA 1IARB 1F00I 2GCYB 3TN0B 2F61A 1GY1A 3D09A 4R3SA 5D1QE 2AC0A 3CFDB 2ESVE 2FGZA 4LARH 4Q74A 1JZEA 3BAKA 3GXNA 2OS7A 2XC8A 3WGUB 2ORBH 1XEDA 5A2FA 1KN4L 5D4HA 3BH4A 1DQQA 1XH3A 3RGVA 4MD5A 4L3CB 5DYFA 2DD8H 1F90L 3DTXB 4R7NB 1P9MA 3VMOA 2Y5TB 4YHYB 1MNUL 1MY7A 2PP9A 2BS9A 4YR6B 1AIZA 3O6KH 4GG6B 1P7QB 3TBSA 2MCPL 2R69L 3U48A 3TTSA 2DJSA 2OMUB 4QRTB 4R7LA 4U2YA 1CDCA 1S5IH 2BDNL 3QUZB 3VGHA 2P52A 4L29A 3T3PF 2HG5B 3QXDA 2VC2H 5C07D 5T3XE 4KK8D 4KPHH 3DO7B 1N0LA 1H3VA 1JGUH 5E23A 3REWA 3GMLB 5T5NG 5FO8A 1C16B 3ZLQC 4Q8BA 4UV4L 2G9HA 1QSFA 2NNRA 3QQ3A 4LSQL 4K9EH 3OMAB 3OGCA 1EHLH 3I3DA 4P2AA 1R4XA 3BAIA 3L2NA 3HAEG 3MRMB 4QYOB 4YE4L 2XZQH 5L2KB 1HIMH 1ZK5A 4ONFL 5ETUB 2Y3NA 5KJ7E 3C09B 2AXHA 2CKBB 4XCNB 1H3PL 4OSUH 5JORB 1ZDQA 3RI5K 1TYEB 2E9BA 4MJ6B 4LASL 1T83C 2XKNB 1DSFH 1H9VA 5D5MA 2X6VA 4RFOL 4P3DB 3T65B 5BO1H 3TVMD 4Q2ZA 1KOAA 1LK2B 4ZXBD 3ARBC 1CQKA 4TUJA 1BZEA 5M95B 4LPUA 3STZB 1FIGH 4RVBA 3LYRA 3T3MB 1JK8A 4JFYB 4L8DA 2EACA 1N67A 4KBPA 4ZXBC 3L5XL 4JY5L 1P4BL 1V3MA 2P24A 3L3GB 2D0HA 1MH5B 1R5IA 5KVDH 4AEIL 1NFAA 2BNRB 1JGEB 2WYIA 3PWJA 1XGTA 2EDEA 2J5LC 3RX7A 4L0PB 4E5XG 3MUGA 3QUXB 4RETB 3ZL1A 1JGDB 1CMOA 3CVHA 3RP1A 4X4ME 1BVOA 1Z32X 4EUPH 1HVXA 1G7LA 2K7PA 5J6HA 1SN5A 4ANWA 5DWPA 4JRYE 4G9FE 5A40E 3ARFD 4DKDC 1CZ8H 1ZT1A 4TUOB 3VI3B 9CGTA 5K1VA 3VFNA 5HHQB 4NI6A 1NUFA 3GHPA 2X2YA 3ZKXC 2EIZA 1RIHL 2CJUL 4PW3A 3EH5B 5E4IA 1R3LA 4UQIM 4ADJA 1VENA 1AS7A 1X5AA 3ARFC 2ZX5A 3QDGA 3Q43A 4HC1A 4CW1B 3FBKA 3Q8FA 5GZOA 3P77A 3LRLA 4FEMA 4AH2B 2EUVA 3T0WA 3BFWA 3CH1A 5KBLA 5AAMA 2JB6A 3HG1E 4UM9D 3PUUA 4NKDB 4YZWA 4DAGL 1QBAA 2APSA 4TSAH 5B38A 3UADA 4OF3A 3H54A 4G42A 5IIEA 3DMMB 4Q6IA 5DMKA 5HTSA 5EZJA 1D5ZA 4WU5B 4LFHD 4C59B 15C8H 3INUL 3RFRA 4PJ7E 3QZBA 3E3QE 5CEZH 2JB5L 2X4NA 3NAAH 4FQXB 4TVSa 4YBHA 3Q01A 3HN3A 2VSDA 4PJEA 1MCHA 4TQEH 2NXYD 1R3IL 3MLYL 4ABVA 5IB4B 2PWDA 2HTLD 2NTSP 1INQB 5GGTL 1SVBA 4Z7AA 1GCFA 4L8BB 4WO4A 3NJNA 2VDPH 1XIWA 4JDEB 2ZF8A 1ZKAA 3FO1A 4ZNEE 5HDWA 4XP1L 3FHAA 2NXYC 4PJAF 1F4XL 4ES9A 5KBDA 2V2XB 3EGDB 2E7BA 3H9SA 2XFXA 5CHNA 5KSAD 4DGYL 4Z7OB 5I28A 3LIZL 4M7JH 2NY2B 5EBGA 2I25N 3FN0H 2XXCB 3BPLB 4BFBD 3WFEH 5FOBA 2FH8A 4Y4HA 3ARRA 3U7AA 2XIDA 3UBXA 1NLBL 1RZQA 4E9YA 2GITA 3N55A 5KSAC 2CRYA 3CNKA 3LD8C 5IJVA 3RTQC 4HHAB 3PWNA 3OAUH 3BWSA 3NTCL 2Y4SA 2MJWA 5TQ0H 3OX8B 1B2WL 4MZRA 4A7SA 5E8EB 1RHFA 1OB1B 5F71A 5I1EH 5M7QA 4NO3B 4NDMA 3L9YA 2F8XC 1XH0A 4M9PA 3RWJB 5HYSB 4P2OB 3DX6A 3TFBA 2WP3T 3AY4C 2N56A 1N5AB 5F7WC 1DVZA 5LG6A 2Y7QB 3U7WH 2Q86A 5EUOF 3IGUA 2YD4A 2ZWKA 3MRGB 3L17A 3NFPB 4X9FA 5I8EA 1G7JA 4MCZB 2IC2A 1JZ3A 3QIWB 3GSRA 3IXAB 3VYOA 1JHLL 4X5XB 1VPOH 3I74A 1T0NB 2EQDA 3N3EA 5DRXA 4B3VA 4YMPA 4YXLH 2APXA 5IHHA 4MLSA 4BFJA 2NY4B 1P84J 5EOTB 1BQSA 1P2CB 1LILA 2DMGA 2FX9L 4JR9H 5E8DL 4N8VB 3ETBF 3U4BH 1E9PA 3FT3A 1UA7A 5BS0A 3MCLH 4K7PL 4QT5B 1NFDF 4YFEA 2DS4A 5AG9A 3JXAA 5AG8A 1RFDL 5FYKH 5I19L 1SYSA 4MCYA 3MJWA 5L9DH 2LU4A 1PG7X 1PU0A 5C08E 1EEYA 1Q8MA 3PXLA 3NSDA 3GEFA 4FNPA 2BP0B 4MTMA 5DUBA 4BRJA 1MFEH 2O6FA 2R39A 4L1DA 5E1AB 2OJ1A 2ZUVA 5EA0L 1AQDA 3KPTA 4QRUA 4N2CA 4PRDB 2DYRB 1OPGH 3QO0B 4LGRB 2DYPA 5L0QC 1RPKA 1OXYA 3LKSB 1KC5H 3O0LA 3B2MA 1A25A 5TH2B 1K6QH 4G8EA 5D8JH 3CVIL 1ZA6B 1AI1H 3E7JA 2CHZA 2EE3A 3F64A 2JKTM 3QA3A 3ETTA 3RDTB 4LDOB 5EU6A 3T6VA 4GKNA 2ZXBA 3EJUA 3ZYOA 4XVOA 3S3CB 4JJ5A 3MLWH 4JM0A 5AAPA 4MJ4A 3P0YL 1BXXA 3PWLA 3SBRA 1QEXA 3B43A 3HLKA 2V2WA 3QZPA 3ZHKA 1WIPA 1N2RB 3H0TA 4R96B 3V5DA 1PY4A 2KQMA 4KKRA 5J06A 4HG4K 4FC3E 1H15A 3VD9A 4ERSL 4P2YA 2R56H 3LQAC 3P69A 2OR7A 1MN4A 5IHBA 2WLKA 4FHKA 5IHWA 5DJ0A 2EEFA 3CHQA 1P6FA 1IBHA 9PCYA 4URKA 5JW4M 1VKXB 2YARA 1EHKB 4X5PA 1CYGA 5I0DA 2IDCA 2DIJA 2VZSA 1DN2A 3KPNA 2YPLA 2A3TA 4TLTA 2CO6A 3ZQXA 4MDRA 4NRYA 4PGBB 3I6GB 4DNLA 2W91A 4QRSA 3G5ZA 5CJBA 3HIZA 3U6XA 4OZIE 3G6JB 3HE6B 1U8CA 4MZ2A 1T22B 2FJFB 2GJ6A 3QJVB 4QTHB 3VFWA 4F7CB 1MLCA 4NC0B 5KOVC 2UY7A 3MGAA 2N01B 4S2SA 4PS4L 3LEVL 2ZOUA 3QIBC 5INDA 4P23C 4M61A 5JW3L 4ATTA 1TQVA 1Y18B 4XO4A 3SE8H 1TZGL 1F4YH 2PXYD 3A47A 1ZGLA 2IGFH 5F1KC 1SJEB 1ND0B 4F58L 4PGEB 2J1WA 3EYOA 3U1QA 3M1BA 4O5LH 4U2ZA 4AT6B 1YPZE 4HAKA 2B1HH 4WTWA 5EIIG 3VFPB 2WCGA 2R1XA 4WFGD 2J2ZB 3D85D 1FG9C 5DHXB 1QX1A 4YK4C 3VRJB 1I9EA 2E9IA 4DGIH 1SHMA 1FAIL 2EZ0C 2GAZA 8FABB 1R3KA 4DFIA 4LCIL 1E4KC 4H40A 4ZZKA 2CPUA 5FYLL 1KJ2B 1O9ZA 4DGUA 4BM7A 3AGWA 1M4KA 4G59C 1BSIA 3UTSA 2VSKB 1P53A 1TO4A 2ICEB 4LCWE 2DICA 3KHOA 3LQAL 1IAKB 1WBZB 3T6QC 1KTBA 1MG3C 3NBNA 1KN2L 3VVVA 3QG7L 4J8RB 1DANU 2CUIA 4QTIL 4QOKE 3SJVE 4JFOB 4PD4J 5H35B 1GS7A 1AD9B 2D8KA 2OR9L 1PZ5A 1D5MB 2H3NB 2WXMA 1EXUA 5D6CA 5F7KC 4ZMXA 1EGJL 5A2IH 2VLKE 5C0CE 3HC2A 4NQSB 3ZTNH 5B3JE 3QJTB 1CXIA 3I75A 4J1UB 1KY6A 2Y7LA 5I71B 4R4ND 1NINA 2EAEA 2HT3D 2YXWA 4RWYH 5FYKE 2EICA 2NLJA 3C6LA 5F70A 1IGFH 1EAPA 3NGBC 4WW1A 4E9WA 2ZOTA 4S1SL 5MEOA 1CC3A 3GSWB 5IW1B 4AEEA 1PNCA 1U8LA 1DE4A 2XTLA 3F00A 4WV1B 4R4NC 5TE7L 4Z76A 4FQLH 3O0RL 1JF1B 2HT3C 3BZDA 4G5ZL 5CCKL 4LSPL 3UAEA 5D4IA 2OL3A 3MX0A 1UCTA 4KKBD 4LLYA 5LLIC 3C5SB 1JOIA 3GD1C 4D3CH 4B60A 5TK4A 3R7RA 2VR9A 4HAFA 5J12C 3UJJH 4ORGB 3FN3A 3U82B 4AXWB 3NFNB 4KKAC 4L37A 2C1PB 4NO5A 1FNGA 5I17B 5CU9A 4ZMAT 4GO8A 1M1SA 1R3JA 5DQ9B 3SDDC 3CDGB 3NT0A 2NXZB 4WW2A 3L7EB 4FG0A 1A6WH 1ILUA 5AKSA 3I85A 4XXCA 1YEKL 2AK4E 4RMUA 1RUKH 3DVGA 4YDNA 1VJSA 4HZLB 1UKSA 3HZYA 1ORSA 3T8VA 3BQVA 4HS3B 3A6CH 2B0SL 1A4KB 4YUEL 4JY4A 3K2MC 1HHHB 3I3EA 3VM5A 1K5NA 2CUHA 3V4LA 2XQYA 1YVLA 1P7KB 5A6MA 3IPBA 4KUZH 2ADFL 1BAFH 3MN8A 4O4YL 1Y0LB 2X4TB 5IMMA 2GUYA 2HFFB 3AT9A 4JM4L 3BIKA 5KYUA 4Z3GA 2F5BL 3FC8A 5AFAA 4YNYA 43C9B 4ZAKD 3MMEA 2NQ3A 3MREA 3N5AA 2YBRA 3C6SA 2NY5H 1NMAH 4JFDA 4CN4A 1QKZH 1TEGA 4X6DA 1XGQA 1E9OB 1CLOH 2BW4A 2JKWA 2CZNA 3UTPE 2HP4A 2Y72A 5MP6L 3B6SA 3QEQB 4GUCA 1JZGA 5TPWL 2C9VA 1HX0A 4PJGB 4YC2C 3SCMD 4BKTC 2ETWA 4U1NB 5GISH 3CLFL 1CD8A 4NZUH 2O5NA 4YBQC 5J11C 1N64L 3KWWB 4GS7B 4A6YH 3N41B 4I2XA 2JQZA 4MYWB 2JKXA 3RBSA 5HSFA 3SCMC 1A6PA 1G87A 5K9JL 8CGTA 2VR8A 3CK0L 4O51A 1KYOK 1GC1C 4UYPA 4JO4L 4P3CH 1HC1A 4QHPA 1PZUB 3FFCB 2FWOA 3BLKA 1FJ1A 4MJID 1NDGB 1FYTE 1K3IA 3MV8B 4PGZA 5FO7B 4PRBB 2UVEA 2EIKB 2BC4A 1E4XL 1BM3H 2MQ0A 1TSRA 3EG9A 3DXAD 1W15A 3HMWL 3GJEA 2X1XR 5LG1A 1ZAGA 3SDAA 4TRPH 4AQ1C 1KJVA 1JPFB 1XF3A 4TNWK 4R3SB 1MFAH 5DD0H 2C9AA 5LXVA 1O6VA 2YD2A 4GW1A 1TEYA 1KCRH 2CPCA 5IESH 3RQ3A 3A0OA 1DQQB 1BZ9A 3SGKA 3RGVB 4MD5B 2GK0A 2MH4A 3SDXF 2XG5B 2ZSWA 3LZFH 2PYEA 4HQQL 4Y89A 4HJJH 1S9YA 3SYQA 1KWKA 5CZVL 1UYWL 1YJDH 3KLDA 5C2BH 1YC8A 3L1OL 5HYQA 4HCGA 2VR6A 3TASA 2BNQA 2WBJC 2VR3A 4HJ0D 4IQHA 3BGFB 1HILB 4L29B 3QXDB 4IKLA 4FQPA 4DN3H 2CSPA 3FU5A 4MCNA 2R0LL 3FU8A 4DUVA 5JW4R 1N0LB 2ZOOA 1AJ7L 3ZZ1A 4KY1H 3AACA 1IT9L 2G60H 5FO8B 4P4KA 1QUNB 2G9HB 4JE4B 3OG4B 3QQ3B 1OSEA 1FZMA 3KL3A 5IHUL 1JPSL 1EQWA 3NJLA 4MNQD 3UYOD 2WJ5A 3W9DA 2B20A 1T0MB 2RA1A 5DVLA 1RPUA 1PX3A 3AU0A 3C60A 4OT1L 3RWDB 3RIAF 4AVIA 2Q3AA 1E6JH 1UEMA 4RGNB 4GUOA 4ZUTB 1HNGA 3EJSA 1NBVH 5IQLA 3OKLB 4ADIA 4Q2ZB 3ILQD 2EO1A 1RK0A 3GSNL 4O9HL 2APVA 4BA0A 4AQOA 3OJDB 2HLAA 2Z1PA 1GC1L 4G2AA 1I8MA 1NSNL 1JK8B 1NAMH 3HPLA 3IPEA 3SPGA 1L6PA 3KPSE 1L3NA 2P24B 2HFGH 4PWKA 4NBYB 3QJHA 5ICYA 5L88L 3C5ZD 4X8XA 4W1TA 4FFZA 4ZUVA 4NN5C 5C3LD 4NQQA 4GIPD 2Y22A 1XGTB 3PWJB 1KLGB 2BWDA 4WFFD 5IQOA 3UIZA 3CWGA 3MUGB 4ABQA 3VD7A 4IIQA 1WICA 1WYJA 2APBA 3TA3D 2K4AA 4JRWA 1JYWA 3FH7A 1G7LB 5J6HB 4L3FA 4KK9C 3WNJA 2WLIB 1YQ2A 5IREA 1ZT1B 1L9OA 1WAPA 3O4LB 3B1UA 2QPEB 3A6BL 3FHQA 3VFNB 1YDPA 4HG4J 1LTXA 4HKJA 3WSQL 4L9DA 3S3JA 4Y4KA 3T77A 3QDGB 4NQCA 4KO9A 4Q6KA 2DB8A 2Y23A 4K7FA 5CJXC 1FNSL 1BXUA 4N0YH 3P77B 4ZQKA 3JV4B 4AOFA 4NT6B 4WCYH 4M7LH 1GSMA 2JB6B 2FQEA 2EDWA 4ODWA 4YVUA 5L7XL 5B38B 3IAGC 1O5PA 1P69B 4G42B 1SUJA 4M43L 2NY0D 1FG2B 4Q6IB 5ANMB 1GPOH 5EZJB 1D5ZB 5FYJL 1OLZA 3S36H 4M1DH 2E0PA 2HYMA 4G7YH 4YSPA 3HUJA 4GMSL 4ZX3A 4YL9A 2RFXA 3SGDI 2F5AL 5DTFA 1SEQL 1WA1X 2CKBH 5DCCA 1MFBL 4TTDD 4OCLC 1CQYA 4GRWF 1TNNA 4NAJA 5HDBE 3TV3H 3HEIB 4GI8A 3TLRA 4ZSOA 2O5ZH 1Z3RA 4KV5F 2GSMB 3GLAA 4WO4B 1XIWB 2FWSA 4MASA 5DMGC 4NWUL 4TTDC 1BA9A 2VDOB 4HS6B 3OXSA 1IVLA 4G7RB 4N22A 4OFIA 5B21A 5KVGL 5GRVK 2YFNA 3L9BA 4HF5H 4XP4H 4U49A 1OANA 4P5SA 3IETA 5JIKA 3ZXAC 1GW0A 5FOBB 5EU7E 1E5AA 5D2LF 4OUUA 3UBXB 3VVWA 2E6JA 5LN8A 2GITB 4QLWA 5IJVB 2JJTA 2VISA 2YEZA 3PWNB 1EUTA 1J9SA 1IBDA 2C3XA 4OW6A 5CNHA 4NIYE 5ITBL 3W2DH 2BIIA 4NPYA 3DX1A 4H8WL 3QVAA 3GZQA 4I3SH 4NDMB 4DCQA 1Q38A 1JGLH 3OTTA 1YMMB 3DX6B 1ZPLA 2FGWH 1MHPH 3BQUD 1ACYL 4YZFF 4IKKA 2IAMD 5C0JB 2D3LA 2Q86B 4LDLB 1CURA 4BH8B 3FSVA 4OGAC 3NEXA 2J12B 1J86A 4MMZB 5A7BA 3BQUC 2XDHA 2IAMC 1PPIA 5C07A 1G0YR 1XTMA 1F6AB 2B2XL 3ZKQD 2FLMA 3LH2L 4PJCF 4Z77A 2ARJA 3N44B 1GXEA 1H3GA 5BS0B 4E9TA 5I16B 1A9BA 1F1AA 4JG9A 1A1MB 5HJGA 3V0VA 3V4VL 5IFHH 3FS9A 4Q9CA 2ZZUT 5IFAH 3L2LA 4K5PA 1T83A 1JYVA 2VDKL 4MCYB 4HBQA 4JL1A 3O9WD 1EEYB 2FUTA 2QJDA 1B3IA 2YXMA 3EBIA 1CIUA 5HHVH 2R0ZH 1U92B 1T89C 1BP3B 3HG4A 3NJMA 3ZKND 3O9WC 3TVMA 2DQJH 4ZXBA 3PL6D 3VDBA 2ZUQB 2WQUA 1RIUH 2DYPB 5AVYB 4YFLI 4ZW6A 1HFUA 2FHCA 4JVWA 5D71L 4BXSV 3NVQA 4MXVE 4H2AA 3NA9H 4XVSL 1GIGH 4J6RL 2DLFH 2DTMH 5JPMC 2NUTB 3PL6C 2R59A 35C8L 1DUZA 2HN7B 4JN2A 2OMXA 2P5ED 4G8EB 4HLEA 2VW4A 2ODHA 3MLUL 3PV7A 5SWSE 2R7EB 4MB5A 2J8OA 4NHCH 3MNWB 4PJFE 3VTAA 4P59H 3KD4A 4J28A 3KWUA 3T4YB 4X0KA 4BFRA 4JJ5B 3HKFA 3SDCD 4JFEB 1P1ZA 3VM7A 2UZYA 4IRZH 2XN9E 3PWLB 4L5FE 5D4QA 4GSRA 5FUZL 2OX5B 3GSQB 4K8RH 4NQDE 2V2WB 1CBJA 5B3NA 5T3ZE 4WWKD 2OK0H 4BD4A 2M1KA 5D5MF 4G8FB 3AQZA 4XN9A 3ARFA 4IOFD 3UMNA 3S37X 3H0TB 5E5MB 3V5DB 4F2ME 3Q1SH 4DSYA 1OTUD 1WEJL 3LSOA 2XBTA 2XJLA 5KSVA 1DVSA 3WFHB 2AQRA 4IOFC 3BDBA 4QWWD 3ABZA 1WGVA 2E4FA 1ZLVK 1AAJA 1EZVX 4UM9A 3V0FA 3KYOB 3TIEA 4U7KA 2YPLB 3MRCB 2XICA 1T6BX 3WDHA 3OKNA 3QYNA 1UJ3C 2W0KA 2Y9RT 3F7LA 5ESAA 4DP6X 3WTSA 2GI0A 1NEZG 4MD0A 1DCEA 2GJ6B 5I8OL 3H9HB 4LSTH 1MLCB 3MFGB 4OGZA 4PJDB 4TS6A 4AUJA 4ZFOA 4X9YA 1H6EA 2UY7B 4JFPA 3PUCA 1KJMA 1JPGA 4I1RA 3LRHA 5JPNC 1NCDH 5TDOA 4M61B 4M3HA 5HHMB 5K9QI 1KYOJ 3WAKA 3WL9A 1BVNP 3HI6H 3MACH 1ZGLB 12E8L 4GQPH 1EEZB 3ARGB 3GO1L 5KSAA 2VH5L 1IQWH 2X38A 3WNLA 1HCYA 4BJLA 5D1XC 3EYOB 3KGUA 2F68X 1FYHB 1T2QL 1NBYA 1RQ5A 2C5DC 3M1BB 3P3TA 3B2XA 4HEPA 3ZGIA 3FB5A 2R1XB 3CQFA 3ZE2E 1J8KA 3HB3B 3WHE0 5HJBA 5LCVL 1PL3A 1SNRA 2YXVA 3BP4A 1I9RL 4JRFA 5GRJH 2OP4L 3B7TA 4F91B 1GGYA 2GAZB 3U9WA 1CVRA 5A2BA 2APWA 4PJ9D 1R3KB 3F7RA 3QUMA 5IOPB 5ID1A 4X7CC 4ODTH 3H55A 1VFUA 1OTSD 4XMKL 2X9YA 5F7LB 2OMBA 5ALBL 5I1JL 5AOIA 3QP3A 4UTBA 1QG3A 3CSTA 4PJ9C 4WVRA 1CFTA 3SOBL 3CFJB 4HYTB 3UTSB 43CAA 1LEIB 3ZTJH 5K93A 3O8XD 2XZAL 4FNLH 2EVFA 4OLWH 3CFIC 4Z7WA 1AD0B 4M7LT 3NYKA 3T8XA 3QBTB 5FO2A 4S1QL 1QI3A 1ETA1 3PXJA 3JZ7A 4IYKA 4YSOA 3O8XC 2OSXA 2O5YH 1VFBA 1EXUB 2EC9U 2ZXAA 3RWGB 4D0DA 5ISZE 2QSQA 2GQHA 3N6YA 5LBSH 5I1HH 2ICES 4LCVA 3KPMA 4G80A 4HK3N 3VGAB 3FTGA 2F54E 4XVJH 4OD3H 4V2CB 4XP9H 1EAPB 4PJXE 4WW1B 2G2RA 3BWAB 3OZKA 2Y1ZA 1I9JL 1WCBA 1U8LB 1IC1A 2YD7A 3QEGL 1DE4B 3E8VA 5AAWC 4RFNB 3RNQA 3MX0B 4LLYB 3MC0A 4Z0XA 1XL4A 3TF4A 2YRZA 2OJZH 3MROA 4GAFB 2CGRL 2ZKXA 4L37B 3TYFA 4F15C 5C7XH 1FNGB 2HKFL 5AVZB 3QDME 4A04A 2WZPD 1R3JB 4KRPD 3IM1A 3EZ8A 1X5ZA 2ZYHA 2AQNA 2ENSA 4WW2B 4K3JL 1JUFA 4X4YA 5FKAB 4YPJA 1R47A 4PWJA 1MJ8H 2EYSA 4HXBL 3HJEA 1MIEH 3FZUC 3HFMH 1DEEA 1QATA 2XWBB 3FQ4A 3RWFA 4PV9A 4LOUC 4EIUA 5E6SB 1ROCA 3HZYB 5CLYA 2XTJD 3MJ9A 2YA2A 4Y7MA 5F0MB 3PV6A 3MRIA 3QHZH 1OGTA 1LEGB 5K9KA 4FNUA 2BVYA 3HRZA 2P26A 4JY4B 4X7TA 4QRPB 4LDCA 1K5NB 4U6HB 1KJ2H 1YEHH 3WFDH 2XTJC 4C56E 4IOIA 1U6AL 1YZZA 2IWEA 4XNMA 3S34L 2YMXL 5IMMB 4NNPH 2X6BA 4N2HA 5A2CA 4U1KA 1J88A 4XNZC 3NCYP 2WN3A 2WAHA 3BKCL 4UT6A 4YNYB 1BYNA 1ZSHA 2X70A 3LRGA 5F1OB 1UZ8A 3ZTEA 2E76C 5T5NF 3HMXH 2YBRB 1MXGA 3C6SB 1RL1A 3MRHA 2VR4A 5E2JA 2JCCE 4X6DB 1KXVA 3WMPA 3DRQA 3HC4H 5G4MA 5I0YA 3FO0H 3B6SB 4GH7B 3IDYC 4G6KH 3JV6A 2D31B 3HJ0A 4A2HA 1BPVA 3KH4A 1SMDA 4PP1D 1VF5C 1JPTL 2QADD 1I3RA 3KYKH 3U0PA 4M5TA 1M42A 1MCJA 2KZ1B 3HTLX 5D7IF 5K59F 1MVFA 1A9EA 3VA6A 5DD3L 1BECA 3BCFA 2R0KH 4J3OH 2B15A 1B3JA 5GJSL 2A73A 3PWUA 3OZ9L 1DBKH 3Q9QA 4LRIC 1JFQL 3ARXA 1YECL 4O51B 2BH0A 1WA2X 3T3PB 2UZXB 3QYCA 3RU8L 5DUMH 5JYLA 3BAYA 1DBJH 4UQEA 1KXQA 5JR1H 2FWOB 2PXYA 1AGCA 4M3KB 4MA1C 4PEEA 5TQ2L 1YEJL 5IUCA 4FKEA 5E2UH 4ENEC 3IN0A 2BC4B 5C09E 3RX9A 1GS6X 5FYJU 3VH8A 4BKSC 5E6UB 2WIIA 2XI9A 3GJEB 4JFUA 1SYVA 3SDAB 1KULA 1OO2A 4N2FA 1CVSC 4WY7L 2Q7AA 1CFVL 1ZOXA 4HIJB 3D85A 2Z6FA 2VIRB 3GI8H 2BXZA 4MYPA 4GW1B 3SO3C 2PO6D 1AYOA 5EULV 3VXNA 2NCEA 5CCJA 2AXJA 2GK0B 1JRHL 2ZSWB 2PYEB 2VDNL 1IGCL 3CHPA 4W9EC 1QSEE 1IO4C 1NBZA 3SD5A 2PO6C 3IMTA 5AOMA 1W80A 5CJOH 4PJHF 3P3SA 4Y19E 2WCSA 4K7PX 1SF3A 3BDYH 3LN5A 1F97A 4ZW8A 3QJRB 1ZTXE 1BXVA 3VXUD 3ZQ9A 4LLMA 1YYLH 3CN0A 4GIAA 3L4VA 1TKWB 1QQDB 4P4KB 5BVPL 3IMBA 4B9CA 3WIHH 4BXVA 2X6MA 3TWYA 3DHPA 2AGJH 3KEHA 1EXHA 2WW8A 4H0GA 3KPRD 4PRHE 5JA8B 1F11A 2ZG1A 1QFUH 3Q6GL 3W9DB 3WDJA 4HOXA 1L9PA 1FA4A 1CGSH 3DIDA 3CLEL 2JI1A 2AANA 2NW3A 1TTBA 3CSYA 5EZLA 3B34A 1S9VA 3WFZA 2P3YA 4RRPA 5D1QC 5FGBA 1WF5A 2YOCA 4KXBA 1PG7H 3PAZA 2JJSC 4LSSH 1RK0B 1ADQL 3KG5A 5D7EA 2VRKA 2HLAB 1MNNA 1Q0XL 1AGEB 3CZNA 1DQDL 4FFYL 4P46C 5JIIA 2EEAA 4U6XA 1EZLA 4GT0A 1KCVL 1NMBH 3KHQA 5T3XD 1DLHA 4FZEH 4ZMQA 2QQKL 4OCWL 3DA0A 2R29H 3QJHB 4ZTOH 5ICYB 4ZUVB 3M1CA 3N0PB 1BV8A 4X83A 2YGNA 1GGIH 2PPEA 4MX7A 3V4PL 2I26N 1KT2A 4QJ4B 3U1SH 2CBPA 2HPOA 2X3BA 4IIQB 3X1EA 3R1GL 4TVPL 1MCBA 1BZ7B 4LT7A 4QRFA 5GJTH 4AEHH 5HDOA 1AXSA 3SQBB 2DWSA 2YK1H 5I76B 3GM0A 1USZA 3ULUE 3QJSB 1I7TA 3GJFA 4BUQA 3ZBMA 3MTXA 4CUCA 3T1FA 1UWYA 1YDPB 1NPJA 1ED3A 4HKJB 2YUWA 1J9RA 1HT6A 1X4YA 4Y4KB 5FW7A 3QC6X 4JQIL 5DJ2A 1MPAL 1I8LA 3EJTA 3WNMA 2QELA 4K7FB 4KKNA 2DIEA 1BQHB 1XSKA 2FUQA 4ZQKB 3BSZL 4OZGE 4ZAKA 2C7FA 2QKIC 4ODWB 1CYXA 2WSKA 2P5WD 3UPRA 3HS0C 5DEGA 1CGYA 4LHJB 4XODA 1FRGL 1HAWA 4POUB 4XCYB 2A74C 4XMUA 1AOZA 1A2YA 4JPKL 2VE6B 2W0LA 1UWXH 3T0DA 2IDSA 5E95B 4Y1TA 5DA0B 4R0LB 3SCMA 2PETA 3EHBB 1X4XA 1H5BA 3MRRA 4KH9A 3X3FH 2WM0A 5KSBE 3ATBA 1KPRA 1JZ4A 3ULVE 2EYTB 4ZSOB 4PJIF 3VNYA 2PWHA 3QRGH 4HWBA 4JRYD 1BOGA 4NC2B 3ML9A 4NERA 4OB5L 4P04A 5SX5K 1FGVH 5I82A 5AVXB 1OK8A 1OSYA 2HTKD 2QV2A 3EJZD 4GQQA 5BV7C 1M9SA 4ELMF 4Z23A 3RZCD 4TULH 3OAYK 4HH9A 1BJ8A 4MJIA 1PY0A 2J56A 5HP5A 4DVRL 1EO8L 1KTDA 3U79A 1LWJA 3HG1D 1NCBL 3DXAA 5TE4L 1NFDB 3K6OA 1IKOP 3MXVL 1TZIA 2QDWA 5ACLA 1NUNB 3Q8EA 1CB4A 2BSSB 3N42F 4TMPA 3W38A 4WNQA 4UIMB 5DVMA 4C4KT 1BREA 3NIFF 5GGSY 3TP4A 5CZKA 1CDBA 5ABZA 4MB3A 5E8OA 3WJLC 5C0AD 1ZLSL 5J1TC 1UASA 3ECQA 3E3QC 3MV01 4L8SC 3V6OA 1ASQA 1T03L 2WGXA 5IK3A 2JIXB 4HC1H 3WNKA 2BERA 4PRPB 4Y16C 4X80H 5C07B 1KXHA 3NCEB 4KWUA 2ZCLL 4WUKH 4CSSA 3LKOA 2DLTA 4ZMYA 2IADB 5GXBB 4F33A 4Z77B 5KTEH 2ARJB 1NCNA 1ODAA 2GHWB 5C71A 2QGEA 3IDGA 1I3VA 1T4KA 4WSGA 1MRFL 3ZKMD 3WJJA 4X5WA 1A9BB 2E7LC 1ESOA 2HT4C 2CE6A 2OMYA 2DEXX 1C12A 4MNQA 4MAUL 3B3IA 1FGNH 4NCDA 4BH7A 5IJKA 1ZXQA 4HOMA 2D3VA 1N7ML 2ED9A 3QULB 1ZTMA 1Q1JH 5CXPA 3P11H 3ARBB 2QDVA 2EP6A 1IEHA 4YXKL 2X4SA 4DUXA 1QSVA 3KR3H 3K80A 1A7PH 1BQRA 2MTAA 3HN5A 1HE8A 2OMTB 4OZFA 2FBJL 4HAGA 5D9SA 4YIQA 5B22A 1SXAA 4ZXBB 2VDOH 4XNQA 3CFTA 4Z18A 5EOCJ 4UNVA 4K3DH 5BV7L 1TF4A 4XH2A 1ZANH 5JHDE 4A67A 1LK3H 2KLTA 2XLLA 2XA8H 1YEDB 2X0WA 4Q9RH 3LV3B 4E9SA 5HYFA 4JN2B 1SLWA 4Y1AE 1T1XA 5GIRA 5ELIA 3D34A 3L9RA 3UFIA 4PHZA 3LS4L 3C5ZA 1E3FA 4GAJH 1EFXA 4NNXA 2G3ZA 4X6CA 5EBLA 2LW3A 4U7SA 2CLRA 5C97A 1DVUA 2AEIT 3L45A 2YUZA 4KKQA 4J6IA 1G0DA 3I6KA 4E9XA 1FH5L 2VUKA 3JBG7 3TA3A 1RZJC 1XCQA 5KBPA 2DQIL 2MPAH 1FV1A 1IMHC 3ZKXB 3VMNA 1MRDH 5IQ9A 1URLA 3ARFB 2EKSA 2W0PA 5DD6A 5F9DC 2OR8A 1AO7E 4POYA 4YQXL 5DJDA 3BH8A 4MAZA 4TQHA 1QABA 2W0FA 5DD1L 1H0DA 5EWIH 4AG4L 3D6GA 3JWDC 3QFGA 4J12A 4U4BA 2NSMA 4QXGL 2PPFA 5LN4A 1DJSA 3LB6D 4FQHA 1IBGL 4UM9B 3FMGL 3LRSB 4OCYL 1RP8A 4OKDA 3BEWA 3TIEB 3CDYA 4QDGA 5I1DB 1HEJC 1IIIA 5EZIL 3WFBL 5EEWA 1YY8A 2W9EH 5JXEC 3OKNB 2WUCL 3D2UD 4BZYA 4CILA 3C5XA 1OW0A 5ESAB 2GC4C 5T1DH 4MD0B 4KJQD 3THML 1NFIB 2IDUA 3SDYL 2NXYB 2QQQA 1RULH 3DJTA 4POZC 4JFPB 1XL6A 1KJMB 2HUHA 4XN4A 5J56B 1JPGB 5LXGH 4ZODA 4I0CC 4Z8FL 4B0MB 4KJQC 3TEUA 2WXGA 4WNJA 1OOWA 3KJ4C 4JO8A 1WT5C 1OAKH 5DRZB 2YRPA 5KSAB 5KYNA 4Z7NB 2BVEA 3MJ7B 3H3PH 3LD8B 3D30A 3U6XS 1NGPH 1INDL 2CO4A 1ZLUH 3K4ZA 1CGTA 3ZDYF 2D03H 1K2DA 3VNZA 1R24A 1LO3H 1Z3GH 4FP8H 4U1MA 4EZJA 4ZG1A 4UINH 3NCWA 4OQ1A 3CV5A 5ID1B 4IBWA 3HUJF 3N1PC 2NY7L 2YRLA 3BIAX 4UMGA 1RZJL 2WIMA 1EPFA 1DQMH 4GLRI 3LNIA 4GP5B 4CC0A 4PG9B 3BQUA 5DDHB 1G6RL 3VXTB 2BOBA 2Z4TA 2IAMA 5J57B 4YX2L 1BXAA 43CAB 2A4ZA 3ZYIA 5DMIL 3WHXB 3RI5F 4MD4A 3CFKA 3T8XB 1RLBA 4KRLB 1IBYA 1MHEB 2WTPA 1WP6A 3O3EA 4PVMA 2F7RA 1U8NB 1WFJA 3JWDL 4XPTL 5PAZA 2HZHA 4QO1A 4E9LA 4QNPE 4OI8A 1LO0H 1BVKA 2V7NA 1VFBB 4RESB 4D0DB 2W95A 4E68A 4AVHA 3IKCA 3BVNA 3MNMA 3RNKB 4U3HA 5E2VH 1WS8A 5FM5O 3HCVA 2ADGB 4G80B 4IBYA 3DUUA 2HPTA 5DZLA 3S4SA 3FTWA 1AC0A 3FTGB 5FOJA 4FA8A 1IGML 3NZSA 4WJ5A 3O9WA 2GYSA 3F01A 1TTRA 2R1YB 3OJVC 4PJ7F 4U6VH 1HINH 1IBBA 3GS0A 5FDYA 3V5HB 5L0QB 4FXKC 4J39A 2FZ3B 1HQRA 2CR0A 2VABA 2E27L 4RMSA 3RNQB 3WDIA 1LEKB 3SY0A 4Z0XB 3V9EA 3PL6A 4CBZA 3CLWA 1BIHA 1DP0A 3F58H 1UACH 1WD9A 1QFHA 2B1AH 3MROB 3QCTH 4GXFA 1LP9A 2DBLL 4F7MB 1T21A 5IR1A 2GVYA 2ZX8A 4AMWA 2CXKA 4QOKD 4XVTL 4X4YB 3SHSA 3U36A 2G3MA 5HD8D 2VLLA 2EYSB 1A3ZA 3BH9A 1XBDA 2X10A 4N25A 4DPRA 4V1DE 5EO1A 5BRZB 2CHXA 5C0CD 4MQ7A 3RWFB 1NIEA 4FLRA 4HWZA 2K6YA 3MRIB 3PV6B 4FQQB 4M56A 4J5VA 1OGTB 4KTDH 4X9HA 3W0WD 2B3IA 3SDCA 2V3EA 5FYKD 5K9KB 4WU7A 2AAAA 4OZHF 1HOEA 3ZMRA 1IAOA 1F45A 4ZFFB 1HZLA 4WJKB 2J4WH 4X9BA 1Q90A 4IOIB 4WWKA 4XNMB 2MOVA 2AK1H 4Y9BA 1XMWA 2XIIA 3DJSA 1E65A 4MKMA 4NAMA 4NIKB 3KWXA 4U1KB 4QHLA 2MNUA 3TYGH 5CLXA 4HD5A 5ESQA 1DJIA 2BXYA 2EDBA 4O00A 1C5BL 4ZTPH 1NL0L 5IB2A 1UZ8B 3KM2A 5KVEE 5M94B 2CRMA 1N4XH 3MXWL 1TU2A 3HBPA 4G1EA 1KTJA 4YSTA 3IFNL 5DJZA 2CRIA 4EXPX 3E6FA 3BT2H 2AK4D 3HI1A 2CMRH 5DD5H 3JV6B 3LKQA 4HOWA 5FW8A 3GMMA 2KBGA 1NCJA 3V7MA 4L4VE 1AZNA 2HH0H 2Z34A 3IXTA 2I07A 1A7OH 1RXLA 4XOAA 4P23B 1TJGL 1I3RB 3P4MA 2HXAA 2K8QA 1G7PB 1TMQA 4JFFB 3ZE1B 3WEMA 1KEML 4B9GA 3V95A 5HI4D 1A3LH 2HWZH 1KBWA 1U8HA 4FMKA 2A73B 5I75C 1KJ3L 3PWUB 4YDVA 3KEDA 2WTOA 1EBPA 3QQ9D 3G6AB 1KCSH 3VI4F 1YAIA 5HI4C 4UT7L 4N1EA 5J5EA 2YAHA 4FTVE 4YK4B 1BIIB 3KPPA 4AUYA 4O58L 2WIIB 1M53A 5D1ZC 1SYVB 3PABA 3ZE0E 3W39A 5CJQH 4OQTL 4JVPA 3D85B 4QKXB 5IVXF 4JHZA 4KI5F 4L4JA 4EI5D 5G4OA 5CLWA 1GMEA 5EF3A 4RMVA 4AQAB 4N8CH 3VXNB 4PJ9A 1WLHA 5KVFH 2R8SL 4LSVH 4AQ8C 4XMLH 4HBCL 1NBZB 1YY9D 5B39G 4EI5C 1KNOA 1OAYH 3ARVA 4KQ3L 2VMCA 3IAPA 5ACZA 1T66C 4IEFA 3GI9L 1QZNA 1PS3A 4FQ1H 5TDNA 1V7NL 3LN5B 3O8XA 4BZ2A 2K4WA 3SSGA 1F58L 2OMWA 2P1YA 4FZ8H 3T2PA 4ZRGA 4GAGH 1DVXA 2ENYA 4ORZC 3RRQA 2Y1AA 2XY2A 2XYBA 4YSRA 3WUWB 2EH7H 3FQRA 4YHLL 2YHGA 3EFOA 2D9QB 2DWDB 4XP5H 1F11B 3K8MA 2DQGL 1IZKA 2UYLA 5IT2H 3NGBB 2BRQA 2ROXA 3HVDA 3MBXH 4BK4A 2QQLH 3O45B 2NW3B 1TJHL 3GIZH 4JRLA 1L5GB 3QFJB 4IHOA 3CSYB 1A6VL 5EZLB 5AAWA 1UC6A 1S9VB 3OWRA 4Z7VE 3BRDA 1RUAL 1YN7A 5FKPB 4J2XA 3VXME 1JVOA 4LKCB 1IGJA 4GNKB 3DETD 3SDDB 1OE1A 3QORC 3OM3B 3EH4B 4ABWA 2OSYA 4U6XB 5KJRL 2AHIA 4JKMA 1DLHB 1KGIA 3CXDL 4MXWL 1TQCC 5TF0A 1DLFL 2IFFL 4FJ6A 2WZPA 1RZFH 3J07A 4PG2C 2DKMA 3X1NA 2EDKA 2V3DA 1KT2B 5IBTL 1AZRA 3VTMA 3RVTC 4GXUN 4F57L 2EIMB 4OF8A 3A3YB 1SY6L 5BZDA 4XBGA 2YR3A 4FD0A 2Q7YA 5EFIA 3TWCH 2DMKA 1IKNC 4U1JB 1IAIM 2NY3D 2QVFB 3A4EA 1I85C 3AG3B 2VZ3A 1EEQA 1FVEA 3B2UC 4DESA 3DUHA 1KB5L 1I7TB 3GJFB 3BYTA 4RA3A 3OSVA 3BW9B 4WDIB 1ED3B 2FDBP 3CUPB 3GSUA 5AVQB 4L3AA 2EUXA 1AFVL 3IDJA 3SE3C 3I2CH 1E5UI 4P99A 1YUHA 3KPSD 1H3TA 5FXCH 3CFEB 5IY5B 3FT2A 3NJJA 4OCXH 1HZHH 1INEH 3TA4D 2JXMA 3T2LA 3V6BR 1UFGA 1K8IA 4W93A 1XVSA 2DKSA 4YC2B 5DEGB 1NWPA 1GHFH 4G8IA 4N28A 3VFRA 5J11B 1A2YB 4K73A 1UQSA 1NCAL 5A2LH 3GPSA 2D2CC 2NDGA 3SCMB 3GSNB 1W8NA 2WKLA 3MRRB 4WHCA 5AB0A 1KPRB 1RMFH 1AR2A 5GGRA 3SPJA 2CK0L 3Q8BA 5DRWA 4NZRH 2UWEE 3OKEB 4H0IA 4JG1H 4BFIB 2E5EA 3D1MC 2DL2A 1HU8A 5EIVA 3VFUA 1XD1A 3BKMH 3GZPA 1YG9A 5FCUL 5CD3A 3C8KA 2OI9C 1MCKA 3UEZA 1XSJA 4AC4A 4AQ1B 3PAYA 5E8NA 4AIZA 4HSAC 3ZVVA 3KM1A 3WI9A 3IJYA 1HSBA 3EUDA 3CIQA 1KN4H 3DXAB 5CEXA 1LO4L 4JLRA 4NKMA 3QEHA 3S3DB 4CC1A 4UUJB 1TZIB 3OLIA 1L9RA 4M1GL 2BZCA 1Y07A 3UCRA 1UXWA 1WAAE 1IC4H 2PO6A 3OKOB 4TQIA 2Z7UA 4UMSA 1KY7A 2WBJB 4QLRA 2YZ1A 4AYFB 1WWBX 4HIEA 4XBMA 2DJ4A 4Z3EA 2QV4A 4UU9A 3NEOA 5E8OB 5E6ID 3LTVA 1LGVA 1M1XB 4PJBE 3ZL4L 4PFEA 3S2AA 4BHUI 1SXSA 1DFBL 4WWPA 5F6IB 5AENA 4O2FA 5IK3B 3A4AA 1QASA 1U93A 5E6IC 5G5DA 1J8HD 2EADA 3VFOB 4EDWL 3SE9L 3QWOA 5DS8A 1JZDC 2ZG3A 3LKOB 5DF0A 3VXUA 4F33B 5IQNA 2LLNA 5SWZE 4JPWH 1YRKA 3NQIA 2YPKA 3VWJD 3I9GL 4XC3L 4X5WB 2F08A 5DK0A 4A2MA 4MXQD 3MYJB 2OMYB 1PFOA 2RTTA 3N40F 3HI5H 1H3PH 3KPRA 4FNTA 1VHPA 3AS2A 4LASH 4UV7L 5EU7C 2VMJA 4N0UE 2MSPA 2XQ0A 1X5GA 1RJYB 2GUOA 4XTRC 1NEUA 2VITA 3LY6A 4JM2D 4RDQG 4MXQC 3BJ91 1NDMB 2X4SB 4ABUA 1KIRA 5I8KL 1KELL 3KZ8A 5DFWH 3BHBA 3D5OF 2YN5A 2EIEA 1YEGH 5D9SB 3CFBB 4YIQB 4YHKL 3FULA 4PLKD 4JY5H 4XNQB 1P4BH 3S5LG 5D55A 2MOGA 3ML8A 3R18A 1S8DA 1WWAX 1BGXH 4AEIH 4NN5B