1KDIA

Reduced form of plastocyanin from dryopteris crassirhizoma
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
102
structure length
102
Chain Sequence
AKVEVGDEVGNFKFYPDSITVSAGEAVEFTLVGETGHNIVFDIPAGAPGTVASELKAASMDENDLLSEDEPSFKAKVSTPGTYTFYCTPHKSANMKGTLTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title The structure and unusual pH dependence of plastocyanin from the fern Dryopteris crassirhizoma. The protonation of an active site histidine is hindered by pi-pi interactions.
pubmed doi rcsb
molecule tags Electron transfer
total genus 22
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 1998-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1kdiA00
1J9TA 4A2HA 1SJMA 1KDIA 4KO9A 2IDTA 3FYIB 2PPAA 1NPNA 1MDAA 1AZCA 4DP8X 4DP7X 4HCFA 5F7BA 4DP9X 1PLBA 5A7EA 2IH8A 1I53A 2LLNA 2YAPA 4GP8B 1ZIBA 4NAJA 1CUOA 2AANA 1NICA 1PZCA 1XB6A 2FQEA 3PPSA 1JXFA 1KYAA 3GYRA 4E9WA 4YSOA 3SBPA 3FSZA 2B3IA 5TK2A 1NIEA 2NRDA 4GYBA 1OE1A 3FS9A 2UXFA 3QPKA 1M9WA 1CYXA 2BW4A 3WG7B 1JXDA 2AZAA 5PCYA 3TASA 4AKPA 4HHWA 3KW7A 5I26A 1IUZA 3OQRA 4N4YB 3IN2A 3FPYA 2PPCA 4JKNA 3NJLA 2JFCA 3NSFA 2RACA 1SF5A 1AZUA 4ZK8A 2BP8B 4YSCA 1AANA 2EINB 1SDDB 4UF7C 4QLWA 1IKOP 3X1BA 3T6ZA 1NPJA 5B1JA 3WKPA 1JERA 5B3SB 5B7FA 4GY4A 1KCBA 4DP5X 5AZUA 3V9EA 3AG3B 2GC7C 1AR1B 3GDCA 3CZUB 3ZIYA 5AKRA 1E65A 1AZRA 2XV3A 2GIMA 1TU2A 1QNIA 3T6WA 5AFAA 3OD3A 3NJFA 3S8FB 3DTUB 3EH4B 1BYPA 2PP8A 1GY2A 4KO6A 3CVDA 4YL4A 1L9TA 2BWIA 4BWWA 2X87A 1X9RA 1JVLA 4KNTA 3RYMA 2HX7A 2P80D 1PF3A 2FQGA 1BXUA 2OV0A 3UADA 2WO2B 2E86A 3FU9A 3CG8A 1ILUA 2ZOOA 3EF4A 4KOBA 1NIFA 1BQKA 5B1BB 2W88A 2BWDA 3FQYA 2BZCA 2BP8A 3CDZB 3FSAA 1ASQA 2WO3B 2FNWA 1MG3C 1SDDA 2X88A 1GS6X 1NTDA 5ANHA 3C75A 5I28A 2CBPA 1A65A 5PAZA 2GBAA 1RZQA 1BEXA 1CYWA 2J55A 3PLYA 3ABLB 1EHKB 1MG2C 2XU9A 1L9SA 3H56A 3IE9A 1ZDQA 5B1AB 1EZLA 3FPXA 3IBOA 2AZUA 4YVNA 2EIKB 4L0PB 4KNUA 4DP6X 2IDSA 1BXVA 3T6VA 2VSKB 1WS8A 2YAHA 4GP4B 4UANA 2HZHA 3AZUA 4A66A 3TBBA 1NIAA 1JOIA 2Q9OA 2GI0A 1R1CA 3PAZA 1BXAA 5B7MA 2N0MA 1PAZA 3X1EA 2EILB 3QJUB 3X1GA 4G71B 4YSEA 1ID2A 2IDUA 2VW4A 1GW0A 3QJQB 3S3CB 1AAJA 2JXMA 4A2GA 4YSTA 2FQDA 1BYOA 3NJKA 4EF3A 1AS6A 4DP4X 4BXVA 2QDVA 1JZFA 1WA2X 2CCWA 3DKHA 4W1TA 2BP0B 2Y1AA 1UATA 1TKWA 3FT0A 2I7OA 1GSKA 3CDZA 2XLLA 3NP3A 4YSRA 1J9SA 4UAHA 3IEAA 1AQ8A 5I6MA 3N55A 2HRGA 3T9WA 2VM4A 1T5KA 6PAZA 1ETJA 4YSDA 4YSAA 2ZXWB 3ABMB 5I6LA 3BQVA 4YSUA 4P5SA 5I6NA 1GS7A 4FA7B 2YAMA 1N70A 1RCYA 3S3BB 1OCCB 4E9QA 1OE2A 4GP5B 1OOWA 3SQRA 4W9ZA 2FT8A 8PAZA 2Q5BA 2GSMB 2MTAA 2CUAA 1AZBA 1KCWA 5I5JA 4G72B 4WTQA 1A4BA 2CALA 1AG6A 2QT6A 1AS7A 2BP0A 4E9TA 1PY0A 5I5MA 1BQRA 3FU8A 1L9PA 1AIZA 1XMEB 5D4JA 4HALA 3OMIB 2VN3A 4RH4A 1J5DA 2TSAA 1A8ZA 1L9RA 1CURA 4BDVB 1MZYA 7PAZA 3L45A 2PPDA 4DPCX 4DP1X 4HAKA 1PZAA 2J56A 1IC0A 5TK4A 1AACA 5IY5B 3T6XA 1N68A 4G7SB 4M3HA 2FT7A 3ABGA 2PCFA 2XX1A 1ZPUA 1W6WA 2YAOA 3NP4A 3WKQA 1OCRB 3AW5A 4QKTA 2DWTA 3NSCA 4AX3A 2I85A 3TU6A 1ZV2A 4KO5A 2AFNA 4G70B 1OF0A 1TEGA 2GHZA 1V10A 3PCYA 4HZ1A 4YSSA 1PZBA 2YAQA 1B3IA 2PPEA 4ENZA 2VM3A 1ADWA 2HLEB 4E9VA 2IWKA 3EH3B 3JTBA 1A4CA 3SBQA 2YAEA 3MX0B 2VSMB 4HCGA 2IAAC 1E5ZA 2IH9A 1AZNA 2DV6A 2IWEA 2PCYA 3QQXA 3AG2B 4A2FA 1GY1A 1BQ5A 3BVDB 4HHGA 3QJSB 1SF3A 2BO0A 2UXGA 2EIMB 4G7RB 1ZDSA 2XYBA 2HXAA 1MZZA 5B1KA 6PCYA 2XUWA 2Y69B 5I5IA 2DYSB 1FWXA 1M57B 1JZHA 3PAVA 4E9RA 4N8UA 1PNDA 2FQFA 1CC3A 4PAZA 5I6OA 1AOZA 4A68A 3OMNB 2PP9A 2HX9A 1OE3A 2XV2A 1ET5A 4K9JA 3OMAB 3ABKB 1NINA 4M4RB 1JZJA 1ET8A 3ERXA 3MBWB 2BHFA 1ZIAA 2UX7A 3IN0A 3QJTB 2H3XC 3FU7B 2UXTA 3UAEA 2W8CA 2YXWA 4HIPA 1J5CA 3NJIA 1PNCA 1AS8A 2J5WA 3QJRB 1URIA 2QPDB 3EH5B 1WAEA 1JXGA 2OJ1A 3ZX1A 3FYEB 3G5WA 1E30A 4AZUA 1J9RA 1JZIA 4G7QB 2R7EB 4AKOA 1GYCA 4E9XA 1E67A 1HAWA 1SFHA 1KBWA 3AG1B 5I6PA 1L9OA 1PLAA 1V54B 2B08A 2I7SA 5B7EA 2BW5A 2GC4C 2VW6A 1TEFA 2PLTA 2H47C 3UAAA 1X9UA 2XVBA 2YARA 3V9CA 2FJSA 3NJGA 1OCZB 4KOCA 4A2DA 1NWOA 3S8GB 1KDJA 2BZ7A 1JZGA 2FWLB 1A4AA 2WSDA 2CAKA 4YVUA 1QLEB 2ZONA 2DYRB 4BWUA 3HB3B 4Q8BA 2H5UA 5LDUA 3PXLA 3WIAA 1WA0X 1KBVA 4DP0X 3NT0A 1VLXA 2XV0A 1F56A 1V55B 4X4KA 3D12B 4F2FA 1WS7A 4MFHA 4E9YA 2QDWA 9PCYA 3OM3B 4KO7A 1QHQA 2YQBA 3FSWA 4PCYA 3CVCA 2OCCB 4DPAX 3FU7A 3SBRA 1FFTB 1KGYE 2VMJA 1YLBB 2MRYA 2FT6A 1JVOA 3DIVA 2DY2A 4BWTA 1JZEA 1HAUA 4YSQA 1AG0A 4NB7A 1J9QA 1DYZA 2R7EA 1IBYA 3HEIB 4Q89A 1NIDA 2YXVA 3CVBA 3PAUA 3FQ1A 7PCYA 2VW7A 2PP7A 4F7KA 4DP2X 3NSDA 3NJHA 3EHBB 1GR7A 3NJMA 2A3TA 1RZPA 1WA1X 1GS8A 4NERA 1NDTA 4BK5C 3UGEA 1DZ0A 3ASOB 1NZRA 4E9SA 1XB8A 3T71A 2XXFA 1W6LA 4YSPA 2IDQA 3NYKA 3X1FA 3X2QB 4F2EA 1KV7A 2HRHA 3N2JA 4CSZA 4AI7A 3QJVB 4WKXA 4FAAB 4CSPA 4AKQA 1XB3A 3KW8A 1SFDA 2TSBA 1E5YA 2YAFA 2QPEB 3UACA 5F7AA 2P80A 4BDVA 4P5RA 5B1JC 3AY2A 3ZDWA 1L9QA 5I6KA 1FA4A 2XX0A 3NJJA 2JKWA 3FSVA 4JHVA 2GB2A 2FTAA 4TXVB 5E9NA 3H4FA 2UX6A 3AG4B 1PLCA 1ASOA 3TBCA 1ILSA 2UXVA 3X1NA 3ZBMA 4HCIA 1SHWA 4DPBX 5EHFA 3H4HA 4GXFA 2CJ3A 2HX8A 4KNSA 1BAWA 2XXGA 1OV8A 3FQ2A 3WI9A 1A3ZA 1RKRA 3U25A 1SNRA 1PCSA 1HFUA 2XWZA 3S3DB 3UABA 3WNJA 4JHUA 2ZWNA 2AVFA 3NSYA 1W8EA 2DWSA 5D4IA 1ET7A 1SHXA 3WNIA 2IWFA 1IBZA 5FC9A 4A67A 1NIBA 1OCOB 1NWPA 4A2EA 5D4HA 1ASPA 4BXSV 3ASNB 3JT2A 2EIJB 1M56B 3TA4D 2PPFA 2J57A 3NJNA 3GXUB 2IDFA 1PMYA
chains in the Genus database with same CATH superfamily
3N41B 2C3GA 3BH9B 2WC7A 3APMA 1JD9A 3BVNA 4NRZB 1S7VA 4DK6A 1D6EB 4HAGA 4JFFA 3EYUL 1TQBC 3BGAA 4FZ8L 4HMCA 3P4LA 3CK0H 2PPAA 5J5EA 1DUZB 4ZYKB 3GMOB 5KVDL 4E5XA 3D5OF 4J3TA 4IRSB 4K4KA 1SEQL 4YDKH 3ROOA 3N1MC 4LDLB 4NAJA 2AEQL 4PB0H 5FK9B 2X6UA 5E03A 3PPSA 4P23A 2OSLA 1XGUB 2VC2H 1WEJL 3F64A 3SBPA 3V6FB 3P30L 3BH8A 5EU5B 1T5XB 2P5WD 4V33A 3QPKA 3VXSE 2VDNB 4GIAA 5CZVH 1G6VK 4N2NA 3P9MA 1FDLL 5HDRA 3RZCB 3I3BA 3HUJE 4XPBH 3NCJH 2JFCA 4YHYB 3VFWB 3KPSD 1SF5A 2DTSA 4ZK8A 4D9QD 3JWOC 3NIFB 1TJHH 2MSPA 3BH9A 2X6VA 5AKVA 4XP1H 1E4XL 3BZ4B 4NRZA 1D6EA 5AZUA 3NZSA 2ZG3A 4NI3A 3N9GL 3CZUB 5BMFL 1N10A 1ZE3C 1WAAE 1VEMA 4HJGB 4J3XA 3WO4C 1HYSC 1T3FB 1DUZA 4NNYB 4ZYKA 4BZ1L 1YUKB 3GMOA 5JOPE 2XV3A 2Z4TA 4BQ8A 4IRSA 3K46A 3D4CA 2F8OA 5JYMA 1OARH 1MCCA 3LEYH 2H32H 4JO4H 5F96L 5FK9A 1A5FL 1XGUA 4BWWA 1A0QH 1WGVA 2IEPA 3H6AA 3RYMA 3V6FA 3ZZ1A 2O6PA 4G7VL 4HPYL 4ONOA 1RZFL 2Y1VA 5EU5A 1T5XA 1MCRA 5EMYA 4PJIB 3SDAB 4JFDD 3VNZA 2D7TL 4U6VL 1ZTXL 2HT4C 4J8RB 1XIWD 1EQWA 3DV4B 5D70L 1JHLH 2KUTA 4KOBA 1IGMH 4WWID 4KXZH 2QGBA 4S1DD 1OLLA 2EADA 3RZCA 3QORB 4W9JC 4FFZL 3LZQA 3P02A 3FQYA 5DHMC 5DJYA 3VFWA 4Z77B 1CD9B 2QSQA 3VFPB 4FNQA 1PG7W 1NMCC 1TQTA 1ZV5A 1HOCB 4YBLC 3AB0B 5PAZA 1QWHA 2APXA 2OMXB 2NYYD 4BA0A 3UYOD 4CC0A 4W9CC 1L9SA 3J8F7 4HJGA 4NZUH 5LNGA 5FWRA 1U8KB 3FPXA 4YHMH 3MRQB 1T3FA 1GZHA 2YD6A 4NNYA 5CAYB 2O5XL 4DP6X 4HJJH 3AS2A 1IT9H 1MQKL 2O30A 3T0XA 2HZHA 3QDHA 4CC4A 1UUSA 2Q9OA 1DEDA 1A7PL 1DSYA 3L3OB 4R8WL 3VFNB 5B7MA 5K1NA 3CFQA 1CIUA 4AOFA 3O6FC 3N50A 5IGXL 4PJIA 3SDAA 1A6VH 2R0WL 4J8RA 1BD2D 3DVNB 2CH8A 1DQVA 3SKUD 4JO1L 3DV4A 3QEQB 1BYOA 3X11B 1QRND 1JWMB 1P4IL 3DSNB 4WY7H 3LHPL 4LCUA 1MDTA 2WQXA 3QORA 5FCUL 3II1A 4MMYA 4Z77A 1FO0L 2OR8A 3UBXI 3WAKA 4ZTPH 5K69A 1EHLH 1GAFL 2DQJL 3VFPA 5FUCC 1R4XA 1MCWW 3MNDA 1AKJB 1HOCA 4QUOA 5CCHE 3OR6B 3OAZH 1YNTB 2OMXA 4OJFH 3M1BB 2FAUA 2IH1B 2ZOKB 5DVOA 5DMYA 2YR3A 3UG5A 1U8KA 2FJGB 1EDYA 3MRQA 1EBAA 2GBTA 3FK3A 4QRTB 4LMQI 2KZ1B 4NO0B 2YQ2A 2AXGB 2PCFB 5I1CL 1RLBA 5EFIB 2ZX9A 3NDYE 1UXSB 3GHBH 3FU0A 4KRNA 2Y7SA 4IBLT 4LCIH 4LP4A 4A7TA 1BG9A 1DDTA 3VFNA 3L3OA 4LPYA 1OGAE 2EC8A 3GMRB 4Z3HA 4NGHH 3BD3A 3HG3A 4JRXE 5A3IC 8PAZA 1KMGA 2Q5BA 2OI9B 3DVNA 3HFMH 5IBTH 2YEQA 5C97A 1K4CB 1KCWA 1D7BA 3QEQA 3DTDA 3X11A 4G7YH 1JWMA 4XX1E 3DSNA 3I9AA 4WGKA 3ZHNA 3DSFH 3ARBB 3DYPA 4ZXBC 2EE3A 5LLIC 1MY5A 4WIQA 2FATH 1XMEB 1AKJA 4YUEH 2QV4A 3OLDA 3TESA 4RBPK 4TUUA 1A8ZA 1L9RA 3OR6A 4AUJA 1BVLB 1YNTA 3TO2B 5I71C 3LQAL 3WU1A 3HC4H 1NCDH 3RX9A 3MLYH 3M1BA 4JFFE 1Q0YL 5AW8B 2IH1A 2ZOKA 4EQ2A 1G84A 2J72A 1QSEB 5L6YH 2FJGA 3VJ6B 1V3MA 2E7BA 3W11D 3I85A 2WUBL 4N86A 4QRTA 5IY5B 3PQYE 2DN7A 1F4AA 1XCQB 2AXGA 2PCFA 3PDOB 3LS5H 2XZQL 3QDMB 5EFIA 1W6WA 1UXSA 3NP4A 4NQDB 1YYMH 2EXTA 4KBPA 2ZWSA 1EZVX 2A74B 5EOCJ 1I8IB 1SJHB 3GMRA 4N90D 4YMPA 4ZODA 2XVGA 5H8DA 3L4CA 5GGTH 4DKFH 1K4CA 2GPZA 2PPEA 2Z1PA 4YHLH 5J12B 3VFVB 1UWYA 5KTEL 2IWKA 3ARBA 3SBQA 3K71B 4OT1H 4WUUB 3WFHB 5KVEL 4LQ1A 4QTIL 1MNUL 4L0ZA 1MSPA 2J6EH 5LGHL 2VZVA 4ZPTB 1BVLA 3EBIA 3TO2A 4UT6L 5L2KD 1RIVH 2DLFH 2VSDA 5K1JA 5GPRA 1FFRA 1AE6H 1QSEA 3VJ6A 3K1DA 5CMAA 4ZAKB 3KLDA 3WEAA 3M6DA 1XCQA 2GJPA 3PDOA 3CSYB 3QDMA 5DWUH 5I5IA 3F7VB 5BOPA 2A74A 3NA4A 4KROB 1AOZA 1I8IA 1SJHA 2GAZB 3V0WL 4N2KA 4A68A 4Q6IC 2B1HL 1R3IH 2GITB 3CLEH 4DSYA 3C09C 3QAZC 1HE8A 3L4UA 1C12B 1DLFL 1FE8H 1A2YB 4FX5A 4KH2A 2EDEA 3JTTB 2BHFA 3V55A 3VFVA 4QLRA 2JCCF 1UA6L 2X2UA 4GMTL 2BSCA 3K71A 3VWKC 4M43L 4WUUA 3WFHA 1XSOA 3NIFE 2D2OA 5KBKA 1S9XB 3NJIA 4N0CC 4WV1B 4ZPTA 4JRWA 5AZEH 4CDGC 2IV8A 2CJUH 1IKNA 5FF6A 5JOFB 1KV3A 1HWGB 4OGZA 5HJ3A 1LE9B 1K4DB 4JO3H 3GD1C 3NCFB 1JZIA 3JV4B 4AYMC 4F92B 1PD1A 4ZX5A 2DDQH 4U0RC 2KYIA 4E9XA 4ZAKA 1R0AL 5AG9A 4OD1H 4NDMB 4OAWB 3CSYA 2XICA 2X1PA 2HT4D 2WXNA 4PREB 3QT2A 2F61A 2WKOA 3LJ3A 3F7VA 4OLEA 2FEEI 4I13B 4KOCA 3KLSA 3S8GB 3WENA 4FMFA 1KDJA 3S3PA 4K3JH 2NT1A 2GAZA 2X4PB 3ARGC 3M86A 4E2OA 4G8GB 1OSYA 3MLTB 1KBPA 2GITA 4Z8FL 4PJIE 4WHYG 4LFHD 1BAGA 2VMCA 2PWEA 1C12A 1A2YA 1U8JB 3PDDA 2EABA 4Y88A 5AQ0A 3JTTA 1FSKB 4IK7A 5KW9L 1XD1A 4Y2NA 5E51A 4AIEA 4U1MB 5IHWA 3IRZA 4UB0L 4HJTA 3KGTA 5MP6L 3K6OA 5I1HH 1E8YA 2AV7B 1M1XB 5IVZA 2ZJSL 4Q7DA 5TF0A 1S9XA 2EO7A 5AVQB 3IGUA 4HKBB 4WV1A 3ROLB 5JOFA 1MCPH 3H3BC 4W9HC 5D7SL 2WBWB 1HAUA 1K4DA 3QAQA 4OCRH 1J9QA 5HHXH 3JV4A 4TUKL 1DJYA 4P2RD 4GI6A 3O6FD 1INEH 4NDMA 1T21A 4OAWA 2YD5A 2BSRB 3EJTA 2DM4A 4PREA 1GL4B 3AQZA 4E9SA 1WTGT 1XB8A 3Q06A 2XT1B 1G6RB 2X4PA 2BHZA 4G8GA 1L7IL 3CXFA 4F8NA 3MLTA 4Z3EA 3T4AC 4F27A 4Q14A 3KM1A 4JCMA 1GJIA 1ZXKA 3TEYA 2C34A 3TN0C 1U8JA 3SE8H 4DESA 1RZKC 3QEQE 4TUOB 4PIBA 2L7EA 2B2XL 2N4IA 4P5MB 4U1MA 2XWRA 4IDLA 3O6LL 3FT4B 4LVHB 4ZMXA 2QL1A 2AV7A 1M1XA 5DU7A 4JHVA 3ROLA 4HKBA 1EDHA 1DSFL 1VPOL 2VC2B 1ZMYA 3GRBA 3AG4B 4I2XA 5C0JB 4UQBA 2QQNH 3GSXB 2RD0A 4M6AA 1I8LA 4GFTB 1U3YA 1RURL 2HAZA 4RWHA 4MGXA 1BFVH 1ORQB 4BFEA 4MJJA 4PRID 1BAWA 2ZCLH 3QS3A 2BSRA 1R19A 3U25A 4XTRC 4BFIB 4XMTA 5TGBB 4PYHA 2ADIB 4IDJH 3RJQB 3UABA 3ZDYB 1BW8A 4IHBA 4ZBJA 3GXMA 2WIIB 3ZGIA 1MJ7L 1G6RA 2J25A 3SCMB 4ZXBD 1FZOB 2NTFB 1RZ8B 5AW4B 1QX1A 1CTMA 3ILQD 3CHSA 2NYKA 4NP4L 5FC9A 2UWEF 3V0VA 2IAMC 4TUOA 3CC5B 2ZXQA 4GRWB 5D4HA 5C08D 5I6XB 1UM6H 3JVGA 3LDBB 1I9EA 5HGAB 2YFOA 4JCWA 4P5MA 5CD5C 2V2XB 3FT4A 2IDFA 2YPLD 4XVOA 4F57H 5D7JC 1J9TA 4YZFE 3SPGA 1X5KA 2FHCA 2C9QA 3FB6A 1FGVL 3TT1L 4JRYD 1N64H 1UD3A 4JR9H 3VG0L 3DJZA 3FBKA 5H37G 1KFAL 5C0JA 2CDEB 1MWAL 4WSGA 2EUVA 3ATFA 3GSXA 1QSEE 3WNLA 3TURA 4S0HA 3GZOA 5A7EA 1JNNL 5HDWA 3SE4A 1ORQA 3MRNB 2EEDA 1MW0A 3LKOB 1XO8A 3EH1A 3K3QA 3QDME 3RIFF 3D25B 2C3WA 1TZOA 4BFIA 4NQDE 5TGBA 3GMQB 2ADIA 4X5PA 1KYAA 4G6AC 4FOMA 3G5ZB 5F7EH 3FFDB 1KXTB 4KXZI 4KZEH 2WIIA 2O93L 4FC3E 3SCMA 3ARWA 1Q38A 4GYBA 4A7VA 4FQ1L 4X5XB 1RK7A 1FZOA 2NTFA 4BELD 1RZ8A 2E27L 1JGUH 2BVUA 2AZAA 2XQ0A 3TASA 5DJ8B 2BVPB 1JHKL 3IDYC 1MVFA 1R5IA 5T1DL 4QEGA 3GMPB 4KRLB 4JPKH 1QEWB 2OFQA 2RQ8A 3CC5A 3FPYA 3K4ZA 1NEPA 4XNBA 1WYJA 5GGSB 5HGAA 1HCFX 4L4JA 5JR1L 4GO6B 4D2NA 1DVYA 2V2XA 2ZNWA 5ELIA 1S9YB 1X3DA 4WUUE 3W0WB 4E68A 4OTXH 1EUUA 3H54A 3NFPB 2ATAA 3NEOA 4JPWL 2CDEA 4NSKB 3QRFM 5G55A 3T3MB 1Q0EA 4LCWE 2A7BA 4LNVA 1UZ6E 5AW7B 4OLUH 3LKOA 5ICXB 1BQSA 2XJLA 3NJFA 4BHUI 2ZUVA 2PP8A 3RIAK 3HHMA 3RWDB 3GMQA 4LSRL 1TDQA 2X87A 4L9LB 2HFGL 3G5ZA 3FFDA 1KXTA 5SX5K 4L1TA 4X5XA 2OW6A 4P4KC 1BBJA 3NH7L 3VWKD 1OKEA 2Y3NA 3TF4A 5DJ8A 2BVPA 5T3XL 4GAGL 3GMPA 5HHMB 5K9KB 1IZJA 2J8UB 1QEWA 5T3ZE 1BQKA 1G7PB 1KELL 3S4SG 5GGSA 2BWDA 3WFCL 3E9UA 5I24A 3HRZB 3NK3A 5C2BL 5MENE 5IJCC 5CZXC 1S9YA 2X88A 4PJ8B 2CBPA 4KPHH 3W0WA 2X0UA 3NFPA 3PLYA 1I9JL 2RFXB 3BQUC 1ZDQA 2XZAH 3QEHB 4LE8A 3NOIA 5BOZG 4ZO8A 1Y6KR 4J3UA 4NSKA 4O58H 3ARGD 2MMXA 1ZY9A 1KCRH 4QPEA 1OT2A 2WVUA 2XKSA 1YC7A 2XQYK 4K23H 5ICXA 2Y06H 3GI8L 3DRQB 3OKKB 4U3HA 2ICCA 3OPZH 4HK3N 3RWDA 4ZX4A 2GI0A 2Y2YA 4NPJA 2N0MA 4L9LA 3S97C 2QVKA 4POZC 1UCBL 2A38A 2EIBA 4N2BA 5K9QG 4Y89A 4G8GE 4MA7L 4WI8A 2DJ4A 2GJ6B 2X1XR 1LO2L 3NJKA 2CBMA 3D85D 5K9KA 3VSQA 4JAMB 2XN9D 3RB5A 3DKHA 4D0CB 4I3GA 5CUSL 1G7PA 5D6CB 1R34A 3BPOB 2BSDA 4LVEA 3VGFA 3HRZA 2DZEA 2NY5H 2ESVB 4OFVA 4PJ8A 3RY6C 1LQSR 3PWPE 5FO2A 1UA7A 4YK4C 5I6MA 1KPUB 3O45B 2Z92B 3I50L 3INUH 2RFXA 6PAZA 4YSDA 3QEHA 5ADPH 4NO2B 1AXIB 5JW3H 4Y5VB 5KSAC 2OR9L 3ABMB 1FIEA 3DO3A 5DLML 3ISWA 2VLJD 4Y1AD 4YSUA 2CE6A 3X3GL 2Z0UA 2HYMA 1JNJA 4QGTA 2VXQH 3MLSH 5FFOA 4FA7B 1EZUA 3DRQA 3OKKA 5F7HA 4KX9A 1YYLH 4C4UA 4I9WD 5D5MB 1ZK5A 4V1DB 3QULB 1WZMA 3TN0D 4JRLA 7TAAA 4FFYH 2F8IA 1RK1B 1B0RB 4GP5B 4OF8A 1CN4A 3D3VD 5C07B 2GHWB 3C5SB 3MUY1 1EBPA 4L1LA 4WFEE 1P4LB 3FB7B 1LMIA 3HVDA 2GJ6A 1DP0A 1BQUA 3NPSC 5H4ZA 1UUNA 5IVNA 1IEBB 4JAMA 4XC1L 3KEDA 4GSXA 4XCCL 4D0CA 5D6CA 2AS5M 3WJLA 5AKTA 3A6BH 3ZDXB 5DC4B 3MUGB 5I1GH 4IRJB 1CXFA 5D4JA 1JZ8A 4R4BB 2ESVA 5DD3H 3KE0A 1FHNA 2ZUXA 4AGQA 1KPUA 2DQFB 3O45A 3EDDA 5GS0H 5LCVH 1LQBC 3D39B 4DP1X 1J1PL 1SXCA 3EJZD 4HXBH 2X3BA 4XTRD 3UGUA 4NO2A 4PU2A 2DD8L 2BNRB 4Y5VA 4OR1A 1WFUA 3KYNB 1UYWL 3F58L 1J86A 2P49B 2PYFB 1BQLL 2J1KA 1JI2A 5GGTA 4KX8A 5DF0A 3VXRB 5I0ZA 3TH4T 3CGTA 1YY9D 2QMJA 3CBJB 2LQRA 2VLME 1ZLEA 5D5MA 4N8CH 2FR4B 4V1DA 3MLWH 3QULA 7FABL 3V52H 4Y19E 4ES8A 5IJKC 3ZDYE 4B3VA 1RK1A 1B0RA 4KC3B 1V10A 3PCYA 5C07A 3C5SA 1P4LA 3FB7A 2BOCB 5CD5D 1S4IA 2YAQA 4X5RA 3ZYIA 5GXBB 3RGVD 1IEBA 4IKNA 4DFIA 3EH3B 4OCMC 3VCLB 4CVZB 1T03H 1CGSL 4GRWE 1A4CA 2DLTA 5I1KL 4HCGA 4HOZA 4IRJA 1MW2A 3L4ZA 2WW8A 3LTVA 4R4BA 1LVEA 2JJTC 2IWEA 2UY7A 3DMMB 2L04A 1LO4L 4GG6B 4G6JL 5MHSE 2XA8L 1PZ5B 2DQFA 3HLAB 1KYOJ 2C4FU 3DDFA 3D39A 1ZV9A 3EOBB 2Z34A 5ABZA 2BNRA 1JV5B 2D9CA 1F3RB 4OLYH 4G6AD 1UENA 2PYFA 3MNWB 5AL8A 3WKYA 2OX5B 3VXRA 3IAQA 1Y1DA 5IW6B 3QG7L 3PUCA 5FIEA 3WY2A 1TF4A 1N3NB 2WB7A 2W91A 4BH7B 4U7KA 2JQZA 1JZHA 2ZKHL 3IMTA 3V6BR 3OKLB 2FR4A 2JJSC 2H1LM 3R0NA 3UTPD 5JXEA 4KKPA 3TFBA 4AJ0A 1JJUA 1GGIL 4B9YA 1K3IA 2BOCA 2IQ9L 4YBQD 5F0MB 1HNGA 3WOVA 3L2MA 3VGDA 2CDGB 3GDBA 3GHEL 3MBWB 2MOGA 4RX4A 3LZRA 1E4HA 1JDCA 3VCLA 3WIHL 4CVZA 4TSCL 1OP5H 5C09D 3RP1A 1BWWA 1ZS2A 3EGDB 3IE4A 3WY3A 1T20B 4C47A 3M7FB 4JG9A 2R0LL 3SBWA 3DMMA 4HCRL 4LAQH 3VA6A 3W0WE 4GG6A 1PZ5A 1WH0A 3BPLB 3HLAA 1ZLVH 2QZQA 3FYEB 2MOVA 3QRGL 3G5WA 1E30A 3EOBA 1AVAA 3RWHB 1JZ5A 4HH8A 1J0YA 2AI0L 5DHYB 5IG7B 3P54A 1JV5A 2D4DA 3C8DA 5I6PA 3T3ME 1IE4A 3MNWA 2OX5A 2X89A 2WBKA 2A4CA 5DJ0A 1CF1A 5IW6A 4P4KD 1PTZA 2YARA 4IMKA 1N3NA 4BH7A 5EBMB 4BGDA 3OKLA 1A6TA 2VXSH 4ABWA 2UZYB 3QUMB 4YZWA 4L2YA 2CAKA 4BUHA 1PVHA 1IGIH 3UC2A 5FLUA 4UOZA 3AREB 4BKTC 1HZHH 2FB4H 3NSJA 5CZXD 2CDGA 3MLUL 3IGFA 1FLRL 3MBWA 3M17B 5HHME 2J8UE 1D9KB 3QCUL 3BQUD 2DH2A 4H0GA 4MS8C 2WNGA 3EGDA 4YXLH 4TLTA 1T20A 4HIQA 2ZICA 1PDKB 4NWUH 4FTVB 3DXAD 4F1SA 4OCXL 4XVUC 1MCQA 1N6QL 4D9RD 3ZL2A 3RWHA 1HH9B 3PPEA 5DHYA 3V4VH 4MXVF 5IG7A 3AWFA 4N6RB 1A6ZB 4POZD 2R0KH 1N67A 2VW7A 4LCVA 4EXKA 4HD5A 1JTTA 4PCTA 1RZPA 3V0DA 3LPGA 3SZKC 3ARFB 2Z3FA 3B2UC 3E2HC 4MZ3A 4XCEB 5C6TH 2OA9A 5EBMA 3S35H 4HC1H 3H6JA 3NCYP 4NZTH 3PS6A 1NZRA 4Y9CA 2X3AA 2XXFA 3S35X 2UZYA 2ZPKL 3G3LA 3QUMA 3CCHB 4JN1L 3VX0A 4Z7NF 4DGVL 2VMDA 1H0DA 3VQ2C 3WEXB 2OKMA 3AREA 1IILE 4YEFA 4F8OA 2GJ6E 3NACL 1J8HE 2ENSA 1G94A 4DKEL 2KZKA 3M17A 4CRPA 1VFMA 1D9KA 4X5LA 2QPEB 5F7AA 5DO2C 3FN0L 5DGQA 5KSAD 4MBRA 1QLEH 4FQJL 3VG9C 2X41A 2ESVE 1PDKA 4FTVA 5E6IB 4OSUH 3CHRA 4FKHA 4TXVB 5I8OL 5F9OL 5KYWB 4GUCA 3BFWA 3N1PC 1HH9A 4KITB 4N6RA 4RRPM 3ET9F 1X4XA 5EHFA 1VERA 3QEGH 1A6ZA 2WCGA 3EYUH 4I48B 4X7SL 2VDQL 5AW5B 3GMLB 2H6UA 4KXDA 4KVNH 3ARFA 4G9FD 1CVRA 4XCEA 2IG2H 1PCSA 2WWOA 5D5ME 4V1DE 4OB5L 4MKTA 1WBXB 4XOBA 3CCHA 1H6EA 4YNYB 2IMNA 5C07E 2Y7NA 3L3JB 5EEWA 2NY1D 3WEXA 1KLFB 3OMZA 3T0DA 5FGCB 3WNIA 2XJKA 2APTA 4N0UB 1NWPA 5ILTH 4A2EA 4KVPA 5E4EB 1QR1B 4PY7B 1HXMB 4FNPA 4XPGH 1XH0A 3EYSH 1CICB 5I73B 4BIKA 3ZDXE 1SHSA 4ZS6C 3UTQB 5E6IA 3F7QA 3S37L 1HINL 1N8ZB 4NO5B 3RTQB 4BZYA 3WLBB 5T1LD 1KIPA 1GIGH 3BUQA 5A2LH 3V5KB 5KYWA 2C9AA 5AOIA 3COOA 4O5LL 4F8LA 2VO5A 3CFTA 5I2IB 4YHOH 5F0PB 3TWCL 2BNRE 2FJFB 3LZPA 2WXOA 3T8XB 2O5ZL 2LLNA 3B3IB 4I48A 3VD9A 4R96B 3OJVC 3IPFA 3N41F 3VXRE 3GMLA 4K94H 2AEPH 2FO1A 3FTVA 3LVEA 4BZ1H 4N2HA 4I3SH 4LEOB 3OJMB 3WEOA 2P8LB 1UWEH 5D1ZB 4LARL 1WBXA 5D7KE 3IJYB 3LEXA 2VITB 4YNYA 3P3YA 1YAZA 3VXTB 2NY6B 3L3JA 5F96H 1KLFA 1AZVA 1UD4A 2HB0A 4HHWA 4XMKH 1KY7A 2K9FB 4N0UA 4AVKA 4HPYH 4YXKH 1QR1A 4PY7A 5EC2B 2JI2A 1HXMA 1WO2A 4N2FA 1CICA 3A6CL 3FUDA 2NXYB 4NOFA 5DC0A 5AZ2L 3NEXA 2G60H 3MDJA 4GBXC 5FHBL 2R1WB 1QRKA 3UTQA 2MQ3A 1N8ZA 1QFPA 4KKLC 1F18A 4KK9C 4NO5A 3RTQA 3WLBA 4GG6E 3V5KA 4IRZL 2J8OA 4XMZA 1GJUA 2AV1B 5I2IA 3WXVL 5D2NC 2FJFA 4JKLA 1QNIA 3T8XA 1Z5YD 3B3IA 3NIFF 4R96A 3T6WA 1VFOA 2H6OA 3U79A 1IFGA 3E1ZA 4MMXA 2O5XH 3SDDD 4LEOA 4KJPC 3ZO0A 2P8LA 5JMRA 5D1ZA 1MQKH 4XC3H 4RZKA 4NQTA 1NGPL 1XF3B 3IJYA 2VAJA 2VITA 3VXTA 3OAZK 4QOKB 1CL7H 2E86A 2VDMB 4NQSB 2LFEA 1DR9A 4YFLI 2JXMB 3S96B 2QQLH 4K8RL 2HTKC 4IJTA 2B9BA 1NA8A 5IW1B 3DARA 5IGXH 2E8YA 2PXYC 1OAYH 2Q20A 4KFZC 3REVB 5EC2A 1MQ8A 1CFVL 1TNMA 4AYEC 1EEQA 1JGVL 4CL7A 2WQAA 3STLB 4PJIF 1A65A 2R1WA 3QUXC 5T5FL 4H44C 4FNSA 4RRPA 4XVTL 1J0IA 4DETA 2XU9A 3G9VA 2W60B 4NS0A 2AV1A 3H0TB 3KPPB 4NQEB 3NA9L 4XPHH 3MRMB 4K3EL 4TVUA 3NK4A 1ZOXA 5CCKL 4ORZC 2Y36H 3LNEA 5DURB 2PTUA 5A2KH 5LG1A 3GJFK 1EVUA 4JE4B 1RZGB 4EO5A 2EILB 4JKKA 1XF3A 2H2SC 4DEPB 4QOKA 1GW0A 2X4QB 2C9PA 4MS8D 4NQSA 4IBWA 4IQHA 4ZS7H 2JXMA 3DX9B 1AMXA 2FLRT 2BWQA 3S96A 4KJYB 4UOW0 4UAOB 4A6YL 4Z0XB 2ED9A 2Y24A 4KMLB 4BXVA 1Z32X 4N0YH 3LNIA 1Y0LB 4W9EC 4XVUD 5IW1A 4W1TA 1CS6A 3REVA 3WMQA 4HJSA 3H53A 2XTJC 1P6WA 1RZJH 1R3LB 2EXSA 3IFLL 1WFJA 3WDIA 3NP3A 4ZMLA 3STLA 2VXQA 2P8PB 4LGRB 4LASH 5BV7L 3LIZA 1DJWA 1QPXA 4FTVE 1VGEH 4LLAA 3CMOL 2Q8AH 1IE5A 3OJ2C 3LX9A 2H1PH 3B2UD 2W60A 3FUMA 3H0TA 3KPPA 4NQEA 4P2QE 3ZK0A 2GSIB 3MRMA 1P0SE 5AG8A 5CP3A 2EUZA 3BAWA 3G04B 1THCA 1CFMA 4EQ3A 4APQC 1MH5B 2H3NB 1U33A 3UERA 1P7BA 5KBNC 1YNTF 2CO2A 1HHIB 5AAMA 5TDPB 4E9QA 1RZGA 5HYJD 3AXHA 3I9GL 5EORL 1WWAX 1ZE3H 1UT9A 2N1TE 2NPLX 2X4QA 1S7SB 2CUAA 3MR9B 4NKOB 1AZBA 5D1XC 3QZPA 4JFOB 5DHVB 3DX9A 1KIUB 5IK3B 3ULUL 4KJYA 1I1AB 1AP2B 4Z0XA 3ZKND 1KN2L 1Y0LA 3UAJC 2D7MA 2YQ3A 4NWTH 1S46A 5ITBH 1RIUH 2Z4QB 3PFUA 4JANB 1R3LA 1ECYA 1OALA 4H8HA 4TQHA 2P8PA 3D08A 5HGHB 1RP8A 2FWUA 4CN6A 2G2PA 3IDXL 1JK9B 1QBLH 3ZL4L 4LVNC 1DFBH 4HAKA 4UTBL 3T0EC 4L3EB 4GW1B 4HJ1A 1J8RA 3UCQA 4KK5C 4ES9A 4U1GC 1PAMA 1CXEA 2GSIA 3SYQA 3V9FA 3G04A 5L7XH 2AEOA 4YZFF 1J8SA 1IGCL 4MWFB 1CQYA 1MH5A 2DICA 2H3NA 3BKYH 3C08H 4K0OA 4BYHA 4PYGA 2MPAH 5M94B 3TYGL 5CXPA 1HHIA 1SJEB 2YXMA 5D9SB 5FDYA 4F7CB 4UM9D 4G70B 4RGNB 1MRFL 5TDPA 3FZUC 3MNVB 1JPGB 2DQCH 3DYMA 3HMWL 2EVGA 1IMHC 1A3LL 2B16A 4RCAA 4YSSA 4NKOA 4PVMA 1S7SA 3MR9A 4LSTH 5IK3A 1OY3B 1RD6A 5DHVA 4JFOA 5A40E 1KIUA 2OZ4L 2X6CA 3VWJD 4ACTA 1I1AA 1AP2A 2XWEA 4EZKA 3V0WH 1MVUB 2WYTA 1IAIL 4N0UE 2CUIA 4JM2C 1PCXA 3PP4L 3BPNC 2W9EH 4OCNC 5D6DA 5BVPH 1KJ3H 2VABA 5SWZD 4JANA 3O3UN 3V4PH 1T7WA 3LN4B 1FH5L 2SODB 3CFCH 5HGHA 5GZNA 2WLMA 5EWIH 2Y23A 1JK9A 2F8XC 4K7FB 1I7RB 3QJSB 4M43H 4RAHA 4L3EA 4GW1A 3WFZA 5DS2A 2YHGA 5AYUH 3NGBC 1DBML 4ZMZA 5DJAB 4MWFA 1QUNB 3WGVB 3AGVA 1QW9A 2QVTA 5D8JL 3O8XC 3WNPA 4F7CA 5D9SA 3UG3A 1A14L 3MNVA 4XVJL 1JPGA 1WT5C 3OG4B 2D3VA 4EZLA 1IM9D 2XV2A 5F7KC 1ET5A 4K9JA 4M5ZL 4GBXD 1NCGA 2YJLA 1MVUA 3SGKC 4J2XA 5CJBA 4XZUB 4KKLD 4KK9D 2WQVA 4Y2OB 5G5DB 1OD9A 4Q0XL 25C8H 3BZDA 4HXAL 1F45A 3MBXH 5HDQL 2UXTA 3LN4A 1H3PL 1LYQA 1OF2B 3KBHE 3JZ7A 5EZJB 4A37A 1ZGLP 4PD4K 1Z2KA 4WUKH 4K7FA 4JPVL 1I7RA 5CJQL 4AZUA 5F9AC 3B9VA 2COQA 3KPSB 4ODHH 1G4RA 5D72H 2BNUB 3EHBC 1I1YB 2WVTA 4X0KB 4XXCA 4PRAA 4YFDB 2P7TB 3CHOA 5DJAA 5B7EA 3DK2A 4ZQTA 1P5UC 4F9PA 5I18L 1R6VA 1QUNA 4PVLA 4HHAB 3EBHA 3H2WA 5I75C 2QADB 2BZ7A 2HTKD 3LQAC 2AJZB 2PXYD 1EX0A 4G6ML 4LCCC 1QLEB 4Q4EA 3ILPB 1KXVA 4BWUA 5ADOL 1D6VL 2I07B 4EKXA 4R6UA 4ESKA 4QOKE 3D6GA 1WA0X 4U2ZA 2NQ3A 5DA4A 1EANA 3NT0A 4WLCA 1CGWA 2MCMA 3S5LB 4AUUA 3PNWB 4FABL 2F5BH 1HZKA 4XZUA 4WEBL 4Q6YA 5TE4L 4Y2OA 5G5DA 1M6OB 3QI9D 4KMTL 4GO9A 4DPAX 1HJCA 3Q9QA 2BC4A 4JFDB 3MJ9L 3TPKA 3MV8B 1OF2A 1XIWB 3QZLA 4GI8A 4XN1A 4ELMB 5EZJA 2HG0A 2FT6A 1JTPA 4C4KO 1HJBC 4WWOA 4YSQA 1C8QA 1IBYA 3KPSA 4NQEE 3U7YH 2LTQB 2BNUA 1I1YA 4X0KA 4LLUB 1R3KB 1VPOH 2P7TA 2H2SD 2A3TA 4PJDB 5DT1L 4HHAA 1CCZA 3RVTC 4V11A 5ESQB 2WANA 1WUNT 1A4JB 2AJZA 5JORB 4X7DC 2ZUSA 3ZVVA 3TT3H 3F5WA 4L23A 1NOLA 3ILPA 4FZEL 4LIQH 1RV6X 2I07A 2ETWA 1NLDH 5CU5A 4AI7A 2EE9A 3MJ8B 2MCPL 1UM4H 1NDMB 5K9JL 3S5LA 1JSYA 2F58L 3P9WB 1ACCA 2GJZB 3MLVH 3PNWA 3ZTJG 4AW7A 3K6IA 1L9MA 3RX8A 3CXDH 5DFVC 1M6OA 2YUZA 4AMKH 3BLBA 1ZA6B 2X70A 3MV8A 1BD2B 1E4XI 1XIWA 4RAVB 4ELMA 2GB2A 4LRIC 2FTAA 5I1AB 3DOIA 3HR5B 4FRWA 4MZIA 5DEGB 1QRNB 3QR2A 3SO3B 4APQD 2HT3C 1ICTA 4HDIB 4QRAA 5D7EA 1ILSA 3GBMH 5HHVL 1W72L 4PGJA 2FJUB 1JN6B 3HVNA 4XN5A 4CVUA 3LXCA 2CJ3A 3QZWB 5C9JB 2BSTB 3KGUA 3MGAA 1R3KA 4LLUA 4N68A 1ZGLM 5SX4H 2WLIB 4XOEA 4DVRH 4ZMVA 4ZX6A 4ZMPA 5D1XD 3ZSTA 3WO3B 5ESQA 5AEAA 1I9IL 3P3TA 1A4JA 1QMUA 5JORA 3UAJD 4JHUA 1EJ6A 5E2TH 1WZLA 3Q13A 1RZ7H 1QNZL 1SPDA 5F71A 2FECL 4FQXA 3MJ8A 5I74B 1NDMA 1PJWA 1U93B 4OLZH 4NN7C 4Q9BA 5F0JB 2GJZA 4GMSL 4X98B 3U6XA 4WK4B 1ASPA 1OP4A 2EIJB 4JG5A 4PWKA 4YN3A 3L7FB 4KK5D 3BVWA 1JHKH 4OIBA 5HSFA 1ZA6A 1KB9J 1BD2A 4RAVA 2BY1A 4AIXA 3SDXB 1P84K 1MCWM 5I1AA 3HR5A 4N0RA 1EEUA 1I3RB 1QRNA 1WZKA 4TVPL 5DEGA 1G1KA 1F6AB 3GBDA 4HDIA 3D48R 3MLZH 4GRWF 1E7VA 4L3EE 1YYCA 1CGXA 4B53A 1JN6A 2KZWA 4ONHB 3FZUD 1PLBA 2ZSWB 2IH8A 3QZWA 5HJGA 2BSTA 4N1EA 3VTAA 5C9JA 3BJ91 3QIWC 2WLIA 3ABZA 4XNZC 3CQPA 2BRRH 4BK5A 1K6QL 1A25A 1ZHKB 4I18B 1J5OH 3NQIA 4RGNE 3C60D 5IW3A 4NXKA 1M9WA 3ECUA 1CFNB 5AALA 1UZ8B 4AKPA 1BF8A 3Q8BA 3N85H 2XXMB 1QKZH 4K7PH 1U93A 2AQTA 4KK6C 4OGXH 4DUVA 3EXLA 1F4XL 2AJVL 4X98A 3QZMA 2LOEA 2B1AH 3U1PA 3ECQA 1D5ZB 5AENA 4K7PX 4L8BB 3KM2A 1AHWB 2CNYA 2YIHA 5DUMH 2GIXA 1UM5H 3L7FA 3KVDD 1NAKL 5T3XH 4QRQB 4EVNB 1IKOP 3X1BA 3VH8G 9CGTA 3SDXA 3QZBA 4FULA 4HIXL 3V9EA 1I3RA 3WN5C 1F6AA 1QFHA 1TQBB 4UI2A 1ZGLB 3O8XD 5F1NB 1A7RH 3VD7A 4FQQB 4U1LB 4ONHA 5L9DL 3RI5F 1L0QA 2Z8RA 2ZSWA 2FGWH 4ICXA 1IBGH 1NCCL 4E5XG 4JHAL 4HKZB 1OL0A 2V9QA 3O2VH 1UD2A 5IUSA 3S8FB 1FRGL 2EXYC 4UTAL 1IV8A 4PEEA 1GY2A 3K5RA 3CVDA 5FXCH 2BWIA 4ONFL 4KNTA 1ZHKA 2LU3A 2LW3A 4OGYH 4I18A 2HX7A 5F70A 4DGYL 5FYKU 5CN3A 4LEXL 4OBRA 3T3MF 5KOMC 5HI3C 1CFNA 4HBQA 1UB5B 4MA3B 1IC7H 1UZ8A 5K1VA 5D55A 2I69A 2V9UA 4YOKA 5DD0H 5FHAL 4HOXA 1PIFA 3U0WL 4DWHA 1GKEA 2E6QA 4PS8A 5KVFE 5IMOB 1CO1A 2R8SL 1D5ZA 4L8BA 4M7LL 1KEML 1AHWA 4Z3FA 4WTZA 3L4TA 2VDOB 1G43A 2VXUH 3ZIMA 4MJID 4QRQA 2P5WE 4WZ9A 4EVNA 4F37F 3ETTA 4X4ZA 3PY9A 5DWPA 4RDBA 5CSGA 2VJ8A 1BEXA 2AQRA 3B43A 3BSZA 2JB5L 2J20A 4OF0A 2X2YA 1BOYA 4P57B 4LSPH 1ZGLA 4UBDD 5F1NA 3CX5J 2ZAHA 3IU4L 4FQQA 4L0PB 1JCVA 3D0LB 3Q5TA 2AQ1A 4HPOH 4K9EC 3KPSE 4U1LA 3WO4B 1UWXH 3OBAA 4D9QE 3L9YA 4I5BB 3TTYA 3BISA 3WL9B 4HKZA 1WS8A 4MD5B 3P4MB 2WOYA 1LO3L 5E08L 4UQ9A 2V3FA 4FLRA 2R69H 2J1WA 4OGAD 3X3GH 1G7QB 1DVFC 1H19A 1T2QH 1YRKA 4FXGC 3X1GA 4GIPD 2EH8H 1PLGL 3CVIL 3ZTNL 3QZNA 4PLOB 3S3CB 1UB5A 4MA3A 4UT7H 3U1SH 4CW1B 1MELA 5EF0A 1VDGA 3MTRA 2YKLL 3GXDA 4TUJB 1H8LA 2EYTB 2HUHA 4OLXL 5IMOA 2BP0B 2Y1AA 4PGDB 4AEHH 5IBLD 3IGKA 3C5ZC 4Y7MA 5AOZA 5M95B 5IKCB 1PZ3A 4FHKA 4JFXA 1TENA 3LMJL 4JFDE 4O2EB 1AFVH 1NMCB 5T8IA 4LLVB 4YBLB 4ELME 4JDTH 5IOPB 5GS1C 4WHYH 3RVTD 3W2DH 4P57A 5H35B 1QFOA 5LWYH 3D0LA 5I6LA 5C2UB 3OC5A 4M6NL 4O00A 2XKUA 4I5BA 3WL9A 3GK8H 4MD5A 4PJDE 3P4MA 4XCNB 1LL1A 1XAKA 5LGJB 2E75C 1I9RL 4NENB 32C2B 1EPFA 1UCTA 1Y6NR 1WGOA 1G7QA 5DQDL 4ELKB 3V4PB 5DFVD 4P2RB 3I2CL 1G7JB 2ROXA 3O6FB 3HBZA 1F4WH 4CW1A 2P45B 1NCTA 3SIKA 2XVKA 1TTAA 4DF9A 1OTTD 4E9LA 5FYLD 3L1OH 4GQPH 1AI1H 2QT6A 2IO5A 1RIHH 2EYTA 2LE9A 4TUJA 5D5MF 4HS8H 5DUPL 5FUOL 1P6FA 2BP0A 2HT3D 2RQEA 4PGDA 4XOAA 5IKCA 3AABA 3MNZB 4WKZB 4ERSH 1FL6B 4O2EA 4EOWH 1NL0L 1TMCB 3E38A 1HOEA 2CXKA 1BD2E 4LLVA 4TLKA 1L6ZA 4FJ6A 3VXOB 4RMSA 4MJHA 4DPCX 1QRNE 3L13A 1H9VA 3QIUD 4TLUA 1DJIA 2LGNA 2J56A 5H35A 5IWLC 4QXTB 4YHNB 4PPTA 3GSUA 3ZDXF 4HLEA 2QR0B 1I1CA 5GJTL 5F9JB 1CR9H 2XY1A 1O9VA 4MLSA 1JPSL 5E95B 1RFDL 4L4TD 2YD7A 1XX9C 3ESNA 4LSDA 2VQ4A 5MEPB 1N12A 4PWGA 1OP5K 4Q9QL 2F2HA 4XCNA 5LGJA 1V7ML 5FW7A 3IS1X 4NENA 1FFQA 2XWXA 32C2A 3GXNA 4JY6B 4M4PA 1GTFA 4XB8A 3EOTL 4BZ2L 2OSWA 2FUTA 4P2RA 4TRPL 1G7JA 1LO0H 3NCBB 1SYSB 1KCVH 3O6FA 5ALCH 4C4KT 3VXUD 3EJUA 4PRIB 1ZLVK 5JHLA 4JFZL 4U1IB 4ENZA 3HZMB 1G4MA 3TV3H 3PE9A 2HLEB 2V3DA 1KLUB 3T2NH 3N43B 4X9YA 5EOCH 3GUTB 2OL3L 5E8DL 1H8SA 5KBDA 5DRZB 4ALAC 5E2VH 4KWUA 4ZXBB 4G1EB 4M1DL 3MNZA 4XMPL 1OAZH 4WKZA 1FL6A 2YD1A 3BKMH 3S88L 2Y7OA 3KJ4C 3QIWD 4ZO7A 3SDXE 3VXOA 4AZ8B 5I71B 4N8VB 5CP7B 1J05B 4KY1H 4QXTA 2V5YA 4YHNA 1TJGL 3V5HB 2QR0A 4LEEA 2YPLB 5F9JA 2ZUTA 3IDJB 3O3BB 1S8DB 4WCYL 4DGUA 5DMKB 4PW3A 4ATTA 2DYSB 5MEPA 3EF7A 3HJEA 4M7JH 1A6UL 3KPLB 4KK6D 4JY6A 1GC1L 1MRCL 3BT2H 4HGWB 5H37H 1FIGL 5GJSH 3E7JA 4AQAB 1SYSA 2E76C 2ICES 4I8DA 1II4E 4PRIA 4XP6L 4JFSA 2K3HA 3H2QA 4U6YB 4U1IA 5DJXB 3HZMA 2W38A 3K2MC 3ZQ9A 5C0BB 2AABL 1KLUA 1GOFA 4BKLB 2DYPD 2HVBA 1OCWH 2CDFB 3GUTA 1MFMA 2VDLB 1QFWM 2H0FA 5DRZA 3OKMB 4ZXBA 1R75A 2YN5A 3BKJH 4G1EA 1MFBH 3SPVB 3VI3F 1J5CA 3QUZC 1GOGA 2DRUA 1YEEH 1G9NL 3PRZA 1DANU 2QPDB 3EH5B 1E3FA 4N8VA 2EXYD 1Z5HA 1ZSDB 1D5IL 1EFXD 5CP7A 1J05A 2J88L 2YA0A 1DFXA 3MV7D 3CPUA 1KENL 5AD0B 3WNNA 1U6AL 2W65B 2ROYA 3NG5A 3V5HA 1KBWA 3IDNB 4R3SB 2YPLA 1GZHC 3IDJA 3P0YH 3O3BA 1S8DA 2GC4C 5DMKA 1TEFA 5GGQL 1X9UA 2EQDA 4G3YL 5HI3D 4ZFOB 3NJGA 4PSRA 1KCSH 5L2KE 1HH6A 3IFOB 3ML8A 4AGLA 3V2AR 4MAYD 1NCWH 1BMWA 1MCHA 2N59A 4HGWA 2K6ZA 3V0EA 4AQAA 4KKNA 4Q6IB 3OSVA 4GFXA 3RFZC 2MTPA 4U6YA 5J56B 4M62H 5DJXA 1WFOA 3C09B 3QAZB 9PCYA 5C0BA 3VU1A 1UWFA 2YQBA 4FE9A 4DAGL 2XXCB 4BKLA 4BINA 1I75A 1TQWA 2CDFA 2ADFH 3TH2T 1WICA 4PJGB 3F6JA 3OKMA 1BPLB 1KC5L 4BQ6A 1ES0B 3SPVA 4P2OC 3VWKB 3U2IA 1HHHB 4KDTC 1ADQA 4NRYB 2CGRL 1X5HA 2MOQA 2OCFD 4RGOH 3QQ3B 1ZSDA 5JPNC 3LNGA 2NNFA 2I5YH 2W1NA 2CO7B 5AD0A 1HSBB 4N2LA 3E6HB 2W65A 1E90A 1DVFD 1RY7B 4TNWF 3IDNA 4R3SA 5EUOF 3EKCA 4H1LG 4U0RB 2HWZL 5D7IB 5GGVL 2JMRA 2YQGA 4J8QA 2XSKA 4ZFOA 3O0RH 5EOQL 2K8MA 1EO8H 3IFOA 5MERB 1GPOH 3LZLA 1FAIH 1FPTH 3B7YA 2VDQH 3QFGA 4OFDA 3THML 5FOBB 3DUUB 4F2EA 4DT2A 3ARGB 2KLSA 4EZJA 4Q6IA 2D9QB 2C9XA 5EU6D 5KG9B 1NM9A 4UIKH 4R26H 2LABA 4TSBL 4AKQA 1XB3A 3FT1A 2CBQA 4YC2C 2FRGP 2DQHL 1A6WL 2VERA 4KFMA 1AY1H 4X6DB 3J07A 1ES0A 5E2WL 3VWKA 1E6OH 5C92A 1HHHA 3SOBH 3VUAA 1FBIL 4NRYA 5KJ4A 3D85B 5CBAB 2XN9B 3QQ3A 3MCLL 2CR0A 4XRCB 3FTXA 5CM1A 2CO7A 3CLFH 1HSBA 4MMZC 3E6HA 1KCKA 1OPGL 3MA9L 4GIOA 4OFKA 4MYWB 5E4IA 1ZLSL 2YRLA 4KHTH 5D7IA 1ETA1 1QTSA 1ND0A 3BKCH 4RGMC 5CGYC 3HAEB 2Q8BH 4ANUA 5MERA 4ENEC 2F1EA 3ZMRA 3MCG1 2YWZA 1OB0A 5J3HC 5FOBA 3DUUA 1RULL 4P2RE 4R9HA 4F7EB 2OK0H 3ARGA 2J5LC 2VYRE 1ET7A 3LCYA 1A02N 1WJ3A 2O72A 3T4AB 3DO4A 4LARH 5KG9A 4PJ9D 3O0LA 4XBEH 5JQHC 4DEUA 3EGSB 4HWZB 3TN0B 4LHUD 3ASNB 4QHMB 3QG6B 1DEEB 3TA4D 1JPTL 4NJAH 3Q1SH 2K0RA 3FC8A 1MFDL 4X7TB 2OM5A 4X6DA 2YS4A 3HA0A 2V9RA 4DKAA 1FNSH 5KSUA 4XNYH 1J48A 2Y6TE 5FUCE 1RERA 1LK3H 2X1QA 3D85A 5CBAA 4PI0A 2XN9A 3D4GA 1WQVT 4Q9RL 4UNUA 4XRCA 4MQXC 3Q8FA 5T1KB 3KNBB 4O4YH 2JKTM 1TU2B 1QW8A 3ALXA 1IJ9A 2VKWA 4PY8I 3L95B 4L8CB 5LUMA 1Q9LB 3U0TB 3OTTA 1KXQA 2DW5A 1MCKA 4MB1A 1T7XA 3HAEA 5LHDA 3FCUB 4XPAH 2OP4L 3IGAB 2E4FA 3B1TA 2C3HA 3FSZA 3BCDA 4GW4B 1KFGA 3G9AB 5EN3A 3DOSB 4F7EA 2Y25A 1IQWL 4ZG1A 2E74C 4Y5XC 3C2AH 4HWBH 4PRIE 3T4AA 2XC8A 4HF5L 5LQBH 4N4YB 4WO0A 4ZW8A 1E5CA 3EGSA 4HWZA 3TN0A 4DN3L 1FHGA 4QHMA 3QZOA 3SZ6A 4P5TC 2IOIA 2DWXA 3QG6A 3BGFC 2AHIA 1DEEA 3IJ9A 2H0EA 3QCVH 1OW0C 3MXWH 4K8RH 4X7TA 1SQ2N 1INDL 5B7FA 1IB5A 5D7JB 5CEYB 5ITFB 2ED6A 2ADGB 3T04D 2G5UA 1CFVH 4IRSD 1J1OH 3HNVH 1MFEL 3LB6C 3P3SA 3LKSB 4FQCL 2DMBA 5T1KA 5T5FH 3KNBA 1QHPA 1TU2A 2Q1EA 1CF8L 3T5WA 4D94A 2PKDA 1JXKA 4NIKB 2YPLE 3L95A 4L8CA 1L7TL 4Y2DC 1Q9LA 1YEFH 2X1WL 3DTUB 3HN3A 1YJDL 1E7UA 3PYCA 4K15A 3U0TA 1I7UB 2B0SL 4MRBA 5T33L 4JLRB 4JRYE 4OCYL 1PU0A 1L9TA 1R3JB 4QWWD 4Z95H 1ULVA 3IGAA 4HKJB 2A0LC 4GW4A 5DXWA 4EI5C 3GSQB 3RZCD 1YEGL 3UADA 1MJUH 3DOSA 3GB7B 4F58H 1Y18B 5LBVA 3L1FA 1SM3H 1R33A 4FI8A 5FEBA 4UZSA 2YPVA 3AQXA 3IDYB 3MACL 5EBWB 1IVTA 2WINB 3A5VA 5C0BE 3X17A 3IJSB 2IIJA 3KLKA 2IAMA 1J9CT 5EIVA 2FNWA 3T3PB 3D0VB 4JL2A 4MX7B 4D9LH 1RZQA 3AWGA 5D7JA 1CLOL 4HWEL 2G9KA 5CEYA 5ITFA 1ED3B 2ADGA 1HHJB 3QDAA 4K55A 1E9PB 2R69A 3H56A 3IE9A 5FM4A 5C09B 2HRPH 1U2YA 3LKSA 5AVWB 4BH8A 1HKLL 2X2JA 4LIQE 3L16A 4J3OC 4M1GL 4N1CA 3D87B 1C1EL 3QHFH 3AZUA 1F0LA 2EEAA 4KTEL 5FYJU 3T8MA 1QPPA 1I7UA 4ANWA 4HV8B 4LOVA 2D0HA 4J28A 1R3JA 2IDCA 5CFHA 3QP3A 5LJYH 4FNRA 4HKJA 1FQ9C 4J6RL 4N20A 4YX2H 2EDOA 3GSQA 1KZYA 3S36H 2D03L 3GB7A 3QJQB 1Y18A 1E3XA 1DZBA 1EO7A 1TFPA 4P4KB 4R90H 4H20H 3ETBF 1O5PA 5EBWA 1WA2X 2WINA 3IJSA 1GGBH 1JYWA 3FONB 3M1CA 3QQ4B 4RA3A 1FORL 4B9GA 1GSKA 2DEWX 3K2UL 4JVPA 3G5VB 2F9BT 4PJGE 2HVKB 3ZZQA 1KGUA 3D0VA 3L5XL 4MX7A 5JIDA 2HRGA 3T9WA 2HH0L 1ED3A 3CV5A 3HS9A 5FYKL 1HHJA 3KLQA 1E9PA 4JFWA 2P5PA 3AT8A 4U33A 2V6HA 4X6CB 5C09A 6TAAA 3BQUB 3UJJL 5I30L 1XVSA 4BSWB 3PJSB 2Q3ZA 1XH2A 4FQPA 4U6XB 3SGDH 3DXAB 3R1GL 3I02B 3EFDL 4WWNA 2Y5QA 4X80L 2D0GA 1IFHL 1ZVHA 1C5BL 1Q9KB 4HV8A 2VQUA 4K5OA 4ECNA 1EHNA 5JLZA 1AIFB 1XT5A 3U0PB 3A4FA 3RVXC 2EJ1A 1OOWA 3UBGA 3RL2B 4UZGA 2C8NA 2X4RB 2MTAA 3F85A 3VGAC 3QFDB 2J12B 5I5JA 3TL5A 3B9AA 1VZIA 1DBBL 3CSFA 4FG6C 4P4KA 4WTQA 3GBEA 1Z5LB 2CALA 3HMWH 1E6JL 1CE1L 3FONA 4Y9BA 1G9MH 1HIMH 3QQ4A 5ACMA 3FU8A 4TNVK 1DBAL 2PMZA 3ARZA 2WB1A 3G5VA 2ZCHL 3O6KL 4PV9B 1KIQB 2HVKA 1YY8B 3WIIH 4X6DE 3WXWH 2CZNA 3B2MA 5JDSB 2CR3A 3TBVB 1EJ8A 3QYCA 2EAEA 1E5AA 4UINL 2P28B 2EP6A 4HIHB 4NM4L 5K59E 4L5FH 2XN9E 1ZHLB 5L4IA 3BDYH 3CN2A 4X6CA 3BQUA 5LAXB 4OI8A 4XNXL 4ENED 3GFUA 2ADJB 4G7SB 2XG4B 5KSAB 3RY5A 1OANA 4BSWA 5J3HD 4U6XA 3E9TA 1YNKH 1YEIL 3DXAA 3I02A 1UJ3C 1N7ML 2NR6C 1KXQE 1Q9KA 3HG1D 1Y07A 1AIFA 1ZD6A 1ZLDA 3U0PA 1TEGA 3MOAH 2HMIC 2VB5A 3ARRA 1OAUL 3RL2A 4HK3J 5JMOC 1XZ0B 2DTML 5B4MC 2X4RA 2VLJE 3K6DA 3TIEB 1TTUA 4XP9H 2DI9A 3QFDA 1OSEA 5DJ6B 1TZ8A 1U95B 4G9FB 1J0JA 1X44A 1DVSA 43CAB 4M5YH 5IMLB 1Z5LA 3NPSB 4I9WE 1T1ZB 4R7XA 1IJNA 1FYHB 3CFUA 3X14B 1T7ZA 3HN8A 2V3EA 1H3WM 4PV9A 3D3VE 2J6WA 1KIQA 4CKVX 1ACZA 1BVKB 1YY8A 4KU1A 4MBOA 3L8QA 5JDSA 3QPXH 3BXNB 3TBVA 1HWWA 3RY6A 5T3ZL 4H25B 1GY1A 4MXQD 2IANB 2BX5A 4N87A 4HIHA 2HLAB 1H3PH 3ZKMD 1ZHLA 3MHZA 5HVHC 2MKLC 3OB0H 5LAXA 1DQQB 1E4WH 2ADJA 5KSAA 2WHVA 4LPCA 3C8HA 2XUWA 3FXIC 1L0XA 3Q9PA 4HAFA 5T1LB 5I19H 5IV2A 2EO9A 5BV7C 4E9RA 1AMYA 3HI1B 1SEBB 4P59L 2FLMA 1SLXA 3RA7H 1PD0A 1V8HA 1BREA 2N1KA 4YWGL 4OM1H 5SV4A 4P5TD 1XZ0A 1QSFA 1ESOA 3TIEA 1TJIL 2CIKB 3KLAB 3U36B 5DJ6A 3UJTH 3CE1A 1U95A 5GRZA 3NZ8B 3OV6A 4MD4B 1KB5L 5IMLA 3K1KC 3VX1A 1D6VH 4N2DA 1DO6A 1T1ZA 3V0IA 4AG4H 5FO8B 2YD3A 3X14A 2OXGB 3LB6D 1X5ZA 5IF0B 4WWPA 4PJBB 1K5WA 2YMXL 5KVGH 3E6FB 1BVKA 3K0YA 4J23A 4JE0A 4LSUL 4MKMA 3VD5A 3BXNA 3QXTA 2P3YA 4MASA 1URIA 4H25A 2IANA 1GA2A 4JY4B 1M7DB 4NLAA 3ULUC 5JHDD 4QXGH 2R7EB 1GYCA 2EDBA 1FC1A 1DQQA 5EO0B 2DQTH 2A0LD 2QGDA 4KZCA 4H4NA 2PLTA 1MLBB 4N9OB 3V9CA 3ARDC 1FP5A 4N3TA 1KSRA 5T1LA 1BP3B 5G2NA 5I1IL 5ID0B 1MOEA 3HI1A 1EGJA 1SEBA 4JK0D 5IJKA 1WC7B 1U3HC 2YGVA 4P8QA 5D1QC 4Y2LA 2CIKA 3BUPA 3KLAA 3U36A 2UZXB 3D51A 3NZ8A 1FGNH 1E8WA 2YOCA 1HE7A 3BAEH 4MD4A 2EVFA 3LN9A 3FSWA 2BP5M 1EWHA 3SDDB 4DPRA 3HPLB 3RAJL 1VKXB 1G6RL 3HZYB 2V5SA 3UTPE 2OXGA 3MRGB 5IF0A 4PJBA 4FYRA 2VMJA 4JM0A 2R15A 4FMVA 3E6FA 1YLBB 3T3PE 3HE7C 3MCYA 4IBSA 2E9WA 2X5PA 4J3OD 2YBGA 4JX0A 4KY2A 4L1BA 2HRLA 2JJTA 5E8EB 2C9VA 3CK0L 2WGXA 4LPVA 3I74A 4ZW6A 5HHPB 4JY4A 1M7DA 1J8KA 3KYOB 1DYZA 5F44A 2AQPA 2R7EA 1WBYB 3UZQB 5C09E 3CVBA 4I7ZC 4PLNC 1BA9A 3GPSA 2WXPA 1UOVA 4YDKL 5EO0A 3QNXB 4Z7OF 3CZSA 1J5HA 1JZ7A 3W37A 4GUQA 1WA1X 4AQ8C 1MLBA 4PB0L 4ELMF 3IRPX 1VENA 2NUPB 2VC2L 4QAWA 5ID0A 1TT6A 4H2CA 3WTSA 2JJSA 1WC7A 1URLA 5JIKA 5CZVL 1RVFH 4Z7IA 2WBXA 1SOQA 2X10A 1I9IH 2UZXA 1E28B 2WQSA 2YC1B 4XPBL 3NCJL 4CU6A 5C0NC 1XEUA 5HJBA 2Q6WB 3DHPA 3HPLA 1FZJB 5EDXA 1VKXA 5CIPB 3HZYA 1FNLA 3V6ZB 1RH8A 1TJHL 3MRGA 5JW5B 4XP1L 4X8GA 1GCYA 4DEWA 2WLNA 4MNQD 5GRVK 4MS6A 5E8EA 1ZEAH 5GRUH 5HHPA 4FLQA 3LS4H 2OMTB 3KYOA 3L3KB 2ZYHA 5HGDB 3CQFA 3UZQA 1WBYA 5B1CA 1VZGA 4HFUH 4X6CE 5ENWA 3O2DA 4DPBX 3RVXD 2X28A 2GEEA 1LDPH 3FO9B 1OARL 5J1TC 1Z7JA 3LEYL 2DQGH 4JO4L 2X4NB 3DXAE 2YOAA 2EDLA 3PAYA 4NXSA 1WFIA 1A0QL 2UVFA 4FG6D 3E2HB 2NXZC 4D9RE 1X9QA 2O6EA 2WTRB 2OR7A 1PEZA 4DGIH 3DRTB 1JHLL 4QXUH 1IGML 1SHXA 3HC3H 1CLZH 1E28A 3HJ0A 4GNKB 2YC1A 3OHMB 1XGPB 5GRXG 1BOGA 3AUWB 3EJQA 4XXDB 3CLWA 3OPUA 3GSNH 2Q6WA 2EACA 2NY0C 3K6SB 1FZJA 1EDQA 4MVBC 4DFHA 5CIPA 3V6ZA 1SMAA 5HYJB 1QZNA 2J57A 4OIIH 1I8MB 3VSUA 5JW5A 3BAKA 1F41A 2AW2A 5TQ0H 4YIQB 3FCSB 1G7IB 3VG9B 1LDSA 4W6YB 4NZUL 1OHZA 4YHML 1VFBB 2NR6D 2OMTA 3L3KA 5HGDA 3SYOA 1MDAA 3WD5H 4HJJL 1O6TA 1IT9L 2HMID 4AVJA 4HIXH 1I53A 4O02B 1JIBA 4TPRH 4GP8B 1CD0A 5BW7C 4HWBA 2NNXA 5B4MD 2AEIT 1MWOA 2ITCA 2OQJB 2X4NA 3SDXF 2BS71 3GS0A 2DIAA 4AJVA 2HKHH 3P40A 1DTUA 2C3VB 4LQFH 2AAVA 4MQSB 3A4DA 1PKQB 4TF4A 3ZYOA 1A6VL 1IM3D 2VO8A 2WTRA 1LM8V 1OE1A 3ETBJ 5KUKA 3G5YB 3P1VA 2PNDA 1HEZB 4HS3B 3WG7B 3VQ1C 3VFRB 3DRTA 3DBSA 4WY7L 2L0DA 4ZW3A 1A3RH 2B8OT 5KSVA 4ZOCA 1XGPA 3UDWC 1QWNA 4BGLA 4G9FE 1EHLL 4ZTPL 4XXDA 4UM9B 5INCB 1UWXK 3K6SA 5HYJA 1NKOA 2YD0A 2NT0A 3P11H 1CQKA 1I8MA 3U0WH 3SJVD 4N3UA 2AXFB 4YIQA 3D09A 3OB8A 3FCSA 3P0GB 3MV9B 4OJFL 1G7IA 2AJXH 3HMXH 3HZ3A 4M7LH 5FW6A 3K91A 3QDJD 1VFBA 4DGWC 1NC2D 2WP3O 4TTDC 3AMLA 3ZR5A 3CXHJ 1FI8C 1WP6A 2UZPA 2ZXEB 3HG5A 4O02A 4PB9L 1N6VA 4WEUD 3GHBL 4Y16C 4CVXB 1RK0B 1CDYA 3QUGA 4LCIL 3TNMB 4NRXB 2LU5A 1IC5H 1P6AB 2OQJA 4AQ1C 4MHHI 3JWDH 1URZA 1XSIA 3H2PA 2C3VA 3CN0A 3GXFA 4NGHL 4QYAA 1WDAA 1PKQA 1KYFA 1MLCB 3G5YA 3HFML 3H9ZA 1HEZA 4HS3A 1MAKA 4P04A 5IQ9B 3VFRA 4FERA 4G7YL 5CILH 1H15B 3NCEB 4QI3A 3DSFL 1Y6MR 4FXKC 2YMOA 2RAMA 2W88A 4ZSOB 3BWSA 3B2VH 1ODUA 2FATL 1LK2B 3HIZA 4UM9A 5INCA 3ULUD 4XP5L 4PWJA 4YUEL 2BVTA 1ASQA 5T1JA 3BIAX 3RVWD 3IDUA 1OSPH 2R83A 2YRZA 2VDKH 2X9XA 3TBTB 2AXFA 3HC4L 1NCDL 3MV9A 3MLYL 4GBXB 2J55A 3SGDI 1DBKH 2YUWA 2GIYA 5CJ8A 3UEZA 5L6YL 3WTYA 3BWUC 4W9DC 1EZLA 5J6SA 4N5UA 5KBLA 3LS5L 5F7UA 1HCYA 1W0VB 4CVXA 4F2MB 4I4WB 5D2NB 2WZAA 1U3HD 1RK0A 1SN0A 5E1GA 5L4MA 3GLDA 1NAMH 5CJOH 1Q9WB 1YYML 3UGXA 3TNMA 1UEYA 4NRXA 5D1QD 2OYLA 4KKAC 3DIFB 2XWDA 2HSIA 5E1AA 1N59B 3RPKA 2WLJA 5HHMD 1A21A 1F8TH 1K5NA 1M3JA 3QJUB 1G1YA 5GGTL 1MLCA 4FNUA 4DKFL 4YHLL 3D06A 5IQ9A 3AITA 5HP5A 1H15A 4N8PA 3HE7D 2Y5EA 8FABB 4FG2A 1REIA 1UACH 4PMFA 3AGWA 1ZLUH 4ZSOA 3QNYB 4OT1L 2V8LA 1LK2A 1SGKA 3ESOA 3FT0A 2PXYB 3RG1C 1SBSH 3EIFA 4YSRA 2J6EL 1J9SA 1WAPA 4KZ0A 5EZIH 3TBTA 1TO4A 1RIVL 1N9PA 2DLFL 4GBXA 1TIUA 4U1SB 3DX3A 4PIRF 1AE6L 1RQ5A 2B77A 4RRPG 1MREH 2ZXWB 1FVCB 1LWJA 3CH8A 3JWNC 1YO4A 4HQQH 3T65B 4L0YA 4JO2H 2DQEH 5DD5H 1GOHA 1W0VA 4JDZB 5LBSH 3HS0C 3P4NB 5DWUL 4I4WA 5D2NA 4F2MA 4C56D 2EIEA 1LHZA 5E2JA 1Q9WA 4Y4FC 2EICA 4LVOC 3VYOA 4Z78A 3DIFA 2GJ6D 1BGXH 3FU6A 5GJTH 1N59A 1JPSH 1T6WA 4FDWA 4QJ3B 4AYFB 4HOWA 1R3IL 3CLEL 1JXJA 2BERA 1ZXQA 2DH3A 5CWSB 3SN6N 15C8H 5A6MA 5E99H 4M6MH 2NSMA 2MPVA 3CZFB 1E9QB 3FQRB 3MU3A 1IAOB 1CT8B 1A4BA 2ESVD 8FABA 4GS7C 2CSPA 5CR1A 3QNYA 2OULB 1A6PA 3QISA 1BQRA 2PXYA 4YXHH 2H0JA 2XTJB 5AZEL 2VN3A 4RH4A 4DTGH 2CJUL 4JO3L 3MRDB 3L45A 4U1SA 1OGPA 2GABA 3QUXA 4IK6A 2DDQL 1WV7T 4P9HC 1FVCA 4GSDL 1IC0A 2NXZD 3ZTJH 4OD1L 3F7PC 3MRJB 1AXSB 4IIQC 3T65A 2NNRA 4V1DD 3RWIB 3ABGA 4JDZA 4LOEA 1BAFH 3P4NA 3MCKB 1EAPA 2EDWA 4A38A 5BUGA 4U1JB 5C07D 1OCRB 3VRLE 3M45A 4FFWC 4APQB 3MZGB 4K3JL 3TU6A 1OHQA 3RHWK 1S7WB 1JAEA 4AYFA 1MFCH 4ZTOH 3V8OA 5CWSA 2ZZUT 2FBOJ 5GGRY 4K9EH 3CZFA 5HPMB 1E9QA 1MCEA 1B3IA 2YJQA 3FQRA 1CT8A 1IAOA 5D1XB 4H8WC 3QW9A 1OAKH 3DOHA 4XBGB 3UJIH 4F5CA 3ZT6A 1BIIB 4FTDA 5I1HL 2GG1A 4UYQA 2IAAC 4L9DA 3BCFA 5HYJE 3D39D 4S1QH 2DV6A 3FN3A 2WZPA 3MRPB 4PJEB 1MCPL 3G7TA 2KERA 1F4HA 4P46C 4AYGA 4HHGA 2IOMA 4OCRL 5HHXL 1OEZW 1IBFA 1ZLWH 2VRQA 3ISRA 3KH4A 3CDFA 4LVNB 3T0EB 1INEL 2ZWKA 5ECJE 3MRJA 1AXSA 4R97C 2Z35B 4U1GB 4HUUB 3RWIA 5DMIH 2CO6B 5JQIB 3MCKA 5D7KD 4NKMB 3ARTA 4NCC1 3QO1B 4ODSH 4DQAA 4U1JA 4APQA 2R23B 2WAQA 3CHQA 1MCDA 4HKXB 3ZQWA 3MV11 1NMAL 2DQ6A 3GLEA 1HDMB 3F6IA 1NGZB 1S7WA 2ARJB 4KTDH 1CVSC 4OFQA 4RX4D 1PKQE 2ZXAA 4J39A 2Q86B 4GXVH 3SE8L 5L88H 5HPMA 2YO3A 4GKSB 1PJ9A 2E5EA 2Y72A 3U4BH 4JZJC 5D1XA 3VXPB 2DB8A 4NAQA 3IN0A 1OM3H 2XRAH 3C6LC 3QPQC 4LBAA 2H3XC 4XPFH 1BIIA 2JI3A 4JM2B 4KKBD 3BPNB 3HRPA 3UAJA 4TTDD 5JW4R 1JF1A 2YXWA 5JIMA 3MRPA 1KY6A 1P1VA 4PJEA 5EPMB 3S48A 4NUMA 3VW3H 2V33A 4ELDA 1T22B 1D5RA 3JZYA 1FNEB 2QQNL 4AV0A 5DVLA 4QRBA 3BP7B 2PO6C 4AKOA 3T0EA 1G0XA 3LVTA 1BFVL 1VADB 4JKPH 5SWZE 3VFSB 3GEWB 2Z35A 5DFTA 4HUUA 4AM0B 2CO6A 1ZVSB 2XIDA 3ARVA 4FHJA 3NGBB 5HJDA 3SGEI 3VE0B 4MQ7B 4NKMA 4AQOA 2D7PA 3QO1A 1A7QH 4IDJL 3VSTA 1UADC 2ALAA 2R23A 1BZ9B 4HKXA 1XHHA 3KWTA 1HDMA 3O8XB 1UHVA 2ARJA 4IOSD 2FECI 4ATWA 2ZONA 2X09A 4ZOEA 5E4AA 4HG4J 3CVHB 4HYTB 4JKWA 3V0GA 3W56A 3WIAA 2V4LA 2PWDA 4GKSA 5DI8B 2CO4A 3VXPA 1UM6L 4GAFB 4NI6A 3Q44A 4AEFA 4PCYA 3CVCA 4HD9A 4QRRB 2LLLA 4ZSOE 4JM2A 4F57L 3SBRA 4MCNA 1GGUA 4FEMA 1NBVH 1N64L 3RBSA 5EPMA 3WFDH 1PPIA 3DIVA 2VZ1A 3HE6C 4TS6A 1T22A 3ZKXC 4F8TA 1FNEA 1A6WH 4KKAD 4LLQB 2CO3A 2FD6H 3BP7A 4NZDA 5KANG 2BHUA 3LNFA 1VADA 4HULB 1DL7H 2ZX7A 1AXTH 3VFSA 4AM0A 4MJIB 1IIIA 3EHBB 1ZVSA 3VE0A 4F2ME 4ALAH 4MQ7A 5D2NE 1TG8A 3VO0A 1P5UB 3IGLA 2HFFB 5T1MB 1BZ9A 5CLWA 4KZEL 2VMEA 3GSNB 3HTLX 5F7EL 4B9CA 1ZLSH 5I75B 4NLHA 1V7NH 3T71A 3RE0A 4PGEA 3O8XA 4P3DA 3DLQR 4X9IA 4YE4L 5JDJA 1JGUL 4HT1H 3UC0H 2PR4H 3CVHA 2G30A 2WXJA 4LCCB 1WT5A 3GPEA 5D7IF 2WWNA 4JPKL 1JL8A 1G7LB 1VEPA 2WXLA 2WP3T 4PTTB 2WLLB 5DI8A 3ZE0B 3VGGA 2CCVA 4Q58C 2XPZA 4L5FE 3FUEA 3SGKA 2YAFA 3ME0B 1ZA3A 4QRRA 3E8VA 5E56A 2A77H 3TX4A 5KEZA 3MQIA 5CGTA 4OTXL 1GC1C 4P07A 2MQGA 2AQSA 3TP4A 3AJ7A 4LNRB 4RMVA 3TJPA 5HYFA 3T0BA 3DECA 5DHEA 3GTVA 3K6FA 4Y4FD 3ZRFC 5CKAA 4LLQA 3TBCA 5ACLA 2VDNH 4R84A 5CLZA 3UPAA 4G11A 4Z1PA 4OLUL 3ZHDA 5BPPA 5JXAH 4X6DF 4U7SA 1HI6B 4B9KC 1XF1A 3EADA 4HPHA 3BI9X 1GH7A 1RKRA 1EAQA 1P5UA 3R06B 2D8KA 2HFFA 5A43C 5T1MA 1FFPB 3IMVA 3GSNA 3SPCA 4M1CC 1G9NC 1FJ1B 2J2ZB 3RX7A 1J1XL 2OSYA 5TFSH 4ABUA 3BN9C 4PSPA 4AE1A 4NNPH 4XX5A 1Z9SB 4LCCA 5DHDA 2VN7A 1N5YH 4TMPA 3TV8A 1G7LA 5KYXB 3KPOB 4DQOH 4PTTA 2WLLA 5TDOB 1NBCA 3S5LG 4IKJA 5KVDE 5FAAA 4M00A 2BY3A 1F11B 3ME0A 4F5CE 4FLOA 2ENQA 1YEJL 2XN0A 4KPHL 5AW6B 3A21A 1I85C 3QJFB 5IQOA 1F6FB 2JI1A 2J71A 3ZPDA 3F6LA 4LNRA 4HVBA 3W3BA 4U1NB 1A7NH 2CRZA 4OCWH 1KJ2H 3AMKA 4FFWD 2DQUH 4AGOA 1RI8A 2ICWI 3WDHA 3JT0A 4O58L 3W9EB 3NABH 4Q97A 4FG4A 1G0YR 2Y06L 3OPZL 5F3HB 4ZFGH 1HI6A 3QHZH 4B9JA 4JGUA 3TEUA 3R06A 3UX9B 4BRVA 4ZFZB 1OOAA 2FQEA 1FFPA 3MBEC 3CN1A 1KN4H 2ODHA 4LCYB 3BEVB 4YSOA 3UIYA 1FJ1A 2J2ZA 5K9OB 1OB1B 3AT9A 3FTGB 4AV4A 4UT6A 3FFCB 3LV3B 5KVGE 1Z9SA 2QVFB 4AL8H 4L4TB 1CICD 3BUIA 2NY2C 3HZVB 3HMXA 3EW3B 5KYXA 3KPOA 5ID1B 2H6PB 5TDOA 3RB7A 5D1XE 2PPCA 1TQSA 1WF5A 4GQ9H 4NN7B 4P46D 1EMTH 1V3JA 2NY5L 1AANA 4XO9A 2J4WH 4UF7C 4QLWA 1P1ZB 3QJFA 1AKPA 4YHZH 4RMWA 3VXUB 4ODVH 3EBGA 3ZT7A 2XBZA 2BM3A 3INUL 4PJEE 4UIMB 4DHLA 4U1NA 3INOA 5ADPL 4LRIA 3NCWA 1PY9A 2XQYG 5JW3L 2OYPA 4RFNC 2I60H 2RBLA 5IFHH 2IMMA 2OXHA 3W9EA 4PGBB 4ZMYA 5CINH 4QIRA 1QOKA 4G82A 1TZAA 2VXQL 3MLSL 5DGRA 1F58H 3V5DB 2OJEB 1YYLL 1UH4A 5F3HA 5AFAA 5C08A 4F91B 3QZWG 5L2JB 1CD1B 3QIWB 2Q10A 1BYPA 4BRJA 1E2VA 4ZFZA 4FFYL 4XNZB 1EZSA 3R7QA 4DO5A 2GBVA 3H3KA 3BEVA 4LCYA 2P80D 4X5WB 5KAQF 5K9OA 3V0FA 3QPQD 4NQVB 1C1EH 1OB1A 1Z6JT 3FTGA 5EU4B 3FFCA 3CSPA 4E42B 2Q3AA 3GKWH 3LH8A 3LV3A 4URKA 1P9MC 4L4TA 3B56A 2R59A 3HZVA 4HUMB 5AW9B 1NFDB 1CGTA 4P06A 5GRYA 5ID1A 2H6PA 4FHBD 4Y4KC 3A6BL 2HA1A 4HX1B 5I1GL 2AF2A 3RBGA 3E80A 5DD3L 1NSNH 3WFBH 1MG3C 4S1SH 3CFKB 4P2CG 1P1ZA 3VXUA 5I1JH 4DZBB 5GS0L 2V2TB 1YNLH 4L4VD 1E9OB 4UDTB 4M8UA 5LCVL 2TRYA 4HXBL 4PRHD 1JDDA 4NCDA 3WN5B 5IT2H 2O5YH 3QDGD 1NQBA 5E70A 4PGBA 1LWHA 1ROWA 5JPMC 3V5DA 3CIAA 3T3PF 2OJEA 3WFEH 5L2JA 3DVGA 4N8CL 1CD1A 5FFGA 3MLWL 3QIWA 5JHAA 3V52L 2VN4A 3Q3GB 5FO9B 4U4IA 1EFXB 5DDHB 5K93A 3MV7B 3RZWA 4XCFH 5GSRB 1G9EA 4X5WA 3MJ6A 1E42A 3R1GH 4NQVA 5EU4A 4YSEA 2B59B 3FFOA 1JPFB 4E42A 3SY6A 3B8SA 4YSTA 1IL1B 1NFDA 4R0LB 1T03L 4F1ZA 2AJYH 4MLIA 2D3NA 3JV5A 4HX1A 4G42B 3HHSB 4F8PA 2LV4A 4QRRE 1T6VN 2XLLA 4YDIH 3OJDB 4FI7A 1QI5A 4LLDB 4P9MH 3CFKA 4QHPA 4WTZG 4HK0B 3M46A 1IC4H 4DZBA 1E6JH 2V2TA 4UDTA 1TQCC 1E9OA 3DWTA 1E5UI 1IAMA 5F0LB 1ETJA 5I17B 2ZE0A 4OLYL 3WN5A 4RA0C 5DLLA 2XIBA 1L5GB 2ENJA 3D69B 3MLRH 3RWGB 4P5SA 5I6NA 2H4EA 4MJIE 5D7LD 5DRXB 3REWB 2YWYA 5JHBA 5DUBB