1KDKA

The structure of the n-terminal lg domain of shbg in crystals soaked with edta
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
177
structure length
177
Chain Sequence
DPPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKRHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sex Hormone-Binding Globulin
publication title Resolution of a disordered region at the entrance of the human sex hormone-binding globulin steroid-binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 31
structure length 177
sequence length 177
ec nomenclature
pdb deposition date 2001-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1kdkA00
4FPGA 2W08A 5JDBA 1QOSA 1WLCA 1CN1A 1CESA 2FHRA 2WSUA 4XBQA 3T1MA 2OW4A 3SLIA 2ERFA 1DLLA 1BXHA 2R49A 1C1FA 4XJ8A 3RG0A 3WDYA 5BYNA 4BPZA 3OJBA 2EXJA 1YYNA 2HYKA 1HQWA 3HMYA 2AH2A 4Y22A 2PHUA 3FLPA 1XQNA 3JU9A 3RMYA 5HCBA 4L8QA 3B9CA 2P3JA 4YGEA 4AVTA 1SBEA 2YMZA 3ZYRA 1SCRA 2A6VA 1A78A 1QDOA 4FPJA 3NV1A 3CNAA 4LBQD 5EXOA 1WD4A 2CWSA 3U4XA 5GM0A 3O12A 1URXA 2YZ4A 3SITA 1JHNA 3WUCA 4IQPA 1MS8A 1LU2A 3AZYA 3FBYA 1H9WA 4K1ZA 2OVUA 5E89A 1QOTA 1G86A 1QDCA 3RSJA 3QLQA 2ZGPA 1WLDA 3IMNA 4FPYA 1SCSA 1OKQA 4ITCA 4RA0A 3ZSMA 2ZA9A 3AP4A 4FQZA 2CNAA 1IOAA 1EPWA 1JW6A 3OBRA 1AF9A 2PHTA 2YXSA 4KBBA 1IS6A 1VIWB 3AP9A 1QOOA 5E8AA 2EXIA 1DHKB 1PZ7A 3MW3A 4LBMA 1DQ2A 1DQ0A 1WBFA 2EAKA 2JDZA 4XDQA 4DRRA 3OPZA 1GBGA 2A6XA 1FNYA 2ZMKA 4YG0A 1V6NA 4BMBA 2W52A 4YG3A 4XJWA 1MS5A 2DU0A 3PMEA 3SH3A 4WVWA 1V00A 1W6MB 5F9TA 1QGLA 4F83A 1DZQA 2R1DA 3I4IA 5H9QA 3W59A 3ZXLA 1KRIA 3V65A 3W58A 5KXEA 5KXDA 1ENQA 4U2AA 2A6WA 1O4YA 1V6MA 1NLSA 3WG3A 2R16A 4I30A 5EYYA 1V6JA 1FNZA 2R0HA 1O4ZA 4XYXA 5DUUA 2C9AA 1C1LA 5CNAA 1MVEA 1G7YA 1SLAA 2P2KA 1CJPA 2P3IA 2ZHKA 1KDKA 3WOGA 4FQ4A 4M3CA 4PF5A 5T52A 4XXAA 1WD3A 5HCFA 4XBNA 4YM0A 2JECA 3IM0A 4LBJA 4ZXKA 2NMNA 3NV4A 2A70A 2AR6A 4BOWA 4XTMA 2GNMA 4AVSA 4FPFA 1PZ9A 3AK0A 1RIRA 2EXHA 1JXNA 1SBFA 4JRAA 4R9CA 2A7AA 1W6NB 2E53A 4YG6A 3TAYA 5JVVA 2ZGNA 2ZHNA 1BJQA 1LOGA 2P3KA 2EF6A 2ZACA 4ASMB 3AZVA 4FOWA 4D69A 4H55A 2PHRA 4FOYA 1CPNA 4W65A 2VXRA 3RMXA 3WUDA 4WVVA 4YZ1A 1YXWA 1GZ9A 4XHBA 2GDFA 2P37A 1UAIA 1YO8A 2LALA 1ENRA 5EYXA 4R9AA 2GMMA 1W6NA 4GKXA 2Z42A 1UZZA 2ZGLA 3AYEA 2VY0A 4YFZA 4Q27A 1Y7BA 1LHVA 4NOTA 3POSA 2ZAAA 1J1TA 3N7LA 5DUVA 1DQ1A 5GJ6A 1LOFA 4GKYA 4ZKTB 2W39A 2AGSA 4M3CE 4Z8BA 3NV2A 4UW6A 1BYHA 2ARXA 2SLIA 2ZMLA 1JOJA 3ZSJA 3AZWA 3PJQA 5H9RA 4XMIA 2JE7A 2A71A 3ASIA 2H0BA 4YGBA 1UL9A 3ZXKA 2ZGTA 3PVEA 5H9SA 4LBQB 1LOFC 3ZXFA 3WNXA 1H30A 1MZ5A 4FP2A 5GZDA 3WLUA 1ZA4A 4XIOA 1V6IA 1DYKA 1UX6A 1V6KA 1MS0A 2EIGA 3AP5A 4XE9A 2UURA 3SH4A 1VAVA 2UWAA 2VW2A 3WHUA 1GZCA 1V6LA 5HCAA 1GNZA 1LJ7A 1MR5A 1Z78A 1LCLA 3DUIA 3OBTA 4JCKA 4P9XA 4AVVA 5IT6A 1F9KA 1ULCA 1F5FA 1QNYA 5EWSA 4XJZA 4Y1VA 3N7KA 4LBQA 2NZ9A 1ZM1A 4AGRA 1CVNA 1HQLA 1SLBA 1LHUA 1LENA 2DVDA 4ISRA 4Q8KA 4Y26A 1DIWA 1N47A 5CBLA 4CRQA 1KJRA 1GZWB 2AYHA 2WLQA 3V0BB 3WG2A 2D3SA 2UU8A 5LK5A 1DQ5A 1W0PA 4YZ2A 2LTNA 3D4KA 4FPKA 1UMZA 4YW5A 3INAA 2GMPA 2NMOA 3A4UA 3USUB 4XJAA 5IK4A 3ZXJA 2ENRA 2ZHLA 3UL2A 5F5QA 1JN2P 2DVGA 4GWNA 1FAYA 1MS3A 1YIFA 2TEPA 4Y20B 1GZWA 3V0BA 3DGTA 5IUQA 5CA6A 1UZYA 2OUJA 1YI7A 1WW7A 5IK5A 2WT1A 5JOYA 1S0FA 3GALA 2EXKA 2UWCA 1CQ9A 4SLIA 2CWMA 3ILFA 1AXYA 1CR7A 1X50A 3WDWA 1DYPA 4K21A 2BQPA 1LGNA 2GALA 4XOGA 2ZHMA 3USUA 3AP6A 1G9CA 3AZZA 1UKGA 2DTYA 2DUPA 2VUAA 4FPEA 1AX0A 3NWKA 3D5OA 1S0CA 5E88A 3WDUA 4XXPA 2XG3A 4Y20A 1LTEA 3A0KA 3M1HA 2YY1A 1BZWA 1SLIA 1ULDA 2A5ZA 3R4UA 4XBLA 4YW2A 1KQRA 1SLLA 3Q9OA 1Q8PA 5JLVA 1GICA 1C57A 1RINA 2DU1A 2GMEA 1LGBA 2V73A 3UK9A 4FPLA 3BIWE 5GALA 3ZVXA 3N35A 2WJSA 1WBLA 4K20A 5DG2A 1CONA 3C2UA 3ZSLA 4PQ9A 1HLCA 4Q8LA 4FPOB 3PVNA 5T5PA 3LCPA 1S0IA 2VW0A 1AXKA 3L2YA 1S0BA 1DQ6A 1Z0HA 3T2TA 2DUOA 2W68A 3RS6A 3VKMA 1KITA 1CIWA 2WKKA 1NXD1 1W6MA 3M3OA 1R1ZA 1H9PA 2XB6C 1DFQA 2ZGQA 4YLZA 3SNMA 3T1LA 2D43A 1W6QB 5KXBA 4HL0A 3MEPA 2D6LX 5FRAA 2A6ZA 1GNHA 1LU1A 2E6VA 2VU9A 2EALA 3OY8B 3A0NA 3R4SA 1YRZA 1S0EA 3N3HA 3LSDA 2JE9A 5DUWA 3FLRA 1HDKA 1WLWA 1Q8QA 2GNBA 2VH9A 2ZZJA 2CTVA 4FPHA 2ARBA 5T55A 5IK7A 1DBNA 2PHWA 5T5OA 2OUHA 2DUQA 1G8WA 3VKNA 3QCWA 1A8DA 1W6QA 1LOEA 5T5LA 5JOZA 1Q8OA 1F31A 2GNTA 3ENRA 4BLIA 3SH5A 1W6PB 3OY8A 2NP0A 1VLNA 2NN8A 4BM8A 4YW1A 2D6MA 4M01A 5IK8A 4YM3A 4PBOA 4DS0A 5JMCA 3O0VA 5FREA 4R9BA 3RQ0A 4YW3A 4AGGA 3AP7A 4Q26A 4XMAA 4P9WA 1S0GA 2DYCA 3AYAA 3BOPA 1I1EA 3BTAA 1MS4A 4YFWA 1ULEA 1W6OB 2VW1A 1ULFA 1OFSA 2G4IA 1MZ6A 1UPSA 3IPVB 1G9BA 1IKPA 1W6PA 2ZABA 1PZ8A 3VUOA 1IS4A 2AUYA 3B01A 4XZPA 4TYSA 1S0DA 1AX2A 4C1XA 1VAMA 4P9YA 1FATA 5CB7A 1ENSA 1VALA 2D3RA 3B00A 5T54A 1C4RA 1MVQA 2DVBA 5SV8A 4YW4A 4FP3A 5GLTA 1A3KA 1AX1A 5DZGA 1W6OA 1QF3A 4BMEA 1QMJA 1GKBA 1FV2A 3RRDA 1Q8SA 1Q8VA 3WVJA 2ZGOA 4LBLA 1N1VA 3ZXEA 1G9DA 4UW3A 3APBA 4DRVA 1DGLA 5GLVA 2DTWA 2ZGUA 1AZDA 3V64A 1LHWA 2CY6A 5GZGA 5JOWA 1S0JA 1JUIA 4AYUA 2GNDA 3GNEA 3H0OA 3JUUA 2NYYA 4R9DA 3POYA 2WSVA 4RL7A 2ZKNA 4U36A 4YGDA 1LOCA 4FOQA 5GLWA 1FX5A 3LSEA 4PCRA 2P34A 2D6KA 5DUXA 3AFKA 1N1YA 5CAZA 4M00A 1N3OA 2E7QA 3KM5A 2WT0A 4PBPA 1SLCA 1SFYA 2Q5TA 1SLTA 5T50A 4ATFA 3B69A 4HANA 4UW5A 4Y24A 1I3HA 3M3QA 1GV9A 1BKZA 2WQZC 4Q1PA 1LOBA 1HKDA 5DXDA 4ISQA 2B7YA 3AXDA 1Q56A 1BQPA 1MS1A 1D0HA 2D6NA 3WG4A 1LHOA 4P14A 3UJOA 5KXCA 3N7MA 4WV8A 2WT2A 4XJ9A 3VKFC 3ZSKA 2I2SA 2A75A 1G9AA 1UN1A 2E7TA 4AWDA 3ZPYA 1FYUA 2CL2A 2WNEA 5GZFA 1IKQA 1N1TA 3FLTA 3OGGA 4AGVA 1V6OA 1KDMA 4K1YA 1N3PA 1LEMA 3HN1A 1QNWA 4YZ3A 3WHTA 2A3WA 2ZGMA 2UWBA 1GSLA 2D44A 1LEDA 4DPNA 3POWA 3WCRA 2PELA 3I8TA 4GA9A 4Y1YA 4Q1RA 3NV3A 3O0XA 3MPPG 4M3CF 3AJZA 1LULA 2A3YA 4DQAA 5L73A 1QKQA 1SBDA 4XIKA 3N36A 3PVOA 3VV1A 4FVVA 4TZDA 4M3CB 3V0AB 1WCSA 4WZFA 4XHXA 1JBCA 1G9FA 1KJLA 3KQRA 3O0WA 5H9PA 3WCSA 4XJUA 4LBNA 1AJOA 4MYEA 2D7FA 2V5YA 3N7JA 3ATGA 1LOAA 3UJQA 3BODA 1CPMA 3WDXA 3WDTA 4DFSA 1LECA 5AVAA 2ZBJA 1OQ1A 4LBKA 1LODA 2DV9A 3V0AA 2YV8A 3O5SA 3TB0A 4OZXA 1AJKA 1B09A 5DZEA 3WV6A 2D6OX 4BLJA 4CTEA 2JJ6A 2R0FA 4GWMA 3IN9A 4Y1UA 2KM2A 5T5JA 2R1BA 4BQ1A 1AVBA 5GLUA 1GYKA 4XILA 2RHPA 1JYIA 3IKWA 4YM1A 3FUQA 3AX4A 5GZCA 3AZXA 1IS3A 1RITA 2CYFA 2DVAA 1WW4A 4XTPA 2ZGRA 1MACA 1ONAA 2D6PA 4NO4A 3VKOA 3ILRA 4YGCA 2DURA 4C1WA 2DWRA 3WZ1A 1WW6A 3AYCA 1GANA 3WG1A 2GN3A 3FUOA 1S1AA 4CZSA 1IS5A 3MW4A 1U0AA 2PHFA 1DQ4A 3B3QE 4GALA 1W0OA 5GLZA 1JYCA 4FPCA 4YM2A 3WDVA 4YZ5A 4GXLA 1MS9A 3AXEA 4Y1ZA 3M3CA 1ULGA 2NM1A 4Y1XA 2ZMNA 4ATEA 3SISA 4UW4A 2PHXA 4JC1A 3VKLA 2GN7A 2A3XA 1N3QA 4Q2FA 2AENA 3OYWB 1LESA 1APNA 3M3EA 2JD4A 4FOVA 1GLHA 1LHNA 1QU0A 1WW5A 2D3PA 3IPVA 1AXZA 1N1SA 2C5DA 2ES3A 3HR9A 3ZYPA 1SACA 5DZFA 2FMDA 1FV3A 5DG1A 2E51A 3FFZA 2DVFA 2JKBA 2SBAA 1WUVA 3AJYA 4LBOA 4Y22B 3AYDA 2ZGKA 3M2MA 2AREA 2A6YA 2ZGSA 1D2SA 4YZ4A 5GZEA 1LGCA 3R05A 3OYWA 5JOXA 3D6EA 3MW2A 2YROA 3ILNA 1TEIA
chains in the Genus database with same CATH superfamily
4FPGA 1U5YA 5JDBA 5JR2A 1HRI3 1CN1A 5KXBA 5LA0A 2XWJB 3H8UA 2R49A 1DLLA 1EUTA 2WN2A 2X09A 2E7AA 2ZX0A 1YQCA 3GJAA 3PVBB 4L11A 4KGGA 4XJ8A 5BYNA 2HYKA 1YYNA 3FN9A 5C71A 2YYOA 1HQWA 1W2OA 4Y22A 2XGXA 3FLPA 1BCXA 3BPZA 4YGEA 4XCAA 1A6CA 5C3QA 3K77A 4JVAA 4HK8A 3TNPB 3ZYRA 4LA3A 3P1IA 4K40A 2J1EA 1A78A 3ORJA 4FPJA 1SHWB 4LBQD 4MHUA 5A70A 3OB8A 5BNNC 5GM0A 2YZ4A 2XPJA 2YGMA 5C33A 2W3JA 2PYTA 1H9WA 3A22A 2OVUA 5J36A 2HWE2 4D6QA 1QOTA 1OXCA 2Y6KA 2WYSA 2RS31 2B46X 3H7JA 5K0UB 2IWGB 1DZRA 1OLRA 1SCSA 3PUAA 4ITCA 4RA0A 2ZA9A 5A3LA 3AP4A 4FQZA 4QX5A 1FOD1 1AL22 3CJIC 1IOAA 3N9NA 4JDOA 4CPBD 5LA1A 3I2KA 4QQPA 2FDHA 1UO9A 2PHTA 1RUD1 3HQRA 3DXUA 3PUSA 3LPGA 2KA3A 1IS6A 2WFF2 1VBE3 1VIWB 4DIQA 4LBMA 1FMD3 3CEWA 5J7MA 2GC1A 2K0GA 3OPZA 1K5JA 3FZ3A 1FNYA 4RS5A 4Y4YA 3H3UA 4BMBA 3EXUA 4Q4V2 4YG3A 3KMHA 1MS5A 1BK0A 1H2NA 4GQ7A 3PMEA 4J25A 2EVXA 3DF0A 1UPIA 1HIXA 5FZLA 1V00A 5FZ6A 2J1AA 4EZ4A 4AVCA 5H9QA 2JXAA 3W59A 3ZXLA 5KXEA 5LBFA 1NZCA 3GZUC 3TEXA 2G9ZA 4CU9A 4EN7B 1O4YA 3WG3A 4CDXB 1RUF2 1VMFA 1V6JA 2FQPA 5EYYA 1M06G 1VBC1 4W6WA 2C9AA 3PJYA 4NPRA 3T0DA 1CX4A 1MVEA 2Y8KA 3LIGA 1G7YA 1SLAA 2XVLA 1CJPA 2XBO3 1KDKA 1OC1A 1PM7A 4M3CA 4KWJA 4LUKA 3OGRA 4XXAA 4EJRA 4CXYA 4XBNA 2JECA 1COV1 5SV5A 3IM0A 1SDWA 4LBJA 5BNQA 4CA9A 1NE4A 1WCUA 3NV4A 4BOWA 4KMQA 2GNMA 4KGQA 2WS92 4FPFA 4CEWB 5CKNA 2UY8A 1O5UA 1SBFA 3HN3A 3DEMA 3KF3A 2ZGNA 2ZHNA 1O7FA 1ENXA 2VAUA 1RUNA 1AYN1 2WNUA 2ARCA 2ZACA 2ZKLA 3J7MA 4FOYA 5FLHA 5FYIA 3MIGA 4XUPA 4YZ1A 2PAMA 1PIV1 2CDPA 2MNGA 2GDFA 1UYZA 1UAIA 2VC9A 3CL1A 5JZGB 1JU3A 2WDBA 1ENRA 1E5HA 1UNBA 1QJU1 4XDPA 5EYXA 4IV3A 3ZDVA 5A6ZA 1W6NA 3DPRA 4BQ3A 2WR9A 1JZ5A 2VY0A 1R1A1 1Y7BA 2EA7A 2X8KA 1DGRN 3POSA 4NOTA 3HNYM 3VBRC 5A3OA 4HKWA 3I97A 3MUZ1 4ZKTB 5J37A 3GZEA 4YNIA 3W21A 2XHKA 3NV2A 1QH6A 2J1SA 1W05A 2ZMLA 1GUIA 2SLIA 1JOJA 1QXRA 2XONA 3AZWA 2VZPA 3BOWA 3PJQA 2VMGA 5FZHA 5H9RA 4XMIA 2JE7A 1UY4A 3ZXKA 3TEZA 2ZGTA 3PVEA 5E6HA 3K4DA 2R042 3ZXFA 4LNVA 3WNXA 4BHPA 2XR4A 3VZJA 2Z69A 5C8WA 4XIOA 2FDFA 1V6IA 1DYKA 1V6KA 3MUY1 1RUE2 4IESA 2LW8A 3URFA 2EIGA 1JI6A 1VAVA 1ZRFA 4LUMA 2P6HA 2PLV3 3CMGA 4N53C 3LA7A 2Y64A 4HT1T 1MQTC 3KVAA 4LHNA 3GHNA 4NHKA 4P9XA 5IT6A 3ACHA 1ZA7A 4PLNA 4Z2WA 1NY72 4LBQA 4QB6A 1HQLA 1SLBA 2YBPA 4IGOA 3S0MA 4ISRA 5I0SA 1DIWA 1N47A 2X5IC 3CU7A 3CJIB 5CBLA 4CDUC 1KJRA 3HT1A 2R071 4XQDA 1PK6A 3KWVA 4GH4A 1O5LA 5LK5A 4NIAA 4C90A 1ASJ2 5A3NA 3R6SA 3MYXA 1W0PA 3BN6A 1WCKA 5AC91 3UKNA 4OLLA 2HWD1 2RM23 4YW5A 1NXMA 4UF0B 1W8HA 5FYCA 4SBVA 3RDIA 3A4UA 4OFGA 5FY4A 4CPBA 4XJAA 1ZBE3 1OQDA 5F5QA 1HXS1 2HWF3 2W2IA 1XNKA 3JZVA 5FY0A 1GZWA 4CDWA 2BPA2 1JU4A 1NX9A 2KD7A 5D8AC 3ABZA 1LKNA 2WT1A 3GALA 2EXKA 4SLIA 2QZ2A 3RZGA 1W2AX 2CWMA 3HD8B 2ZEZA 2DF7A 2F4LA 4N8MA 3WDWA 4AZZA 3ZN4A 3USUA 2BZDA 2ORXA 1C8NA 5LBCA 4I02A 1VB2A 2DTYA 2OZJA 5FZ1A 2VUAA 1B35C 4FPEA 5FZEA 3NWKA 3JB8A 3NNMA 4JTOA 1WA4A 2Y6LA 5JWPA 1W9WA 1QJFA 1YQ5A 2YY1A 1XYPA 3J7LA 1HRV1 4IW3A 5JXIA 1ULDA 5AVPA 1OH4A 3OSDA 4DEVA 3Q9OA 4LT5A 5FOJB 4JGZA 2GMEA 4Y33A 1QJZA 1BEV1 1YNAA 1NA1A 4FPLA 2GP5A 5I0TA 5GALA 2GZWA 3BGAA 4W6XA 4BH9A 2WBKA 5DG2A 2W94A 4Q8LA 3PVNA 1R082 3LCPA 2P17A 2DCKA 1W04A 2VW0A 1GP4A 2VL4A 1HJFA 1OQEA 5A7NA 2W68A 3D82A 4LMFA 3VKMA 3WINE 3ZR6A 3RZJA 1DP0A 2JDMA 1D2QA 2WKKA 4JDMA 5A7QA 1VMJA 4BU2A 1QQP3 1DFQA 5HCHA 2ZOEB 3I3QA 1HRI1 2D43A 4RHV3 1DF0A 4N9IA 4D94A 5JCTA 1W6QB 4P08A 2AZ5A 3H50A 4I0WB 4S2DA 1I6XA 3MEPA 3VBFC 4XUQA 4CEYC 5I0UA 3FJSA 4YVWB 5FRAA 2RS53 1GNHA 3KGZA 2E6VA 1YFWA 4JGYA 4LIVA 5FXZA 5APAA 3OY8B 2JIJA 2V5DA 1YRZA 4I2OA 3W9AA 4NHMA 2RVAA 1JYNA 3LSDA 3T4VA 5DUWA 2JDKA 1C8M3 4BIFA 4CYDA 3B02A 4Q4W2 4GMP1 1DBNA 3KLSA 5CEHA 1AR83 3NJYA 3U37A 2UY9A 4I09A 3VKNA 2R30A 1C5HA 4BK4A 1LOEA 4GZ9A 2IXKA 3IZOA 3VZOA 4CCMA 3I2OA 3PUHA 1TME2 5CYYA 1IZ3A 5FMOS 3S7EA 2GNTA 5C8CA 1ND2B 4G4FA 2KXLA 4XFFA 4PBOA 3ZFGC 3C7GA 4LOTA 4NPMA 4XPVA 5FREA 3RQ0A 5A7WA 2WO7A 3AP7A 2I45A 4CDUB 1RHI2 3KF5A 5A32A 5IVFA 5F5AA 1VBE1 5FY5A 1I1EA 3U07A 1MS4A 5FXXA 1W6OB 1D4M2 2VW1A 3C3VA 2Y0IA 2YC4A 1GOFA 2DCYA 2ID4A 1QJY1 5LK7B 1PM4A 4RD7A 5DABA 4JV4A 2ZABA 1G9BA 3ACLA 2VCBA 4XW3A 1HB2A 4TYSA 4KWUA 2FCUA 1AX2A 2GC2A 4DMIA 1KS5A 3I3EA 2ZAHA 1SEFA 3VDBA 3PIJA 1ENSA 1W9TA 2Y0OA 2D3RA 2WZPP 5FPUA 4BQXA 3IDBB 5KHIA 4YW4A 2JG9C 2QQWA 3LF7A 3M7AA 5FCCA 1ND3C 2VZRA 3F2ZA 3LEKA 2J22A 5IATA 1AYM3 2ZCWA 4C0HA 2XLGA 4AEJA 4BMEA 1AR73 2D98A 3ROUA 5J09A 1C3HA 1WCQA 4AF9A 3WVJA 4NHYA 2XBO1 2ZGOA 2OKXA 4LHLA 2ZEYA 1N1VA 3BTXA 1VRH2 4UW3A 1AR62 5L36A 1XJAA 2FDGA 3T2PA 3LWCA 3FL7A 2VZTA 2ZGUA 2Z5WA 3ZXDA 1F5JA 4LO5B 2CY6A 3ZOIA 2MPFA 4FTSA 5A1LA 3BU0A 2FDJA 1C5IA 4R9DA 1JYXA 2C24A 3HBKA 3HWJA 1LOCA 4FOQA 3VD3A 4CCCA 1QJEA 2XJQA 3LSEA 3MIFA 4PCRA 1AR93 2JIGA 3AFKA 1W3VA 2GC3A 2B8MA 3PURA 4MUVA 1N3OA 5CVRA 5FV3A 5FZMA 2WT0A 3I2JA 4AI3A 4Q0QA 4A7ZA 3M4FA 1UIKA 2Q5TA 4XFIA 4FO9A 2OXBA 4ZU5A 2FBEA 4Y5Z0 4DO0A 4TLGA 1E57A 3POEA 4OHVA 2WLPA 5LY2A 4Q1PA 1LOBA 4AQ6A 4AE2A 4QDQA 1ZBA1 2BYVE 4A44A 3ELNA 3T30A 4WVZA 1OPMA 1D0HA 2D6NA 4BYYA 3OTFA 3ZN6A 1OHFA 3ZYHA 3KSCA 1PO22 4MX3A 1UYXA 4YVSB 5A33B 2A75A 2MHFA 4AWDA 2JICA 3ZPYA 4IEXA 2WNEA 1NKGA 1PVC1 2RR12 3ZYBA 1W28A 3LFMA 3ZXGA 4WM8A 2QKDA 2YFUA 4KBZA 1TZOA 3LGRA 3I59B 4COUA 5ABJC 3GBGA 3HN1A 2YGLA 4F3JA 1Q5OA 2UWBA 3X29B 3D3AA 1NG0A 3WCRA 4DOUA 1EPZA 4GA9A 1IQAA 2XJSA 4IV1A 3H8OA 4IGPA 5BPXA 4IETA 4M3CF 3OF1A 5FLJA 2A3YA 5F5IA 2PLV1 4DQAA 1GWKA 5CADA 1SBDA 1VBA1 2YBKA 3N36A 3SXWA 5D2AA 3VZKA 3BVCA 4AAPA 5FK8A 1QJX2 2XL7A 1JBCA 1G9FA 3WR0A 4B7KA 5JMOA 2R32A 4CDQC 4RS5C 5EIYB 4RR3B 5JXGA 1CX1A 3ZFGB 3OOXA 3K3NA 1CAXA 1K45A 2WFPA 4WM7A 2FD8A 1UY2A 1LOAA 4RQPC 3AKQA 4Q0PA 3WDTA 1ZZCA 4DFSA 3NAPC 5AVAA 3TEYA 5CKMA 3OUJA 3LDKA 5LB6A 2GH8A 4XCBA 2RM21 2DV9A 4Q5OA 1RUH3 4OMCA 2VULA 3MHZA 3FBMA 2D6OX 5DZEA 1YQ8A 3WNNA 1VB4A 2IXHA 3POJA 4GWMA 4Y1UA 5KR7A 1W2UA 5F3CA 3EB7A 1EP0A 2R1BA 2YUEA 4H2AA 1AVBA 3VDDA 5FP3A 5JI7A 2Q8EA 1YCIA 3VBSC 4LE4A 3NJZA 3IAPA 2F4PA 3AX4A 3WQ7A 4RYDA 5GZCA 1RITA 5CZKA 1HN0A 1WW4A 2OQ7A 2ZGRA 3IB3A 1MACA 1ONAA 1V9U2 2Y6GA 3UNPA 3GBFA 4YGCA 3AM2A 2XKPA 1FOD3 1UOJA 4OZOA 3WG1A 4ONUA 2GN3A 5LA2A 3TEWA 4G9SB 4KU7A 1IS5A 1WA6X 4FCAA 1RUD3 1RJ7A 3GF6A 1W9FA 5GLZA 5CU1A 2B45X 3L2HA 4MZUA 4RGKA 2RDRA 3HEIA 4E2GA 4UT5A 4XF3A 1CWPA 1OSGA 4Y1ZA 4QM8A 4KU8A 1W90A 5F8PA 3T3YA 5FR3A 5A80A 4B1LA 2PHXA 4AI8A 2DCTA 3VKLA 4EN6B 1N3QA 3LDBA 4IE7A 1CAVA 2FMYA 1APNA 2O8OA 3M3EA 2H6BA 1TMF3 1LHNA 5LWBA 1AUYA 2VQ0A 1N1SA 3PDQA 4FFIA 4AEDC 5HV4A 2FMDA 1BLZA 1VBC3 3FFZA 2JKBA 3VHRA 5BY5A 2YU1A 4Y22B 1J3RA 2H0VA 5LA9A 3I2GA 4FTEA 3E5QA 3VD7A 1GP6A 1K42A 2AREA 2RG4A 4QQLA 1XBFA 1COV3 3R05A 3UETA 1W8OA 2W1SA 4OMDA 3RZKA 4UFIA 2YROA 5FJHA 2ZX4A 2RS51 4XABA 2FHRA 4XBQA 5IVBA 2CV6A 4CP9A 4XC9A 4O9EA 3RG0A 4BQWA 1C1FA 2G1MA 1YFXA 4BZ4A 1UCXA 4CP0A 3OJBA 4AFDA 3O1RA 5K9YA 5F3IA 4QPIC 3WW1A 5HCBA 2BBVA 4L8QA 2P3JA 4QPGA 4AVTA 1SBEA 3WW2A 2BGOA 3WT3A 2HWC2 5D1IA 4ZONA 1SCRA 2GAUA 1QDOA 4AW7A 2OX0A 3NV1A 4TLFA 1PIV3 3S7IA 2CWSA 5KHJA 3GDBA 2J42A 3J8F1 1OVSA 2BNOA 4K6BA 4DXTA 3U4XA 3SKVA 1J1LA 5F37A 1MS8A 1POQA 1QJU3 2OQ6A 3FBYA 4K1ZA 2HWB2 3MFCA 4DINB 4Z2AA 3RSJA 1R1A3 3QLQA 1RMU1 4JQTA 5IVYA 1YUDA 2QQMA 4FPYA 1OKQA 4E4SA 2QQOA 4O61A 4LR4A 5C9AA 1VBB1 2WN3A 2YXSA 1Q3EA 3KVBA 1U5ZA 4GD4A 4CUGA 1DHKB 1W2NA 4DRRA 1RUJ3 3JBG3 3NO8A 4D7YA 5IAXA 4OQ9A 2DBIA 3M8LA 2VR4A 4A3XA 3O14A 4LORA 4XJWA 4B3NA 2VZ1A 3VBOA 1RTVA 3SH3A 2YDEA 1W6MB 3IT8A 4FT8A 1RL3A 1DZQA 3I4IA 5E1RA 1AYM1 2IC1A 1IG0A 1KRIA 1QHDA 3V65A 1AR71 5ERLA 5K0UC 1NYWA 2DBNA 2E9QA 3AKRA 3PLQA 2J1UA 4XQWA 1AYN2 3K4ZA 4E4HA 2W1QA 2D5FA 3HT2A 4I30A 3ZDSA 4CXXA 4D7SA 4TTGA 1O4ZA 1JZ3A 4LULA 2VOVA 5LRRA 4OQ8A 1OT5A 5DPNA 2P3IA 2VNGA 2XXZA 4FQ4A 1D4VB 2VQTA 1JOPA 2WNUB 5HCFA 5T52A 4ZY9A 1GQGA 1GQHA 2Q8DA 5AC93 4EN0A 4HVQA 2HWD3 2AR6A 4JTNA 4COYA 3H3LA 4URAA 1ZRCA 3AK0A 3ITQA 4DUWA 5BNPA 2EXHA 4NHXA 4BWOA 3H9AA 4IV3B 1W6NB 4YG6A 3DPRB 4HBNA 4CCLA 1HXS3 4LO8A 2L9LA 3OEBA 5JVVA 2D93A 4LO4B 5F5CA 1PO12 4JZRA 4ASMB 3OUIA 2BV4A 2XH6A 4UXAA 4A7KA 2E26A 2PHRA 4CDXC 3ACGA 4W65A 2VXRA 5LBBA 3SCGA 3THDA 3WUDA 1JS9A 4B1MA 3O1TA 4XHBA 3W5NA 2P37A 5L9VA 4RFT0 4H3WA 4HK9A 3QH6A 1X9PA 4M4PA 5FTTC 4CCDA 3O1PA 1HB1A 2HJIA 2GMMA 4R4XA 4AEKA 4EWAA 2ZGLA 2K2SA 3I3MA 4YFZA 2K46A 4Q27A 1IG3A 2QDRA 4P00B 1LHVA 1NCRA 5CKQA 5DAWA 3RYRA 5FPXA 1HRV3 5DUVA 2C26A 5GJ6A 1WLTA 4Z8BA 2AGSA 4QXCA 4UAPA 5IHRA 4XE9A 2WINB 2BVVA 2ARXA 3DKWA 1BEV3 3LOBA 2R072 3BIEA 1PGSA 2DCZA 1UL9A 4P9LA 2W95A 3EHKA 5H9SA 4LBQB 4OVEA 1LOFC 3PHMA 2HH9A 4TSVA 1H6XA 3UESA 1WMDA 2Q4SA 2VTXJ 5G04L 1UX6A 5IWFA 1ZREA 2BGCA 1PK6B 3I2HA 3JD71 1ZZ8A 2UURA 1WGPA 2VUDA 1XOYA 4GH4B 4AL9A 3FHIB 4PI2A 1AL0G 4S2FA 1MR5A 1Z78A 5I91A 1YIPA 3WNPA 2QQPA 3NQHA 1O8SA 3RFRA 1F5FA 1OF3A 3POBA 2VE1A 4XJZA 1J3QA 2WZ8A 4Y1VA 2NZ9A 3ETPA 1RUC3 3UGFA 1NQDA 4LK7A 1LENA 1OH3A 2DVDA 3R4DB 4Q8KA 1H2LA 1EV11 5FLIA 4BQYA 2VCAA 2AYHA 1GZWB 2CSGA 4CDWB 4EN9B 2WO1A 2WLQA 2R062 3W20A 4V2WA 1UU5A 3WG2A 1RUH1 1W3XA 5D21A 1PGL1 3HOBA 3WF2A 3B5LB 3TYJA 3INAA 1K5MA 4UI9L 1FPN1 1JZ6A 5LRSA 4GMP3 2Q0AA 5FZGA 2BW8A 3USUB 5IK4A 2HKXA 2HYXA 1X8MA 2ENRA 3VBUA 1H8VA 2XVKA 3WW3A 3ZXJA 4BDVB 4Q4X3 1FAYA 2I74A 1YIFA 3P3NA 5CIRA 2P6CA 4H7LA 3V0BA 3DGTA 5IUQA 5CA6A 1ST8A 4A6OA 1S0FA 4Z07A 4NRQA 2JE8A 4JGZB 1AXYA 3DECA 3QD6A 4RGGA 2PTMA 2AACA 1NA1B 2BQPA 4X8PA 5FBZA 4EV0A 3AP6A 3AZZA 4H14A 1UKGA 3E1F1 1KD7A 3MICA 2VXJA 5E88A 4XXPA 1GR3A 5LASA 3WW4A 1QJY3 3A0KA 3M1HA 5EV7A 5FKBA 4ZZ8A 4MADA 3KT1A 4UWDA 4XBLA 3C7HA 4YW2A 4HLTA 5FMDA 5IW0A 5FYZA 1L7LA 1YQ2A 2O14A 1D7PM 5JPNB 2WL1A 1Y4WA 1LGBA 4XAEA 3UK9A 3RJRA 4CP1A 1TMF1 1O6UA 1QEXA 1RUG3 3MV11 1W8WA 3H3ZA 4PLMA 3ZKYA 5C3SA 3O1OA 4G3YC 1CONA 3C2UA 4PDWA 2P1BA 2C9KA 3ZSLA 2PXJA 3SEEA 4OI2A 5T5PA 5AFBA 3VD4A 2W5FA 4JGYB 3AKTA 5LEKA 1JOBA 1Z0HA 3ZYIB 2DUOA 3RS6A 1KITA 1CIWA 3J7HA 4NUBA 4AOCA 1W6MA 2VTFA 3OD4A 4LJHA 1R1ZA 4LLFA 1H9PA 2ZGQA 3PTRB 2WAAA 4YLZA 5FUIA 3T1LA 5IYYA 1HN1A 1Z7S1 3OBZA 4HL0A 3QH7A 1JZ4A 1RXFA 3ECQA 5B4XA 4O9GA 5C8CB 5KC6A 5A1AA 3RZZA 3R4SA 4LQRA 2QE3A 3N3HA 1UF2C 1XNBA 2BOIA 1FMD2 1HDKA 1WLWA 1Q8QA 2JDYA 2Q1FA 2TNFA 3ACIA 3FLRA 3MFAA 4MGIE 5FY9A 3I7DA 4WM7C 4FSJA 3TWIA 4NWWA 1IQDC 4QMAA 5A7WB 2E32A 2PHWA 5T55A 2OUHA 1EUUA 4DB5A 4YRDA 5A32B 4FFFA 2QFEA 1D0GA 3LOIA 5EFUA 2B9UA 1ZBA3 5ACA1 1YFYA 4E4ZA 3ENRA 2F17A 2IZWA 3SH5A 3LDRA 1VLNA 2BNNA 1F2NA 3CO2A 4CCKA 4AFBA 4DNYA 1JH5A 4NIIA 5IK8A 2Y60A 4YM3A 5FZBA 3ZYFA 1MEC3 4YVWC 2XJRA 4YW3A 1HV0A 4I01A 4AGGA 1JHJA 3LE0A 4ARXA 2XBO2 2DYCA 1PVC3 1ODMA 4M4RA 3BOPA 2D97A 3BTAA 4YFWA 1JZ8A 4NAMA 4Y3OA 5F2SA 1RUJ1 1OFSA 3JBG1 2X10A 4LEJA 2J7MA 3IPVB 1IKPA 2LRPA 3GM8A 4QHOA 3U75A 3E6CC 2VQUA 1VR3A 4QX1A 4C1XA 1OD3A 4UBHA 3PU8A 5EJZB 4ES9A 3K4AA 4EWDA 4HVRA 1VBA3 4QX3A 2VD7A 4DEQA 4HG6B 4CU7A 3OCPA 4NE9A 4A7YA 3HNMA 4NIDA 5FZKA 1ND2C 1EAH2 4MGQA 4AG4A 4DUXA 1OA3A 3T09A 2V4AA 4CP2A 1QF3A 3P6BA 2Q1MA 4EWEA 1FV2A 4A4AA 3RRDA 1Q8SA 2C0ZA 4P5HA 3BTZA 3F95A 5HBAA 2F6BA 1H4GA 3NKGA 1TQ5A 3POGA 3RYPA 1DGLA 1I5ZA 2JDUA 2MEV1 3MIDA 2B42B 4MLOA 1LHWA 5K4LA 5JOWA 1H2MA 5FYTA 1TNFA 3I2IA 4AYUA 5CFCA 4RL7A 3H0OA 3K75B 2NYYA 3OEAA 3KQ4B 3POYA 5LCWL 4OI0A 1BMV2 1FX5A 2YC0A 3I3BA 4CSWA 1N1YA 4JQRA 4GMP0 3ZN6B 3FWEA 4B7EA 5T50A 4Z92B 1RVF3 2BEOA 4EE2A 2RS11 3U4SA 3AC0A 2RV9A 4QGLA 5A6QA 1OLQA 4NMIA 4IXLA 1GV9A 1EY2A 5BV6A 3CHXA 4AHYA 2WQZC 5L9RA 4BA6A 5LW9A 1H1IA 1HKDA 4CUBA 2AEZA 3AXDA 1XE7A 2Z79A 2PLV2 3MLLA 4WM8B 3BCWA 4BQ4A 1U5XA 1MS1A 1RJ8A 1YLLA 5JPMB 1S2KA 4P14A 4XUOA 1MZEA 1IGOA 5I93A 4IV1B 4QXHA 3PL0A 4X6QB 1PX4A 5IVCA 2WT2A 4XJ9A 2I2SA 1UN1A 1ZRDA 2ZXQA 3GHMA 2BFUS 3PU3A 3BUCA 2CL2A 5GZFA 3ON7A 5A1FA 2H6CA 1IKQA 3FLTA 5FK7A 4AGVA 4PIZA 3N4MA 5DAQA 4R4ZA 1F4AA 4D3WA 1KDMA 3P5BA 4OI4A 4URTA 3FC0A 1I9RA 5LATA 3HAGA 3WHTA 1BK1A 2O1QA 1CAXB 4CCOA 2A3WA 2RJ2A 3ES4A 4WM7B 5T3NA 5J48A 4DPNA 1Y9GA 4OHYA 5ANNA 3I8TA 3ZR5A 4B4RA 3O0XA 5EP9A 1POV3 1SDDB 1ZBE2 4BXSV 5L73A 1QKQA 2HWF2 1NE6A 4OHZA 1XU2A 4TZDA 2RDNA 4AI1A 1TME3 4WZFA 2VVDA 3KQRA 3DN7A 1RUC1 2HWE1 4QU2A 4YVSC 4IEOA 1BBT2 2DDUA 4LBNA 4LK6A 3D0SA 1AJOA 3VDDB 2PAEA 3EMRA 4MYEA 2V5YA 4QGMA 2A1XA 1AL21 2WIIB 2JG8A 1OA2A 3LD8A 1J3PA 4ZS3A 1X33A 1XSRA 4L2NA 2ZBJA 1OQ1A 4LBKA 2YHJA 2WABA 2XWBB 2BNMA 2ADEA 2WFF1 3IBMA 4PIXA 5FYBA 1AJKA 4BLJA 4CTEA 1UD1A 2IXIA 4Q0SA 4Q4X1 4Q4V1 5T5JA 1XE0A 5K7PA 1DGWA 4CU8A 2WAOA 2RHPA 3J8F3 4P9GA 1JYIA 1IPSA 3TNQA 4YM1A 3TOJA 3AZXA 3LPFA 2O0OA 2WNOA 1WZXA 3ZFEA 4RR3C 4BK5A 4AK3A 5C3RA 2EICA 4EYUA 4HN0A 4XTPA 4XFCA 1RMU3 2D6PA 2XMLA 2DURA 5DDJ3 4GB33 4K8FA 2VECA 4TN7A 4F8AA 1CAVB 1VBB3 1S1AA 2ATFA 4IL7A 1QQP2 4GALA 1NCQA 1JYCA 4RHV2 1WCDJ 2FCVA 1YHFA 3AKPA 1ULGA 2WS91 2GU9A 4Y1XA 2VBBA 5F6KA 1NLRA 2PAKA 1NUKA 2RS52 2VPVA 2ZMNA 3HQXA 3B7MA 2WWJA 1RUG1 1ULPA 3E97A 3MF9A 4KH9A 4NRPA 4P02B 1PHMA 4JC1A 5JIAA 1PVXA 2GN7A 2CU5A 2AENA 3EJKA 4Q2FA 1LESA 4XFAA 1CIYA 5KBFA 3AL6A 1C8M2 1QU0A 1WW5A 1H1AA 3IPVA 1UOGA 3ALQA 3G6JB 5FMCA 5FYYA 1AR82 4CP9B 3P3PA 3RZHA 5CG8A 3WY6A 1W8FA 2VZ3A 1VP6A 3H8XA 3KS7A 1YWKA 4FXKB 1R092 3M2MA 4QPGB 1S4CA 2A6YA 4LO7A 4QWNA 4NIHA 1TE1B 5DAPA 1PMHX 3Q8CA 1W2TA 3PNAA 4I3PA 5HXMA 4H7MA 5JOXA 3J4UH 4J1XA 3V64A 3ILNA 1TEIA 4LE3A 2W08A 1CESA 5CG9A 4WVMA 5LY1A 4GWJA 2OW4A 3WDYA 4N43A 4NRMA 4HVOA 2XJTA 4BPZA 1POV0 4IUGA 4PF1A 3OD0A 2OIIA 4L92A 2QCSB 4XF0A 1XQNA 4XF4A 1JYVA 1L7RA 3B9CA 3AMNA 1UZVA 5FXVA 1OA4A 5K8SA 3KV9A 2D40A 4GULA 1WMXA 4QAWA 5C9AB 2EAAA 5EXOA 4FI9A 1WD4A 1RUE1 3LB9A 2X29A 4N9HA 4HFSA 1UY0A 2Y34A 4OHXA 1URXA 1DG6A 2VBPA 1JHNA 3SITA 1QIQA 3LKJA 3PUQA 3S30A 3VD5A 3WUCA 3AZYA 1LR5A 1CD3G 2V4VA 1K5MC 2XUMA 4QD2A 1QDCA 1MEC1 2VGDA 1ULOA 1AR72 4EQVA 1NY71 5IAVA 4LOSA 3IMNA 5FXWA 5FP9A 3VBOB 1XSQA 4Q0VA 1ZNPA 2CNAA 2P5BA 1EPWA 4ZU7A 1JW6A 1GP5A 3OBRA 1AF9A 2BU9A 5C3PA 3MV01 2WWUA 3WF1A 3ZSEA 4COVA 1ASJ1 2VQAA 1QH7A 1QOOA 2XVGA 2WQ4A 2EXIA 1PZ7A 1KS4A 3IDCB 2QQJA 1DQ2A 4XDQA 4ZS2A 2EAKA 5FOBB 4YSFA 1GBGA 2ZX1A 2ZMKA 4YG0A 3RWKX 1UKRA 5EJ1B 1V6NA 1V0AA 2IUWA 1YJKA 2BERA 1AR92 2DU0A 3JD73 4BIOA 1ODNA 1S2EA 4M0HA 4WVWA 5F9TA 1QGLA 2R1DA 3TN92 2ET1A 3H42B 3W58A 5KXDA 1ENQA 1UX7A 4U2AA 1JYWA 1PGW2 2A6WA 2VZSA 3KGLA 1V6MA 1NLSA 4XZUG 5BNPB 3H8RA 2VBDA 1FNZA 4XYXA 1TVGA 1ZZBA 1C1LA 1V9U3 3CKHA 4IEPA 1EV13 2XJUA 5DQ0A 2ZHKA 3ZO0B 4EROA 4PF5A 5FPLA 2BJSA 4QM9A 4IE6A 3JCIA 3J7NA 4PDWC 3VHOA 2VMIA 3THTA 1IHMA 1UYYA 2NMNA 5L7OA 4CVUA 4XTMA 4BJ0A 2E31A 1FPN3 4AVSA 1PZ9A 5FAXA 2RMU2 4LKFA 1UW8A 2ET7A 4JRAA 4R9CA 4D8MA 4XAAA 3LA3A 3J9SA 4HZFA 1RVF1 2CAVA 5FBJA 5A3MA 1OVPA 4QB2A 1BJQA 1GWLA 1LOGA 3SC7X 4DY3A 1NCRB 2P3KA 1XC6A 3DCQA 3AZVA 1I5PA 4H55A 1CPNA 1SFNA 3ME2A 4NVPA 5CFDA 4WVVA 1KGYA 1YXWA 4MXWA 5FZFA 5FUPA 4EN8B 4IEZA 4HPKA 1YO8A 2LALA 3VBRA 1SFPA 2WNUC 3ZMNA 3ZYJB 4R9AA 4GKXA 2Z42A 1UZZA 4META 3A21A 1K3IA 5C4WB 2LM3A 2YC2A 5JSPA 2ZAAA 4K9SA 3MIEA 4AR2A 3MO4A 4IV3C 4M3CE 2X53S 5KC5A 3WQ0A 2JDHA 1GMMA 3DPRC 2KR2A 4UW6A 1BYHA 1DLCA 3GGLA 5F6LB 3UGGA 1IPKA 2JX9A 2H0BA 3AMPA 3ASIA 1RUH2 2HBTA 3BYWA 5FZ4A 4FFGA 2ZS6B 2VMHA 4N53A 3MLJA 4OUEA 4Q0UA 1PGL2 1H30A 4MO3M 1CAWA 1RUI3 1MQTA 1POV1 4KI5M 4KWKA 5GZDA 1ZA4A 3RI8A 3NW4A 1OF4A 2W9XA 3AP5A 3B93A 1R64A 2UWAA 3K3OA 3NL1A 1TME1 3SH4A 3WF0A 2VW2A 3NNLA 3ZXAC 2DCJA 1V6LA 2E33A 1GNZA 1LJ7A 2X5IA 3DUIA 1LCLA 3JXSA 1K5MB 5FPZA 1F9KA 1ULCA 1WKYA 3OG2A 1QNYA 2RS32 4O7XA 4RGAA 5FWEA 2HWB3 3N7KA 4S2HA 1ZM1A 4RSUA 1CVNA 3RVHA 4AGRA 4QGNA 3VBUB 1FI2A 1QXPA 1Z7S3 4LA2A 5FWJA 4Y26A 2VZUA 4ET7A 4X6RB 5EPAA 5BNOA 1FOD2 4Q4Y3 1JODA 2QQKA 1J83A 4JHTA 4XACA 1RUD2 3V0BB 2UU8A 3VZNA 3POFA 4IE5A 2OPWA 1CAUA 4YZ2A 3T2QA 3GCWA 1GFF2 2LTNA 3D4KA 4A6SA 2GMPA 5FMOL 3T0AA 5D8AA 4ZXEA 1ZZ6A 1PK6C 2NMOA 4GH4C 1P8JA 2IXLA 4IEVA 4XETA 3IWZA 2ZHLA 3UL2A 4P5YA 4DZGA 4MG2A 1O3SA 1JN2P 1V70A 2DVGA 1MS3A 5ACA3 5JXHA 4IGQA 4JKLA 1PMJX 4OI1A 3IDEA 1UZYA 3DYPA 2OUJA 1YI7A 3KT7A 4AHXA 4FAHA 5JOYA 5DDJ1 1B35A 4GB31 1CQ9A 5EZWA 1MZFA 1VBC2 1OMIA 2QDNA 4RN5A 1X50A 1DYPA 1SPPA 3N9PA 4K21A 4QB1A 4CDWC 5BUVA 4XOGA 1VRH1 2ZHMA 1AR61 2WC2A 2DUPA 3CZUA 4B8EA 3WP6A 1T6BX 2OT7A 4PDWB 1OURA 1COV2 1S0CA 4Y20A 2XG3A 5ANQA 3EYPA 1LTEA 2OZ6A 4QX8A 3CDZB 1VBD3 1SLIA 2VZVA 3R4UA 2W1UA 1ACCA 1KQRA 1SLLA 3AL5A 3WD5A 1C57A 1ZX5A 2DU1A 3FX3A 2IFRA 3BIWE 3WQ1A 3BI3A 2OPKA 4IE4A 1JMUB 3IDAA 1VAKA 2WJSA 3OPWA 1WBLA 1OUXA 2Y6HA 3WX5A 4D69A 5B4NA 1OOPB 4JGZC 1HLCA 1H1MA 1DYOA 4PQ9A 4A42A 4FPOB 1PO13 1NA1C 2CGNA 1PIV2 2WZR3 3L2YA 1S0BA 1VPHA 2B39A 2VVEA 4QPWA 3WSOA 4MH0E 5IVVA 4R8HA 3VBFA 1QJU2 1PX3A 4NROA 2ZEXA 1WWYA 2IXCA 4XF9A 2MEV3 1HX6A 2XB6C 3NJXA 1NZIA 1R1A2 2PA7A 3B94A 5FYMA 5A7SA 5C7GA 3KV6A 1PO21 4W50A 3MF6A 1VRBA 3NNFA 5FQ0A 1LB2A 4LITA 1VJ2A 1NQJA 2D6LX 2A6ZA 1HB4A 3O1VA 4X8NA 3KZ4C 1REFA 1S0EA 2EIBA 2AEYA 1REDA 3VBHA 2CGPA 3UV9A 3K2OA 2B9VA 1NT0A 2GNBA 1RUJ2 2ARAA 2HEVF 2RS13 3FE5A 2CTVA 3JBG2 1X9TA 2ARBA 4JGYC 5IK7A 5FIXA 3MIBA 1UXXX 1G8WA 1UZ0A 2VMDA 4QXKA 3QCWA 1A8DA 2Z2SB 4AFMA 2HLEA 2BWCA 1F31A 4CUAA 1QJX1 1EYBA 4OCTA 5A3PA 5IFTA 3HVDA 4KWLA 2NN8A 4BM8A 3RGBA 4YW1A 2D6MA 4DS0A 4AVBA 1STMA 3O0VA 2TBVA 5C8CC 2JWPA 4LXLA 3KB5A 3OBAA 3WXPA 4AHZA 1YJLA 4KG0A 2C4XA 3OGJA 3U14A 3AVRA 1RGSA 1ULEA 3ZIWA 5AC92 4W4ZA 1MZ6A 1REEA 1DGRA 1UPSA 2WRAA 1W6PA 2HWD2 4QKNA 1PZ8A 4L99A 3GZAA 1PNFA 2AUYA 3B01A 4QT6A 2D5HA 2JG9A 5C4WA 4HETA 2XQRA 3ES1A 1JYTA 1ND3A 4DUVA 4P9YA 4XF1A 4COZA 1W03A 2W91A 5FJKA 1HXS2 1VALA 3B00A 1JTZX 1QWRA 1C4RA 4QDRA 1MVQA 1NCQC 1WMFA 2DVBA 5A7OA 5SV8A 4B4PA 5GLTA 2ZJCA 4D0QA 5CFCB 3GJBA 1A3KA 1AX1A 2QTWB 1H0BA 2HWE3 5DZGA 4YWAA 3ZX7A 4CUCA 1GKBA 1V9U1 1Q8VA 3NKTA 2WYFA 5G05L 3VD9A 3KV4A 3ZXEA 1AL23 2QQLA 2XUEA 4QKBA 1G9DA 1NLQA 1ZRRA 3MIHA 1Q43A 4IEWA 3NVCA 4M0NA 4P9IA 5GLVA 2DTWA 5I8TA 3MGUA 4MV2A 5GZGA 2WFF3 1JZ7A 3D0JA 1JUIA 2XL9A 4IEUA 4MGZE 1HRV2 4WZCA 4QX2A 4U36A 1H4HA 1SG3A 3DV8A 5EQUA 4NJ4A 4HSJA 3MPBA 4QDSA 2G9GA 4JHZA 4V1PA 4Q4V3 4HMZA 4JX0A 5DUXA 1BEV2 5JR7B 1YC61 2C1FA 1CGPA 4UFHA 2HBUA 3K48A 1SLCA 4ATFA 1SLTA 4BISA 5FPVA 3B69A 2V72A 3E6BA 4UW5A 1I3HA 5FZIA 4Q29A 2FDIA 4N43C 1BKZA 3CF6E 1RUF3 4GJZA 4OHWA 3PIGA 5DXDA 2Y33A 2NPIA 4ISQA 3I2FA 2ZX2A 2JB8A 4A45A 4AAXA 2JEMA 4UFKA 3WG4A 1LHOA 3I2DA 5FZ9A 3EQEA 3UJOA 3LQCA 4MVTA 1PNGA 1HRI2 3N7MA 1RUC2 4WV8A 3ZSKA 1X7NA 3A7QA 4AVAA 5ABJA 3DL3A 4UYBA 2WS93 1ZVFA 4K8RB 1X36A 2E7TA 2UYBA 3HNBM 3FFQA 2LROA 3UKTA 4D6RA 3VZLA 1GWMA 3OGGA 3Q8AA 4BCUA 1V6OA 1XPWA 4K1YA 2VZOA 3DKQA 1XNTA 1LEMA 2CGOA 1RUI1 4YZ3A 4CU6A 4QU1A 4QKFA 1VMHA 2D44A 1LEDA 3POWA 4ES8A 4C0BA 2HWC1 2PELA 2VCCA 3LA2A 1YFUA 2JG8B 5F3GA 3NV3A 5B2GB 4CDQA 3AJZA 1LULA 4WM8C 3ZFFB 4AI9A 1X82A 4Q4X2 3VV1A 1KFXL 3PVOA 4FVVA 3LIHA 1MPXA 3I49A 4BB3A 3RPQA 1W9SA 1XYOA 2IVIB 3AMQA 3O0WA 2HWB1 2WNVB 4IV1C 4RQPA 3WCSA 3WNLA 3CBNA 3NAPA 4XJUA 4GWIA 1OOPA 2VMEA 4Q4Y1 4JKKA 3S5AA 2D7FA 3ATGA 3UJQA 1CPMA 3WDXA 3C7FA 4TWTA 1VBE2 1YI9A 3ZFEB 1BVVA 4PI0A 1UIJA 3VB9A 1DU3D 4CE8A 4IDZA 1VE0A 3THCA 2W0XA 3U11A 3VBSA 2YV8A 1QJY2 3O5SA 3V0AA 4YW6A 3K51A 2R043 2BOJA 3E5UA 2JJ6A 1PMIA 2R0FA 3IN9A 4HOOA 2KM2A 2WA3A 4BQ1A 1OLME 1RUE3 5FKCA 3Q8BA 1GYKA 5GLUA 4DXZA 2JDNA 3AFGA 2JKXA 1RUG2 2CAUA 4RFRB 2BP6A 1NCQB 3FUQA 4IERA 1C28A 1IS3A 3JB4C 5L7OC 2JDPA 1DCSA 1EAH3 3VDDC 3VKOA 4NO4A 3DYMA 3ZIXA 3CQOA 1OD5A 4OUSA 4Z1VA 1A34A 2ORZA 2ZZQA 3AYCA 1GANA 1HJGA 3FUOA 1M4WA 2JDAA 3MW4A 5EHDA 5FY1A 3O1UA 2PHFA 2VCMA 1ASJ3 1VBD1 2B4KA 3B3QE 3THPA 3VL9A 3UT0A 2LUWA 5CFDC 1KXGA 5KHKA 4GXLA 1MS9A 4MGYE 4PIYA 3M3CA 2NM1A 3SISA 4GAZA 2RDQA 1H8TA 3IIIA 4INDA 4UW4A 4AEDA 4QXBA 5DN2A 1LRHA 2VVFA 4UFMA 4FOVA 1PO11 5A6YA 2WZR1 2D3PA 2C6SA 1AXZA 2C5DA 4WVMB 2ES3A 3HR9A 5A3TA 5F7UA 3VZMA 5IVEA 2A73B 4N43B 5DG1A 4QX0A 5ISLA 2RJLA 3AJYA 4LBOA 2O8QA 4LHKA 1ZBA2 2J1RA 2ZGKA 4J6GA 5F3EA 5FP8A 3SCFA 3LAGA 5BNNB 2B5HA 2XDVA 4I0AA 3VLBB 4LLOA 4A41A 1CZTA 5GZEA 1F4HA 3IAQA 3OYWA 5FY8A 3AMMA 3LZZA 3I3DA 3MW2A 3GCXA 4QPIA 1MEC2 4EZHA 2VJXA 1QOSA 1WLCA 3T1MA 4B4QA 1OI6A 2WSUA 3CJXA 3OPTA 2PHLA 5DAXA 3SLIA 2ERFA 4D6SA 1BXHA 3C7OA 1PVC2 2IFWA 3TRSB 5LZ6A 2EXJA 4S2GA 1XNDA 3U1XA 1GU3A 2AH2A 2VOWA 3HMYA 4KG8A 4UFLA 5FPBA 1US2A 3TBDA 2PHUA 3JU9A 2YBSA 3RMYA 2WO2A 2YMZA 3KT4A 5BNOC 1W9YA 4F7ZA 3ST7A 4XFHA 2YB7A 2A6VA 1R083 4AI0A 1ZZ7A 3CNAA 1W8TA 2VTXA 1KEXA 5EJ3A 5FZAA 4AQTA 1VBA2 4FXGB 4QPGC 3O12A 3I54A 4L0PA 4N90A 3NNGA 2XQXA 3S57A 4IQPA 4MHRA 1GZTA 4HKOA 1LU2A 1UYPA 4NAOA 3JQXA 5E89A 1G86A 5HPOA 1CZSA 2YPJA 2ZGPA 3IIAA 1WLDA 3O7OA 1W06A 3OUHA 3A23A 5JXJA 4YYOA 3ZSMA 1BBT3 3QOPA 3H1MA 3KD4A 1SZBA 2R061 1Y9MA 1SQ4A 4TXWA 4KBBA 2RM22 3AP9A 1W39A 5E8AA 3MW3A 3WNKA 1DQ0A 1WBFA 2JDZA 5C9AC 4MGTA 2A6XA 2I07B 4Q4W3 5LBEA 4Y4RA 3BPSA 4ASLA 4ATEA 4YZ5A 5C5TA 2TUNA 2W52A 4PHZA 5K0UA 4PJYA 5JAXA 4Z82A 5L19A 3MZHA 2WA4A 2G19A 3Q8FA 2FZ1A 2QQIA 2FDKA 3R0RA 4F83A 3RNSA 1RVF2 5L7OB 3VGIA 3ZKUA 4DXSA 4K7JA 3VBOC 2R16A 2QJVA 3UGHA 4BXFA 2R0HA 5DUUA 3S5QA 5CNAA 3ZFFA 4ZU4A 2P2KA 3E5XA 1RHI3 3CLPA 2EIEA 4KQ7A 1CJDA 3CIHA 5FYVA 3WOGA 1WD3A 3QBQA 1GNYA 4YM0A 2ZX3A 1D4M3 4MSVA 2WNVA 2ZEWA 2HEYF 3H7YA 5FZ0A 2ADDA 4MXWB 4ZXKA 4AFCA 3EO6A 5CFDB 2A70A 5FO9B 3KCCA 1DGWX 5FY7A 4XFGA 4CCNA 4LKDA 4HPKB 2RE9A 2VOTA 3VBRB 1RIRA 3VDCA 4CDXA 1O8PA 3VDAA 1JXNA 1O3TA 2A7AA 2E53A 3PTYA 3U0ZA 3TAYA 1F35A 3CZJA 2EF6A 3N9LA 4XEZA 5BNPC 3ZMOA 3ETQA 1RUF1 4FOWA 1DDLA 3RMXA 5J1XA 3C8XA 4V2VA 3WP3A 5FDBA 4AXOA 1GZ9A 5FYHA 4NHLA 3VBHC 4CEWA 1QXJA 1VRH3 4B29A 1AR63 4ARYA 4QPYA 4Y5TA 4N53B 4C8DA 4E8CA 2XJVA 3AYEA 1R093 1CAWB 5KWRA 1MQTB 3WF4A 3N7LA 5J98B 1T6GC 1DQ1A 1UQXA 2VZQA 4XVHA 2Y26A 1LOFA 4GKYA 2GH2A 2W39A 1AHSA 1TNRA 2VO5A 2X5IB 3T2OA 3ZSJA 5JZGA 1NCRC 3BB6A 4J1WA 1UZWA 2A71A 4YGBA 1BHGA 1FMD1 5FP4A 1ZRIA 3ZPOA 1Y9QA 1E5IA 5BNOB 2VMCA 1FT9A 1OBNA 1MZ5A 4FP2A 3T4HB 3WLUA 5IVJA 4A2UA 1XYNA 4PQQA 1MS0A 1RB8G 5KHGA 3J8F2 5L9BA 3WHUA 1CAUB 1TG7A 1GZCA 5HCAA 2OA2A 2RDSA 1XNCA 3OBTA 2BUKA 4JCKA 5C4WC 4AVVA 1OKOA 5C3OA 1K12A 3HPNA 5F32A 2QUOA 2Y6FA 5D8AB 2R6QA 5EWSA 1RMU2 2YFZA 1PO23 5FZOB 2XLFA 3T0BA 1J59A 1LHUA 5DDJ2 4GB32 5BXXA 5F39A 4CRQA 1VBB2 3BKZA 3LEMA 2RR13 1YEWA 1W8NA 4FBFA 2D3SA 4UFJA 4GJYA 5BNNA 5FO8B 1UY1A 3E6DA 1DQ5A 3WNOA 2ZPXA 3NSTA 5HV0A 2R041 4HXCA 1B35B 4LPLA 5I0RA 2XJPA 5GKAC 4FPKA 1HV1A 1UMZA 5FUNA 1IPJA 1SPPB 2JD9A 3N9OA 2WWSA 3ZLIA 5F1RA 5FYSA 4JKMA 2BTVC 3NJVA 3USSA 1NAEA 1L3JA 3RYKA 2LS6A 4E4DX 3M70A 3CJIA 4GWNA 4Y20B 2TEPA 3WQBA 2GP3A 2UYAA 1AYM2 1QJX3 4KNCA 1EAH1 4QHBA 3BALA 2X05A 4YW7A 4NN0A 3NRUA 4ORFA 1WW7A 2YG0A 5FZCA 3TN93 3VBUC 4COWA 3SCHA 5IK5A 2UWCA 4FFHA 2W87A 3RWNA 4FAGA 1WMEA 3ILFA 1CR7A 5IJRA 4UF0A 4IE0A 5FFOC 1LGNA 2GALA 4IEQA 1UU4A 1G9CA 1O59A 3GYDA 3D8CA 3W5MA 1AX0A 2BBAA 3D5OA 3WDUA 5I8SA 4HKLA 1BZWA 4XUNA 2A5ZA 5HXVA 2XKOA 1A8MA 1BMV1 4XQ4A 1Q8PA 4CEYB 3VBFB 5JLVA 5JSOA 1GICA 1RINA 2E63A 2RMU3 2V73A 4I0BA 3B9IA 5FO7B 3ZVXA 3N35A 1JUHA 1OLMA 4K20A 2VM9A 5FPAA 5FQ0B 2AC1A 3VN4A 1S0IA 2WQ8A 2EIDA 1AXKA 4A3ZA 1DQ6A 3T2TA 3KHBA 4N7IA 3VBHB 4AQSA 1HW5A 1RC6A 3FHQA 3MLKA 3KHCA 1UXZA 1NXD1 1UY3A 2PFWA 3M3OA 1W8ZA 3DYOA 5FZ7A 3ZYGA 3KCXA 1T2XA 3SNMA 1F15A 2OS2A 2BRTA 3PMSA 4CXWA 1NOVA 1ALYA 3MBWA 2OYZA 3UYJA 1HQNA 2QQVA 3WP4A 1LU1A 2VU9A 1H2KA 2EALA 5A3WA 3A0NA 3VHNA 3LEIA 4ZPIA 3C7EA 1LNSA 5KHHA 2JE9A 1OOPC 1HB3A 2VH9A 1W0NA 3G7DA 3J26N 2ZZJA 1R081 3MDPA 4FPHA 3AVSA 5T5OA 2DUQA 1XE8A 2XOMA 4N7UA 3SHRA 1W6QA 3AB0A 1ZBE1 1O91A 3JD72 1UOBA 5T5LA 2HWF1 5JOZA 1RUOA 4YVWA 1GOHA 1Q8OA 2V09A 4BLIA 4DXRA 1Y3TA 1ZYBA 1W6PB 3OY8A 4QX7A 2NP0A 2BFUL 1DZTA 3FHAA 2JG9B 3HBZA 3EBRA 1SMVA 4M01A 2QZ3A 1US3A 1BBT1 4MXVA 1ND3B 5M0TA 5I8YA 4JAAA 5JMCA 1KFUL 3QACA 2RS33 2PQSA 4R9BA 4NIGA 3HJRA 1EV12 4Q26A 3AKSA 2QQNA 2VUJA 4LO6B 4XMAA 4P9WA 1S0GA 3AYAA 3WF3A 1UMHA 2IXJA 2VUCA 1ULFA 2BGPA 5I0DA 2G4IA 2ETEA 1S55A 4Q4W1 4W8JA 4IEYA 5FZ8A 3VUOA 1IS4A 4XZPA 1FPN2 1ND2A 3U10A 3GXUA 1S0DA 2HWC3 4MGKE 4CCJA 1LAJA 1U12A 1VAMA 1FATA 3RZLA 5CB7A 2JB4A 3VHPA 2QNKA 5JI9A 5T54A 4CDUA 2FZ2A 5A6XA 4LKEA 4FP3A 3GBWA 4QQHA 1W6OA 3H1YA 3BU7A 4QHZA 1E5RA 3S6PA 1QMJA 2NQYA 3NMBA 1H8TC 2JENA 4XFBA 1RHI1 4LBLA 4D7TA 3M3IA 5J96B 1XU1A 1XNAA 2R7EB 2Y38A 2ZTNA 3APBA 3HIFA 1D4M1 2BDRA 4NR1A 2NLRA 4DRVA 5C70A 4BE3A 1QQP1 4FTBA 1AZDA 2PQQA 3U78A 1F8VA 1S0JA 1X8EA 1Y43B 2ILMA 2GNDA 3LFIA 4RHV1 4WBBA 3GNEA 2W46A 3JUUA 1XXNA 2WSVA 2W47A 2ZKNA 4YGDA 1W99A 5FZOA 5GLWA 2P34A 1G6NA 3AMHA 1CZVA 2D6KA 4LTAA 5A3UA 2G9FA 1TMF2 4LIUA 4M00A 2E7QA 4MOAA 3KM5A 4O65A 5CAZA 2CDOA 5CFCC 4PBPA 4E8DA 1JZ2A 4QQ2A 1SFYA 3ZN5A 2VMFA 2Z4FA 1U5IA 5ABJB 1C8M1 4HANA 1RUI2 4Y24A 3M3QA 1AR81 1AYN3 2PN5A 4PLOA 4E2QA 3N9QA 4HONA 3L9JT 3SKJE 2B7YA 3RI9A 1Q56A 1BQPA 1J84A 3T08A 1R091 5F2WA 1RXGA 4ZHNA 5E16A 5KXCA 3IMMA 3UKVA 1FXZA 4L9BA 2P3YA 4RS5B 4CDQB 1Z7S2 3VKFC 5C6CA 1G9AA 1UMIA 1O3QA 2J1TA 1UWWA 3FMGA 3OGVA 4Q4Y2 2XHNA 1FYUA 4UBGA 2P4EA 3BTYA 1N1TA 4KL1A 4L97A 2QBXA 4RQPB 5TSWA 5JIUA 3NAPB 1N3PA 2QQUA 4LKSA 2PHDA 1QNWA 2ZGMA 3KCYA 4K3UA 4ASKA 2FCTA 1GSLA 5C5UA 2Q8OA 3SQOA 2HEWF 4Y1YA 2Q1ZB 3PUIA 4Q1RA 5FMBA 2Q8CA 3ZM8A 3MPPG 1OFNA 4HSLA 3JQWA 3DXTA 1XB9A 1ZZ9A 1GQPA 4YVSA 5A33A 2W92A 4XIKA 3SEPA 4CEYA 2N7GA 2WUHA 4BQ2A 5LEJA 4M3CB 4E9KA 5ACA2 2J1VA 2Y6JA 1WCSA 3VBSB 3V0AB 2VNOA 5J3UA 4XHXA 2Q30A 1KJLA 4W6YA 5H9PA 3RZMA 2BWAA 4E2SA 3I59A 4ZZ5A 4AI2A 4JDNA 4DY5A 5AFEA 2PMWB 1J58A 4R52A 2BVBA 3HQUA 4JRLA 3N7JA 2RR11 1QY4A 3BODA 3WP5A 1LECA 4YPJA 4MGSA 1O4TA 1LODA 2R073 3TB0A 4OZXA 5IFPA 1VBD2 3O1SA 4I3GA 1B09A 2VNVA 5FZDA 3WV6A 2JG8C 4BQ5A 1BVP1 3ZFFC 4RR3A 4LHSA 5CISA 3ZFGA 4PT6A 3O1MA 1AR91 3OGSA 3NNJA 4XILA 4P9JA 4OUMA 5DAVA 2DFBA 3IKWA 3KV5A 2WNVC 3N9MA 3TN91 3Q8EA 4NPLA 3WNMA 4YARA 2CYFA 2DVAA 5FZ3A 1RYYA 1PGW1 2WO3A 3POIA 4AHWA 2RJKA 2WZR2 3ILRA 1GOGA 1H8TB 4AEDB 2GC0A 3LEGA 4C1WA 2DWRA 3WZ1A 3ZFEC 1WW6A 4CCEA 4AFAA 4CZSA 2R063 2YU2A 4OYUA 1U0AA 4C91A 2MEV2 3V56A 1DQ4A 3VL8A 1W0OA 1S2BA 4QQOA 1OPOA 1OUSA 4FPCA 4YM2A 1YQ6A 3WDVA 2GSYA 1W8UA 1UU6A 2XLAA 3H1WA 3AXEA 4XUTA 3WEZA 2DFCA 4Y5SA 2W1WA 5JUVA 3ACFA 4CEWC 2RMU1 5JSRA 1XRUA 2IVJA 4GIQA 4NWVA 4HN1A 2A3XA 3RJ2X 2VOXA 4QKDA 3OYWB 2YPDA 2JD4A 5HI0A 1GLHA 4QPIB 2RS12 5FYUA 3MI8A 4OULA 5A7PA 4XURA 1O3RA 1L7QA 3SMHA 3ZYPA 4AQ2A 1SACA 5DZFA 1E5SA 1FV3A 2E51A 4AEMA 2DVFA 2SBAA 2VOKA 1WUVA 3K46A 4XDOA 5DMYA 5JZGC 2VG9A 2WZEA 3AYDA 3GZTB 4UOJA 5FP7A 2VNRA 1UOFA 2ZGSA 1D2SA 4YZ4A 1H6YA 4E27A 1LGCA 2K9ZA 2CHHA 2QVSB 3D6EA 1J1TA
chains in the Genus database with same CATH topology
4FPGA 1U5YA 5JDBA 5KXBA 1HRI3 1CN1A 2XWJB 3H8UA 2R49A 1DLLA 3PVBB 5EJ3A 2E7AA 2ZX0A 4L11A 4XJ8A 5BYNA 4KGGA 2HYKA 1YYNA 2YYOA 1HQWA 4Y22A 2XGXA 3FLPA 1BCXA 3BPZA 4YGEA 1A6CA 4JVAA 4HK8A 3TNPB 3ZYRA 4LA3A 4K40A 4LBQD 1A78A 4FPJA 5BNNC 5GM0A 2YZ4A 2XPJA 2YGMA 5C33A 2PYTA 1H9WA 5J36A 2OVUA 2HWE2 1QOTA 2RS31 2B46X 3H7JA 5K0UB 2IWGB 1DZRA 1OLRA 1SCSA 4ITCA 4RA0A 2ZA9A 5A3LA 3AP4A 4FQZA 4QX5A 1FOD1 1AL22 3CJIC 1IOAA 4JDOA 4QQPA 2PHTA 1RUD1 2KA3A 1IS6A 2WFF2 1VBE3 1VIWB 4LBMA 1FMD3 3CEWA 5J7MA 2GC1A 2K0GA 3OPZA 3FZ3A 1FNYA 4RS5A 4Y4YA 3H3UA 4BMBA 3EXUA 4Q4V2 4YG3A 3KMHA 1MS5A 4GQ7A 1H2NA 3PMEA 2EVXA 3DF0A 1UPIA 1HIXA 1V00A 4AVCA 5H9QA 2JXAA 3W59A 3ZXLA 5KXEA 1NZCA 3GZUC 4EN7B 1O4YA 3WG3A 4CDXB 1RUF2 5EYYA 1V6JA 2FQPA 1M06G 1VBC1 4W6WA 2C9AA 3PJYA 4NPRA 1CX4A 1MVEA 1G7YA 1SLAA 2XVLA 1CJPA 2XBO3 1KDKA 1PM7A 4M3CA 4KWJA 4LUKA 4XXAA 4EJRA 4XBNA 2JECA 1COV1 5SV5A 3IM0A 1SDWA 4LBJA 5BNQA 1NE4A 3NV4A 4BOWA 2GNMA 4KGQA 2WS92 4FPFA 4CEWB 2UY8A 1O5UA 1SBFA 2ZGNA 2ZHNA 1O7FA 1ENXA 1RUNA 1AYN1 2WNUA 2ZACA 2ZKLA 4FOYA 5FLHA 3MIGA 4YZ1A 2PAMA 1PIV1 2MNGA 2GDFA 1UAIA 5JZGB 3CL1A 1ENRA 5EYXA 1QJU1 4IV3A 1W6NA 3DPRA 2VY0A 1R1A1 1Y7BA 2EA7A 2X8KA 1DGRN 3POSA 4NOTA 3VBRC 4HKWA 4ZKTB 5J37A 4YNIA 2XHKA 3NV2A 1QH6A 4GMP0 2ZMLA 2SLIA 1JOJA 1QXRA 3BOWA 3AZWA 3PJQA 5H9RA 2VMGA 4XMIA 2JE7A 3ZXKA 2ZGTA 3PVEA 2R042 3ZXFA 4LNVA 3WNXA 4BHPA 3VZJA 2Z69A 5C8WA 4XIOA 1V6IA 1DYKA 1V6KA 3URFA 1RUE2 4IESA 2EIGA 1VAVA 1ZRFA 4LUMA 2PLV3 4N53C 3LA7A 4HT1T 1MQTC 4LHNA 4NHKA 3GHNA 4P9XA 5IT6A 4PLNA 4Z2WA 1NY72 4LBQA 1HQLA 1SLBA 3S0MA 4ISRA 5I0SA 1DIWA 1N47A 2X5IC 3CU7A 3CJIB 5CBLA 4CDUC 1KJRA 3HT1A 2R071 4XQDA 1PK6A 4GH4A 1O5LA 5LK5A 4C90A 1ASJ2 3R6SA 3MYXA 1W0PA 1WCKA 5AC91 3UKNA 4OLLA 2HWD1 2RM23 4YW5A 1NXMA 4SBVA 3RDIA 3A4UA 4OFGA 4XJAA 1ZBE3 1OQDA 5F5QA 1HXS1 2HWF3 3JZVA 1XNKA 1GZWA 4CDWA 2BPA2 5D8AC 1LKNA 2WT1A 3GALA 2EXKA 4SLIA 2QZ2A 2CWMA 3HD8B 2DF7A 3WDWA 3ZN4A 3USUA 1C8NA 4I02A 1VB2A 2DTYA 2OZJA 2VUAA 1B35C 4FPEA 3NWKA 3JB8A 4JTOA 1WA4A 5JWPA 2YY1A 1XYPA 1HRV1 1ULDA 5AVPA 3Q9OA 4LT5A 5FOJB 4JGZA 2GMEA 1QJZA 1BEV1 1YNAA 1NA1A 4FPLA 5I0TA 5GALA 2GZWA 4W6XA 4BH9A 5DG2A 4Q8LA 3PVNA 1R082 3LCPA 2P17A 2DCKA 2VW0A 1OQEA 2W68A 3D82A 3VKMA 3WINE 2WKKA 1D2QA 4JDMA 1QQP3 1DFQA 2ZOEB 1HRI1 2D43A 4RHV3 1DF0A 4N9IA 4D94A 5JCTA 1W6QB 2AZ5A 3H50A 4I0WB 4S2DA 1I6XA 3MEPA 3VBFC 4CEYC 5I0UA 3FJSA 4YVWB 5FRAA 2RS53 1GNHA 3KGZA 2E6VA 1YFWA 4JGYA 3OY8B 4I2OA 1YRZA 3W9AA 4NHMA 3LSDA 5DUWA 1C8M3 4BIFA 4CYDA 3B02A 4Q4W2 4GMP1 1DBNA 3KLSA 1AR83 2UY9A 4I09A 3VKNA 2R30A 1C5HA 1LOEA 2IXKA 3VZOA 1TME2 1IZ3A 5FMOS 3S7EA 2GNTA 5C8CA 1ND2B 4G4FA 2KXLA 4XFFA 4PBOA 3ZFGC 4XPVA 5FREA 3RQ0A 3AP7A 2I45A 4CDUB 1RHI2 5A32A 1VBE1 1I1EA 3U07A 1MS4A 1W6OB 1D4M2 2VW1A 3C3VA 2Y0IA 2DCYA 1QJY1 5LK7B 4RD7A 1G9BA 4JV4A 2ZABA 3ACLA 4XW3A 4TYSA 1AX2A 2GC2A 4DMIA 1KS5A 2ZAHA 1SEFA 1ENSA 2WZPP 2Y0OA 2D3RA 3IDBB 5KHIA 4YW4A 2JG9C 3M7AA 5FCCA 1ND3C 1AYM3 2ZCWA 4C0HA 2XLGA 4AEJA 4BMEA 1AR73 2D98A 3ROUA 5J09A 1C3HA 4AF9A 3WVJA 2XBO1 2ZGOA 4LHLA 1N1VA 1VRH2 4UW3A 1AR62 5L36A 3LWCA 2ZGUA 3ZXDA 2Z5WA 1F5JA 4LO5B 2CY6A 2MPFA 4FTSA 1C5IA 4R9DA 3HWJA 1LOCA 4FOQA 2XJQA 3LSEA 3MIFA 4PCRA 1AR93 3AFKA 2GC3A 2B8MA 4MUVA 5CVRA 1N3OA 4AI3A 2WT0A 4A7ZA 4Q0QA 3M4FA 1UIKA 2Q5TA 4XFIA 4FO9A 4ZU5A 2FBEA 4Y5Z0 1E57A 4OHVA 2WLPA 4Q1PA 1LOBA 4AQ6A 4AE2A 1ZBA1 2BYVE 3ELNA 4WVZA 1OPMA 1D0HA 2D6NA 4BYYA 3OTFA 3ZN6A 1OHFA 3KSCA 1PO22 4MX3A 4YVSB 5A33B 2A75A 2MHFA 4AWDA 2JICA 3ZPYA 4IEXA 2WNEA 1PVC1 2RR12 3ZXGA 4WM8A 2QKDA 3LGRA 4COUA 3I59B 5ABJC 3GBGA 3HN1A 2YGLA 4F3JA 1Q5OA 2UWBA 3X29B 1NG0A 3WCRA 4DOUA 1EPZA 4GA9A 1IQAA 2XJSA 4IV1A 5BPXA 4IETA 4M3CF 3OF1A 5FLJA 2A3YA 4DQAA 2PLV1 5CADA 1SBDA 1VBA1 3N36A 3SXWA 3VZKA 1QJX2 2XL7A 1JBCA 1G9FA 3WR0A 4B7KA 2R32A 4CDQC 4RS5C 4RR3B 3ZFGB 1CAXA 2WFPA 4WM7A 1LOAA 4RQPC 3AKQA 4Q0PA 3WDTA 1ZZCA 4DFSA 3NAPC 5AVAA 2GH8A 2RM21 2DV9A 1RUH3 2VULA 5DZEA 3FBMA 2D6OX 1VB4A 2IXHA 4GWMA 4Y1UA 1W2UA 1EP0A 2R1BA 2YUEA 1AVBA 3VDDA 5JI7A 3VBSC 1YCIA 4LE4A 3NJZA 3WQ7A 2F4PA 3AX4A 5GZCA 1RITA 1WW4A 2ZGRA 1MACA 1ONAA 1V9U2 3GBFA 4YGCA 3AM2A 2XKPA 1FOD3 3WG1A 4ONUA 2GN3A 4G9SB 4KU7A 1IS5A 4FCAA 1RUD3 1RJ7A 3GF6A 5GLZA 5CU1A 2B45X 3L2HA 4MZUA 4E2GA 4XF3A 1OSGA 4Y1ZA 4QM8A 4KU8A 2PHXA 4AI8A 2DCTA 3VKLA 4EN6B 1N3QA 1CAVA 2FMYA 1APNA 2O8OA 3M3EA 2H6BA 1TMF3 1LHNA 1AUYA 2VQ0A 1N1SA 4AEDC 2FMDA 1VBC3 3FFZA 2JKBA 3VHRA 5BY5A 4Y22B 1J3RA 2H0VA 4FTEA 3E5QA 2AREA 4QQLA 1COV3 3R05A 2YROA 2ZX4A 2RS51 4XBQA 2FHRA 2CV6A 4O9EA 3RG0A 1C1FA 1YFXA 4BZ4A 1UCXA 4CP0A 3OJBA 4AFDA 5K9YA 4QPIC 3WW1A 5HCBA 2BBVA 4L8QA 2P3JA 4QPGA 4AVTA 1SBEA 3WW2A 3WT3A 2HWC2 5D1IA 1SCRA 2GAUA 1QDOA 4AW7A 3NV1A 4TLFA 1PIV3 3S7IA 2CWSA 5KHJA 3J8F1 3U4XA 2BNOA 4K6BA 1J1LA 1MS8A 1QJU3 3FBYA 4K1ZA 2HWB2 3MFCA 4DINB 3RSJA 1R1A3 3QLQA 1RMU1 1YUDA 4FPYA 1OKQA 4E4SA 4LR4A 5C9AA 1VBB1 2YXSA 1Q3EA 1U5ZA 1DHKB 4DRRA 1RUJ3 3JBG3 3NO8A 4D7YA 3M8LA 4A3XA 3O14A 4XJWA 4B3NA 3VBOA 1RTVA 3SH3A 2YDEA 1W6MB 3IT8A 4FT8A 1RL3A 1DZQA 3I4IA 5E1RA 1AYM1 2IC1A 1KRIA 1QHDA 3V65A 1AR71 5K0UC 1NYWA 2E9QA 3AKRA 3PLQA 4XQWA 1AYN2 2D5FA 3HT2A 4I30A 3ZDSA 4D7SA 1O4ZA 4LULA 2VOVA 5LRRA 2P3IA 2VNGA 4FQ4A 5T52A 1D4VB 2WNUB 5HCFA 1GQGA 1GQHA 5AC93 4EN0A 4HVQA 2HWD3 2AR6A 4JTNA 4COYA 1ZRCA 3AK0A 5BNPA 2EXHA 4BWOA 3H9AA 4IV3B 1W6NB 4YG6A 3DPRB 4HBNA 1HXS3 4LO8A 5JVVA 2D93A 4LO4B 1PO12 4CDXC 4ASMB 2XH6A 4UXAA 4A7KA 2PHRA 4D69A 4W65A 3SCGA 2VXRA 3WUDA 4XHBA 2P37A 4RFT0 4H3WA 4HK9A 3QH6A 5FTTC 2HJIA 4R4XA 2GMMA 4AEKA 4EWAA 2ZGLA 2K2SA 4YFZA 4Q27A 2QDRA 3RYRA 1LHVA 1NCRA 5FPXA 1HRV3 5DUVA 5GJ6A 1WLTA 4Z8BA 2AGSA 2WINB 2BVVA 2ARXA 3DKWA 1BEV3 3LOBA 2R072 1PGSA 2DCZA 1UL9A 4P9LA 3EHKA 5H9SA 4LBQB 4OVEA 1LOFC 3PHMA 4TSVA 1WMDA 2Q4SA 1UX6A 1ZREA 2BGCA 1PK6B 3JD71 4GH4B 1ZZ8A 2UURA 1WGPA 4XE9A 3FHIB 1AL0G 4S2FA 1MR5A 1Z78A 5I91A 1YIPA 2QQPA 1F5FA 4XJZA 4Y1VA 1J3QA 2NZ9A 1RUC3 1NQDA 1LENA 2DVDA 3R4DB 4Q8KA 1H2LA 1EV11 5FLIA 2AYHA 1GZWB 4EN9B 4CDWB 2WLQA 2R062 1UU5A 3WG2A 1RUH1 1PGL1 3B5LB 3TYJA 3INAA 1K5MA 1FPN1 5LRSA 4GMP3 2Q0AA 2BW8A 3USUB 5IK4A 2HKXA 3ZXJA 1X8MA 2ENRA 3VBUA 1H8VA 2XVKA 3WW3A 4Q4X3 1FAYA 2I74A 1YIFA 3P3NA 5CIRA 4H7LA 3V0BA 3DGTA 5IUQA 5CA6A 1S0FA 4Z07A 4JGZB 1AXYA 3QD6A 4RGGA 2PTMA 1NA1B 2BQPA 4X8PA 5FBZA 4EV0A 3AP6A 3AZZA 4H14A 1UKGA 1KD7A 3MICA 5E88A 4XXPA 1GR3A 3WW4A 1QJY3 3A0KA 3M1HA 5EV7A 3KT1A 4XBLA 4YW2A 4HLTA 5JPNB 2WL1A 3UK9A 1LGBA 3RJRA 4CP1A 1TMF1 1RUG3 3H3ZA 4PLMA 4G3YC 1CONA 3C2UA 4PDWA 3ZSLA 4OI2A 5T5PA 5AFBA 4JGYB 3AKTA 5LEKA 1Z0HA 3ZYIB 2DUOA 3RS6A 1KITA 1CIWA 1W6MA 3OD4A 1R1ZA 4LLFA 1H9PA 2ZGQA 4YLZA 3T1LA 1Z7S1 4HL0A 3QH7A 3ECQA 4O9GA 5C8CB 5KC6A 3RZZA 3R4SA 2QE3A 3N3HA 1UF2C 1XNBA 1FMD2 1HDKA 1WLWA 1Q8QA 3FLRA 2TNFA 3MFAA 4MGIE 3I7DA 4WM7C 4FSJA 3TWIA 4NWWA 4QMAA 5T55A 2PHWA 2OUHA 4DB5A 4YRDA 5A32B 2QFEA 1D0GA 3LOIA 5EFUA 2B9UA 1ZBA3 5ACA1 1YFYA 4E4ZA 3ENRA 2IZWA 3SH5A 1VLNA 2BNNA 1F2NA 3CO2A 4AFBA 4DNYA 1JH5A 5IK8A 4YM3A 1MEC3 4YVWC 2XJRA 4YW3A 1HV0A 4I01A 4AGGA 2XBO2 2DYCA 1PVC3 3BOPA 2D97A 3BTAA 4YFWA 1RUJ1 1OFSA 3JBG1 4LEJA 3IPVB 1IKPA 3E6CC 1VR3A 4C1XA 4UBHA 4ES9A 4HVRA 1VBA3 3OCPA 4A7YA 1ND2C 1EAH2 4AG4A 1OA3A 4CP2A 1QF3A 2Q1MA 4EWEA 1FV2A 3RRDA 1Q8SA 2C0ZA 4P5HA 5HBAA 2F6BA 1H4GA 3NKGA 1TQ5A 3RYPA 1DGLA 1I5ZA 2MEV1 3MIDA 4MLOA 2B42B 1LHWA 5JOWA 1H2MA 1TNFA 4AYUA 5CFCA 4RL7A 3H0OA 2NYYA 3POYA 4OI0A 1BMV2 1FX5A 2YC0A 1N1YA 4JQRA 3ZN6B 3FWEA 4B7EA 5T50A 4Z92B 1RVF3 2BEOA 2RS11 4QGLA 1OLQA 4IXLA 1GV9A 1EY2A 5BV6A 4AHYA 4BA6A 2WQZC 1H1IA 1HKDA 3AXDA 4WM8B 1XE7A 2Z79A 2PLV2 3MLLA 3BCWA 1U5XA 1MS1A 1RJ8A 1YLLA 5JPMB 1S2KA 4P14A 1MZEA 1IGOA 5I93A 4IV1B 4X6QB 2WT2A 4XJ9A 2I2SA 1UN1A 1ZRDA 3GHMA 2BFUS 2CL2A 5GZFA 2H6CA 1IKQA 3FLTA