1KDPA

Cytidine monophosphate kinase from e. coli in complex with 2'-deoxy-cytidine monophosphate
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
223
structure length
223
Chain Sequence
AIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKGFSVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYARQKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sugar specificity of bacterial CMP kinases as revealed by crystal structures and mutagenesis of Escherichia coli enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords CYTIDYLATE KINASE
total genus 73
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2001-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kdpA00
2GZDA 4WZAE 2BWJA 2OG2A 4Q19A 2QNRA 4LGMA 3RYTC 4MUBA 3I62A 1ZU4A 2MSDB 1FOEB 3LA6A 1XTQA 3TBKA 3FFAA 1Z0DA 4IDNA 1FFHA 4KLNA 2OE2A 5J4YA 3T1TA 2OXCA 4CF7A 1RYHA 2ZRGA 4EAQA 3CX7A 1RJ9B 3A4NA 4D80A 4IEEA 2ZRAA 2ODEA 4LYHA 4YMSA 3R7WB 4ZO4A 3SYLA 4EJSC 1XD9A 1UKYA 3FMIA 3CBQA 3K0EA 3K0SA 3UPUA 2GXAA 1G5RA 1X86B 1RW4A 3OE7D 3QSYA 4JYBA 4NYJR 1WP9A 3OIWA 5KUTA 2YKGA 4LK2A 1MV5A 1GFIA 3IBYA 2IA5A 2ZRPA 1I4DD 1XZPA 1SVWA 1KO5A 4Q1CA 2QTHA 4LV6A 4FW9A 1G1MA 1XXHE 4MRVA 1JI0A 4NTZA 2O8BB 1U9IC 4M1TA 4TMKA 2WOJA 1OW3B 4QJ3A 5J47A 1G7RA 1EFTA 2FSFA 3QPUA 2F3TA 5LB2A 3WRYC 3FYHA 3ONWA 1ZM9A 4NCIA 4DLZA 1ZC4A 2GJAA 3EA5A 4KCGA 2AR7A 721PA 3THYA 1WRBA 5KDOA 4QBGB 2BM1A 4BUJA 2ASEA 1TAGA 2CE7A 5IDVA 2ZE7A 1ZRHA 3BAFA 3THOA 5E3HA 1J8YF 1P7CA 1Z6GA 3R20A 1AQYA 1OV4A 2VP2A 3JVUA 4FXPA 5C18A 2YINC 1CJVC 2BMJA 4UNPA 4URVR 4N1AA 1W0KD 3TSWA 5KYKA 2ZM5A 1QRAA 3K9GA 4F91B 4RVCA 3HPQA 3AUYA 4TMTA 3V4FA 1ZAKA 3LBHA 2I4IA 3C4JA 5EE5B 1R0WA 3FOZA 1G16A 2WWFA 3L8ZA 4AC9A 1JNYA 1NKSA 4TYPA 5EXPA 2JLZA 5BW8A 4D4LA 4LCBA 4D82A 2VSFA 2IXEA 2EFCB 3D7MA 3GLGA 4CEHB 1U99A 4OHWA 5CM9C 1SVSA 3BH6A 3HR7A 3ZZ0A 1Z06A 5CJ2A 1A2BA 3GP8A 3P27A 1VG9B 1BMFA 4ZDJA 3IILA 4W5WA 3M4YA 4EKDA 1BYIA 1LF0A 1QVRA 2YWHA 1OFTA 4G0NA 4OJQA 2QRZA 1CR1A 1XD2A 4URWR 4US2R 5HZHA 1IOZA 4V0KA 3BS4A 1COWD 4FMCB 3THWA 2TMKA 4I4LA 4M53A 4OHXA 2QTVB 3RWOA 1OXXK 1XWIA 2ERXA 3BFXA 1BH2A 3QF4B 2AHOA 4JBWA 5EE9A 5JHHB 2XNDD 3OIVA 2CNWD 1KO7A 2ZU6A 1AGPA 4V03A 5FOSA 3K70B 4Q02A 3EZ7A 1LFDB 4TZ0A 1YZQA 3U3JA 1E69A 4YQFA 5FOUA 2QSZA 3EZFA 3LBNA 4AK9A 2FEMA 1NY5A 4M4SA 2IW3A 4X8HA 1U94A 2C78A 1FP6A 2XSZA 2AD1A 2JGNA 4A8JC 1KOFA 1RVDA 2WHXA 1ZUIA 4JT2A 4LC1A 4EFMA 3FHCB 4V0OA 4KFTA 1FW6A 4DLUA 3AF3A 5L3SA 4DXAA 2RAPA 2GXSA 4BFVA 1Q1BA 3B78A 3D31A 1E4VA 5JS8A 2AKAB 3ZD7A 4PAMA 1JAIA 1SXJA 1AZTA 2R6CA 2Q6TA 4QGGA 4DLYA 2DR3A 2PEYA 4CIDA 2J0VA 5KPDA 4HLCA 2PZFA 3KXLA 2WJVA 4YMTA 2O8CA 3K0FB 4TQ9A 5JMTA 4DT1A 3CX8A 1YZKA 4LI0A 3B82A 2YWGA 3KJIA 3HU1A 1FQJA 1BMFD 3QF7A 4GFDA 4BZQA 1U9IA 3NC1C 1CF4A 1MH1A 4HAZA 4LPSA 4NYIR 1AGRA 5AUNB 3U3MA 1JEEA 2IF0A 1ESNA 4FCWA 5DYIA 3UK6A 2OFOA 1WQ1R 4D6PA 4ZV4A 4ASUA 3L0IB 3L2OB 1COWA 1S96A 2WJHA 1ZM2A 3X1DA 3CRRA 4KU4A 1NVVR 2YV5A 1OIWA 1F48A 1EG7A 5FPHA 3UG6A 1W0JD 2F43A 1AKEA 2G83A 2VP4A 2ZR0A 3MWLA 2GETA 4C0JA 1UF9A 1VCNA 5GJCA 1XTRA 3F8TA 4TT3A 3TR5A 2B21A 2GZHA 1M8PA 5HZKA 3NH9A 5HE9A 5JS7A 1EFCA 5E95A 2PZEA 3A4LA 1L4UA 3LWNA 2B6HA 3NBZC 4B43A 4BFWA 1UKEA 3CRVA 4QC2A 4FI3C 1P3JA 1U8AA 1E1RA 1IQPA 4HDCA 3ZS9A 2C9CA 2ECKA 2X2FA 4DLTA 5G3YA 4DWJA 3TVDA 1CULC 1IAQA 1P9WA 2ZJ5A 4QXAA 4B2PA 1T3HA 1KDRA 4HEJA 5K8LA 2QZ4A 1KK0A 2AK2A 4Q4HA 3BBPA 2GBLC 2QROA 4M9XA 4Q9LA 4OHYA 3EG5A 1AQUA 1HYQA 2P5SA 3K0FA 4GMXA 4FMCF 4LUCA 3AF1A 1GNPA 2ZETA 3W5IA 3PV0A 3I1FA 4G5SA 4MKFA 5DH9A 821PA 2O8DA 4HATA 3CPEA 1S3GA 5DI3B 4LJYA 1HV8A 5F2EA 1GVNB 4OQLA 4JJKA 2J46A 2XAUA 3QUSA 3HR8A 3SYNA 2VL7A 4KLZA 2BVNA 2WMOB 4EPXA 3E5HA 3REGA 5F3WB 4B33A 1XMVA 1WMSA 4O25A 2E9SA 2F9LA 3SC3A 2QG6A 1QVAA 1MT0A 4DCSA 1XTJA 3G5UA 5GJVC 4KSCA 5FBVB 1GP2A 3GEIA 3C15C 4A8JA 4B71A 5GJBA 3LDAA 5FL7D 1G4UR 3K0CC 4ZI3A 1VYVA 1W47A 1DG1G 2JAQA 4C0QC 5CLLA 4HDQB 1Y63A 5FI1B 3ZVRA 2P6RA 2IBMA 3IBGA 2P2LA 1T5IA 3DVLA 4PHTA 3K8YA 5JEDA 4LHWA 1ZIOA 3I4LA 2G1KA 3O8RA 1F60A 5JLJA 2H92A 3PVSA 3W3ZB 3BB3A 5SZKB 2JCSA 2IX3A 2CVHA 1ZW6A 2FFQA 1US8B 3IDQA 3W6NA 3ADBA 3DOEA 3RRZA 1NF3A 4PO8A 4RCYA 4B6FA 3SBDA 4EJSB 4FWTA 5J4HA 2HLDD 3AVWA 1UPTA 4KBFA 2VHUA 3K9NA 4LHZA 5DSZA 2DYKA 3LFUA 4HZUB 2P65A 4WXRA 1W5SA 4WW0A 3ZZTA 1Q3TA 2XXAA 1SKYB 2OM2A 3B13B 3I61A 1NVVQ 3CX6A 4I1VA 2NZJA 3QKSA 1DAIA 3UG7A 4C7OB 4JLPA 2ZE5A 4JSTA 4LJ6A 4RD4A 1TQ2A 4XVQA 4TQUS 3MFYA 1GITA 4LC0A 3SQXA 1IJEA 3FB4A 1J7KA 4IW3B 1D6JA 4YMVA 3KTAB 4MYHA 1CRPA 1DAHA 4YDSA 2ZI3A 5H68A 1U8YA 1LY1A 1QHHA 2VSXA 2YOGA 3QOFA 2E1RA 2WKQA 4NCJA 4PZYA 4DCNA 3EZ9A 2ZI6A 3AF0A 5AUOB 2OLKA 4UKDA 1HUQA 2EYQA 4UXHA 5CIQA 5HCNA 5B64A 3R9XA 1LNZA 2NMVA 1OJLA 4NYMR 2JLQA 1ZD8A 2QBYA 1YZLA 4KBGA 4LX0A 1DADA 2X8AA 1W7AA 1NLZA 5DHAA 4CGZA 2RKOA 3QY0A 4ZDIA 1W4RA 2W6JD 3EAQA 5CITA 4YXWD 5EJEA 1T8UA 1YRAA 2V8OA 3BFVA 4QBHA 3TQFA 5FTLA 3K9HA 3A1VA 1JR3A 1S3SA 5FOWA 1OH7A 2EVWX 1JR3D 2QP3A 2ZRFA 4QHTA 2EFEB 1GOTA 1PLJA 2WBLC 3TSOA 1E1RD 5FPSA 5ANRB 4M1OA 1OIXA 4Q1FA 4KI0A 4EPYA 1W46A 2ODWA 2GNOA 3B8HA 4IDOA 3AP2A 4NL4H 1G8YA 3HP1A 4DLWA 4PC6A 5H8WA 1P2SA 4K46A 3BB4A 4JS0A 2PLRA 5HPYB 3TJZA 3MGCA 2CVFA 2QI9C 4V0LA 1KI7A 3IGFA 2WKPA 2WSMA 3GQBA 2GKSA 2XZOA 1VCIA 2QE7D 2ZJAA 2QAGB 4FN5A 1CR2A 1IN6A 1TADA 3LAWA 1E2QA 1QBKC 2GRJA 1G3IA 1PUJA 4M9ZA 3G82C 1RRCA 2QMHA 1U90A 3P4XA 2V6IA 1QZXA 1Q57A 2O8CB 2BMEA 4HLUA 1FX0A 3HU3A 4DZZA 1KI6B 3RS3A 1EX6A 3K0CA 1X8JA 4NBSA 1Z28A 3A8TA 1I2DA 2QPAA 4LJ8A 3U44A 1N6PA 1SXJB 1NN3A 4PPQA 4DIEA 2RGDA 3GLFB 1W1WA 3TUIC 2E87A 3AVYA 1MOZA 2PT7A 3VX3A 4A82A 2DWPA 1JEDA 2ZUCA 4D26A 3R9WA 1RRFA 5CYOA 2O8FA 4DLVA 3V4RA 1GKIA 1AIPA 1OXUA 1YZGA 3NBYC 3MD0A 3BFKA 3WMGA 2UVQA 2OBMA 4C0KA 1Z22A 2UZIR 3UIEA 2L0XA 4FCVA 2WAYA 3WMEA 4HAYA 1QDEA 2GK6A 1XX6A 4M22A 3RS5A 2ZJBA 1CIPA 2F3RA 1CTQA 4LJ4A 4LV5B 5TARA 2GAAA 4JL5A 5EZ6B 4DSNA 1TQ6A 2J1LA 2VHTA 1ZJ6A 1SVIA 4XH9B 3EZ6A 3SE0A 4DLRA 5GVSA 1GSIA 5EP2A 4ARZA 3IHWA 2QAGA 3ADCA 3VU9A 4ITRC 3BE4A 2C03A 4A0GA 2ZS9A 3BH0A 3CLVA 1SKYE 3PXGA 4MGIR 5HKKD 2GESA 2VP9A 3GFOA 3MCAA 4R2HA 3OIYA 2IHBA 1II8A 4AYXA 1OXVA 3C5HA 1P73A 3IPYA 3H4MA 4B3CA 2QQ0A 1G8HA 3R9IA 2KB0A 3WNDA 3GJ6A 3GJ5A 4HZIA 4R2IA 4NCKA 1PJRA 5DISB 4BLTA 4MGKR 1X1RA 1RIFA 4KV9A 2D06A 4JLBA 4KAXA 5BN3A 8OHMA 2ODNA 3N5CA 1XP8A 4K81B 4Q66C 5DGXA 1SXJE 2UKDA 4B76A 4V02A 1DO0A 3PITA 4JVMA 4NH0A 1JAHA 1XMIA 4G5GA 3JZAA 1KJZA 4URYR 3A4MA 4Q9JA 5TVKA 1SXJD 1SVLA 1G8FA 2GJSA 3BRWD 4PZZA 3RABA 3IPXA 1GRQA 2D4HA 1NL3A 4TL7A 3CKLA 4BRWA 2FF7A 3WBJA 2QBYB 2H1LA 221PA 3AH8A 1QHIA 2WMNB 3UMFA 2QEQA 2J7KA 4POAA 6Q21A 5JHGB 2IHYA 4TMWA 3DM9B 5BYJA 1G3UA 2FN4A 3OIUA 4NMMA 2A9KA 3SJZA 1UDWA 1W36C 1A7JA 1E2NA 5BN4A 2IYXA 3ETLA 3O8DA 4ZIRA 4PANA 2CMKA 4CEHA 3B1WA 5FL3A 4DCVA 3T5DA 2NPFA 4GZMA 2OUKA 4IDQA 121PA 1SQ5A 4HYYA 5FUYA 3ZS8A 4Q4HB 3BK7A 3QPWA 3OAAA 3NXSA 3HPRA 3K09A 2REOA 4RD3A 3TW4A 1R0YA 5EE1A 3H0KA 2FWRA 3SHFA 2AN9A 4HZUA 4JBYA 1A5TA 3K9LA 4AG5A 2O8BA 3NEYA 1NLYA 4F4IA 3Q85A 1NY6A 4GOKA 4PXAA 2HF9A 1KI2A 2NO1A 4KXFB 2ZROA 2QA5A 3TNFA 2F55A 1HURA 3PUVA 1OB5A 2J41A 3OF5A 4QJ5A 4W9MC 3VHXA 5FBWB 3QXHA 4P33A 2OESA 2PCLA 3ZVMA 1X8KA 4HI0E 4EPVA 3MG9A 3EX7C 3W8NA 2IXFA 3I72A 4Q00A 1YHNA 3SJCA 3NDBB 3H2YA 2WTUA 2OO7A 4LBVA 4OJKA 1OFHA 3A37A 3FMOB 3RNLA 2I1QA 3A58B 3I32A 3SNHA 1G6OA 1SVMA 1N6RA 2ATVA 2R6AA 3W90A 1K8RA 1KK1A 1QG2A 2GCNA 2Y8EA 5FBQB 3VR6A 5JJIA 1NP6A 5BQ5A 4EPTA 1Q20A 4LHYA 1YR9A 4D4JA 3PQCA 1TF5A 2V4ZA 2PJRA 4BE7B 4B2IA 3BC1A 2ZVQX 5FPTA 4D0LB 5DI9A 2PL3A 2XTZA 3NG1A 4N3NA 5JWRA 2GA8A 2ZYWX 1R4AA 3Q7QA 3WHKA 3IQXA 2ZI4A 1Z47A 4IFEA 4TMVA 1KYIA 1VG1A 5B57C 1KI6A 3F3YA 3L0SA 5K8TA 1E79A 2W00A 1XNJA 4Q4AA 1W0JA 4RKFA 3K0AA 5CK4A 5E7MA 2GEDA 2IYLD 5EP3A 3GD7A 2CK3A 2IWHA 5SZHB 1KAOA 5EXTA 5EZ5A 3DZ8A 4M0LA 2V7QA 3B1ZA 2PX3A 3VU9B 3NWJA 2VF8A 1ZM3A 3GJ0A 5JCZA 2Q0HA 3CF6R 4QBIA 1XCPA 3THYB 4B73A 2REBA 4I1OA 5FR1A 5KDDA 2IT1A 1FL9A 2QMEA 3BGWA 1D8TA 2JLXA 3IIMA 4PSVA 4FMDF 2BKEA 5JJLA 4RKEA 1KO8A 4C2UA 3TGPA 2IC5A 4ZKDA 1TPZA 3P20A 1BKDR 4I99A 1XF9A 4GNKA 4DBLC 1AKYA 2IS1A 3N70A 3SQWA 4CEJB 1ZYUA 1EFRD 1DAFA 4JL8A 4MRRA 1P6XA 1KO1A 3RRYA 1Z2CA 4HB4A 1EFHA 2EYUA 2GEVA 2IYWA 3GEHA 3R7WA 3PENA 4ESVA 3GCGA 4RFVA 3KTAA 4AIIA 5BWMA 2PMKA 4RJLA 1YVDA 1IJFA 2WIAA 1WDTA 3KL4A 3AKDA 4TLDA 1F3OA 2KBEA 1RC8A 4MITA 3RS4A 4G1UC 1XTKA 3VR2A 1XJ0A 3ZIAD 4DLXA 1NJFA 4ZCIA 3X1WA 1M74A 3AP1A 3IUYA 1E2MA 1EWQA 4OI0A 5FBLB 3F0TA 3HDTA 5SZJA 4GRAA 4C0BA 5AJZA 4E09A 2ZANA 4II7A 2DFTA 3SYKA 4S35A 4GP7A 1NSTA 1XMSA 3EWSA 4KODA 3U4QB 2MMGA 2W2VA 1VCMA 2C5LA 2KJQA 2O8FB 2XSZD 3REFA 1UEIA 4IVRA 2AXPA 2FZLA 4HUTA 3RSOA 1UBEA 3SJBA 4LV8B 4CEIA 4R71A 2J9RA 3PEVA 5B58C 2QRNA 3HYRA 4QGFA 1E96A 4LOAA 1JECA 1Q0UA 4D81A 5KHOC 2V54A 3FHTA 3GMTA 5FOTA 1RPZA 3RS0A 1W48A 1E9CA 2QP4A 4H9GA 2KE5A 5JFGA 1QG4A 2O52A 2C2HA 4LY6A 4M1YA 4YC7A 3MWKA 3KQKA 2FGKA 5TDHA 5TV2A 1G291 3QXCA 1TF2A 5E4FA 2OLJA 1GL9B 1N6OA 4WZ6A 1DELA 4XWAA 4WZBE 2DFKB 3U3RA 2XJ4A 5FOXA 1GNRA 3QKUA 5FTKA 2OXRA 2EFDB 1CJTC 2HJGA 1LVGA 1FMLA 3QKSB 3AGQA 3EPLA 1S8FA 4Q03A 2Z0MA 2IUSA 2XX3A 3SHWA 4Q01A 1UEJA 2RGXA 4XTCS 1CS4C 1GILA 1M7HA 3AGPA 4BLQA 2UZ3A 4A1FA 3MJRA 2W6ID 5L3RA 5C46F 4JLVA 3OEHD 4UNQA 4F4CA 1E0JA 4PPFA 3FDIA 4BFXA 1A2KC 3Q5DA 4Z1MD 4GPTA 2BJWA 4LJ7A 1P75A 1NG1A 1U81A 1MO3A 3QKTA 3W6PA 2QQEA 1TEVA 2ZJOA 4JJZA 2B8TA 1YQTA 3FKQA 2C96A 1KSFX 4MUAA 2J0SA 3QJYA 2W0SA 1ELOA 4KJZA 1IN5A 4G5QA 2CCGA 3ZD6A 3EARA 2PEZA 4O0MA 3OFND 2RGNA 3EWAA 4LZZA 5KOYA 4EFLA 2YC2C 3X1ZA 2OAQ1 3BJIC 5AK0A 1KZ7B 4IVPA 4H1UA 4OYHA 2JLRA 5JJKA 4M21A 3DL0A 1SGWA 1OXSC 4MKGA 4HUQA 1IY2A 1VMAA 1B23P 4AYTA 5M04A 5HE8A 1Z8FA 2Z43A 4NP6A 4LBZA 2N46A 1M7BA 4MA4A 1XEWX 2GWHA 1G20E 4BGDA 4RFSA 2CJWB 1TF7A 4PQYA 3PEUA 3RSLA 4QRHA 4ZCLA 1XCMA 3ND9A 4PR0A 1IXRC 1KK3A 2QT0A 1P4SA 1QHNA 2C9OA 421PA 1XDBA 5J4LA 1XPUA 1NRJB 2O8DB 4B34A 2BCJQ 2J7PD 3ECCA 1UDXA 2JIZA 1GRRA 4I81A 1N0WA 4ILEA 3WNBA 1P2VA 2GDJA 1OB2A 1E9RA 3C14C 2EFHB 2WWWA 1NI3A 3IEUA 4L9WA 2A5DA 3D8BA 3QXSA 1JPNA 1XB2A 1Q44A 4OHZA 4AURA 2ZSDA 1GDDA 1P2TA 1X6VA 3IHLA 3B1YA 4CT5A 1RRGA 3T1QA 3K70D 1DARA 3X1XA 3GLHA 3KJHA 5JSZA 3FKSA 2OV2A 1M1YE 3ICEA 4X8LA 2V7QD 1HTWA 2GVZC 5AJWA 3SEAA 1OH5A 1D5CA 2G9NA 2DHRA 2BV3A 1RFLA 2D3WA 3O8BA 1UJ2A 1IN7A 3L82B 5F9FA 2ZRCA 2PX0A 4DRZA 2VHJA 4JLMA 2JJ2D 2NGRA 2RCNA 4FWIB 4HDOB 3LBIA 4A92A 3UATA 2HLDA 2GK7A 5EXSA 1RYFA 3BOSA 5CDFA 2IF2A 1MRSA 1TL7C 4EJSA 1MKYA 5C1BA 1A82A 1JPJA 3AKYA 1N0UA 3B60A 1E99A 3N2EA 4Z8XA 4MH0R 4E03A 3W5JA 1KHTA 4OQXA 2XNSA 5IK2A 1P62B 2IS6A 2FE4A 2QE7A 2GF0A 3LLMA 5H1YA 2ZQ5A 2REXB 1P9RA 2R6FA 4ZCMA 1BO6A 1VYUA 4TTQA 4PAQA 2G3YA 2ZRKA 2IK8A 3GEEA 4O2LA 1GG2A 4HLDA 2Z4SA 4LBYA 3ZH9B 3MMPA 1E2FA 5DO9A 3KFVA 1I4LD 2WSSA 2CLSA 3SDZA 1U8ZA 1GKYA 1B0UA 1NN0A 1NNEA 4LWZA 3RS2A 4F93B 5KSOA 3AP3A 3CZPA 2YNMA 2GCPA 5BYKA 4C0SA 4B32A 4XD7D 1F6BA 2EFGA 3GFPA 1D9XA 2FSHA 3MJHA 4PTLA 2Z6VA 4XD7A 4CRWB 4NYMQ 3AVUA 1KI9A 1MABB 3LXXA 3PUZA 4TLCA 2RHMA 1YR6A 4C0HA 2BOVA 2EQBA 4RD1A 3SOPA 3NEJA 4US1R 4TSFA 1E4YA 4AG6A 1V5WA 1P2UA 3CRQA 3TLXA 2ZITA 4HLQB 3T06B 4Q48A 3ZDQA 4Q4JB 3G0HA 3ZQJA 1NBMD 3AVPA 1J2JA 4QHYA 3NIBA 3O8CA 1NIJA 5J40A 4A0FA 1HQYE 3VX4A 2PT5A 3MWJA 2BCGY 3BB1A 4M2LA 1WF3A 2JJ2A 4TLEA 1ZCAA 4AKGA 4M1WA 1K6MA 4QNRA 3TW8B 5CB8A 3OESA 4TYNA 4BRUA 4D25A 1H8HD 2FMXA 4IXNA 2HXSA 1RE0A 1T5LA 1G5PA 1GNQA 3UWOA 4A36A 2ZRIA 3I8XA 2ORWA 3CF2A 3C5CA 1JBKA 2R65A 3CWZA 3RDPA 3CPJB 1NG9A 3M6AA 1DBSA 1R0XA 3KX2A 1HE8B 4HSEA 2ZE6A 3QPVA 1G18A 4EUNA 1L8QA 3GJ7A 3U7FB 3EPJA 1WCV1 4Q1EA 4A2QA 2OZEA 4CT4B 4HB0A 5D3QA 3I5YA 3B9PA 5JRZA 2X1VA 2EWVA 3RLFA 5JI3E 1XMJA 1XTSA 1YZTA 4EQ6B 4GI7A 3DDCA 2JLVA 4PSKA 3HU2A 2HJVA 3IIKA 5L3QA 2HXYA 2EU8A 1AN0A 2QPOA 2ZU0C 3CPHA 3T12A 3KUCA 4MKHA 2F6RA 3H86A 2H16A 3KKQA 4Y0VA 1U0HC 4ZI2A 5LDDC 3AB3A 1AK2A 2MSEB 1FQKA 2A78A 2EW1A 1R5BA 4PAOA 1IBRA 2BBOA 2V1UA 2P0EA 1S0UA 2XEXA 1KMQA 3PUXA 3KQLA 3QI2A 4KFUA 5GADl 1VG8A 2Q3MA 1OH6A 1CR0A 4FMBB 5L3SB 1F2UA 5DHFA 1EESA 3FPAA 2JEOA 3ASYA 4G5OA 1S1MA 4MQBA 4U00A 4EFNA 1OH8A 2NG1A 1M34E 2IYRA 1U98A 2WAXA 2AWNA 4EPRA 4RY2A 2PMDA 2RHDA 2ZSFA 4ASUD 1LF5A 3W3AA 1VECA 3DMDA 4FMDB 2GILA 1CP2A 4TMZA 3RRNA 4GP6A 4L9SA 4R98A 5CYPA 4WA7A 3ZZUA 4BEJA 3ZVNA 1WB9A 3TVTA 4CZ2A 2ZRDA 4GZLA 4GL2A 2OBLA 1U0LA 5L8VA 3AF4A 1KK2A 2Q3HA 1VYTA 3WMFA 3PFIA 1WXQA 1Z6TA 2HT1A 2ZJ2A 4UNSA 1KAGA 4XSHA 4FCTA 4TMXA 5DE3A 1KI4A 2FV8A 2VLIA 3CONA 2VBCA 3GLIB 5C4GB 3RAPR 4CEJA 5KO2A 3LX5A 2IYYA 1MO5A 3QXJA 4TL9A 1F2TB 2FEOA 1W0KA 2P6UA 3LXRA 5K8IA 3DM5A 2VO1A 1Z29A 1FNMA 2OSBA 1J8MF 5F98A 3F5FA 1K5GA 5EUMA 1TU4A 4DSUA 1KZGB 3VR4A 1N6KA 4DDWA 2QM7A 3ND8A 4J0QA 4KHZA 4Q47A 2LWIA 3CNOA 1G3RA 4KITB 3DKPA 1PZNA 1ZBDA 1FZQA 2P6NA 2R44A 4D2IA 4CYMA 4CEIB 2GBLA 1FPMA 4B35A 1G17A 4DDUA 1EK0A 2PJZA 1DAGA 1U0JA 1VHLA 2QAGC 2XGJA 1KDPA 2H8KA 2VPPA 4HB3A 3THWB 2J0UB 2QM8A 4U02A 4B74A 3E1SA 3RC8A 1KMHB 3TUJC 2NO9A 2RGGA 4JT4A 3LVRE 4L5BA 5C4MA 3THXA 1BOFA 1FTNA 2F1IA 2ZTSA 4Z8YA 3O47A 1R8SA 3X1YA 1KY2A 3K53A 1OLOA 3L43A 4PQFA 1CJMA 2WJYA 4IXMA 3EPHA 1R5NA 1NMXA 1DG3A 2FG5A 3ASZA 5EUQB 1JB1A 2D7CA 1D2EA 2WWHA 5A5GA 4HB2A 4M8NE 1N25A 4OI1A 4V0MA 2O0HA 2BHRA 2JJ8A 4Z1MA 2WWYA 4MGZR 1FP7A 1VIAA 1OSNA 2GAOA 2B7BA 3DMNA 1OT3A 3T34A 3CR8A 1SVKA 4P4SB 4TYWA 1CRQA 1VDZA 4GBMA 3U3KA 4DLSA 5AR1A 2X2EA 3U7GA 2OBNA 5FUXA 2FA9A 1KNXA 1ZU5A 2DPXA 2LCFA 1GRNA 2Q21A 3QKRA 3LNCA 4QFMA 4RZ2A 5P21A 3ZVLA 1E0SA 4Q5IA 1P60A 1KY3A 4ESHA 3PEWA 3VKHA 1XEFA 3SFVA 2ZS8A 3OHMA 4NONA 1XPOA 4QBFA 2GF9A 3QVUA 5JWOA 2QN6A 4BLPA 2ZR7A 1JR6A 3OZXA 2XTNA 3EA0A 3NTUA 4X8MA 1NJGA 1PUIA 4TSFD 4Q7JB 2FGJA 1XEWY 1JQJC 3FTQA 4YMWA 5AJVB 4B75A 2V1XA 4C7OA 1UAAA 2NOAA 4AI6A 2LKCA 3FFBA 1W2GA 3MUFA 1WA5A 3PJRA 4Q9KA 3U7HB 2IXGA 2ZYVX 1R8QA 2IEYA 2VEDA 1HEIA 1M2OB 3ZGXA 4I1SA 4Q1DA 1KDTA 2CL7X 1E2LA 2DFNA 2OCYC 1N6NA 2JLWA 3MWYW 2QGZA 3KKPA 2YZ2A 2ZE8A 4Z51A 4H1VA 2IWRA 4L4UA 2WSSD 4JLOA 2XZPA 3QXXA 4F38A 5FPKA 4UNRA 1FTSA 3TH5A 5HR5A 3SBEA 1ZNWA 4M1KA 2AK3A 1LB1B 3EXAA 1N5LA 2ZSAA 1JQLB 5FH9A 3VKGA 2BC9A 1NMZA 1Y3AA 3VQTA 4IOLA 1KI3A 1W2HA 3IEVA 1N6IA 4JYCA 4XVRA 2CL6X 4Q21A 2ONJA 3U3OA 2Z4RA 1HH4A 3CNLA 1Z0AA 4TQAA 2P5TB 1CEEA 4PPNA 4Q4JA 1E98A 3GLFA 2FZ4A 3I8SA 1ZC3A 1AA9A 3RHFA 5FR2A 5IT5A 2WOOA 1T3SA 1NN1A 3SJAA 2FFBA 4IOKA 1J90A 2V6JA 4PC1A 1KSJA 5CB6A 3HYTA 1YZNA 2IYUA 3KKOA 4IDPA 4QHSA 5CM8B 2HF8A 2GVDC 4C4PA 3LX8A 3S1AA 1Z0IA 4AKHA 2ZRLA 1OPXA 1H65A 3P32A 3EC2A 2GJ8A 1ZNXA 1VHTA 3FMFA 4A8JB 1OKKA 5LPNA 2DY1A 4ZDKA 1FX0B 2R6GA 4BASA 1TNDA 2QU8A 2IS2A 1DEKA 2WPDD 4B44A 2Z5FA 4LRWA 3WYFA 1DO2A 5DI3A 2NO6A 4RZ3A 1W4BA 2A5YB 3A1WA 4MDEA 1XFAA 4KFRA 4Y0AA 4XIGS 3BH7A 1N5KA 1M7GA 1KGDA 4JLJA 3TAUA 4L8GA 3E70C 2FPMA 1PLLA 4DDTA 3DHWC 1KTVA 4P0TA 3SU8A 1E32A 2ZSBA 1IONA 2XJ9A 3KKMA 4TLBA 1XZQA 5KPJA 1NSFA 1XEXB 2PLFA 4LHVA 3KZ1E 1E2IA 5JECA 4QM6A 1YU9A 2VYFA 1IXSB 3NVAA 2BBTA 4TWZA 5G41A 4AYWA 2ZUDA 4A4DA 1F5NA 3PG5A 1UBGA 2DCUA 4OK3A 3H84A 1OHHD 1JXOA 2I1VB 3AQ4A 2ATXA 3EC1A 4DB2A 1QHYA 3FVQA 1QHGA 4MKIA 5HCIA 4JZKA 1E2HA 3HWSA 3GLFE 4JLNA 1OYWA 2W58A 4HLUC 2VIIA 4TT3D 3LQRA 2CK3D 2OFWA 3E2IA 3FKSD 4PHHA 2RB4A 1EWRA 3KXKA 5D3MA 4BZPA 4B3GA 1NLFA 1IM2A 2VSOA 5B30A 2BKUA 3GJ4A 5KSYA 4RZXA 1OE0A 1HA3A 2BM0A 5JCPA 2GEUA 2C77A 4QOSA 2WM9B 3LO5A 4LDJA 2VHCA 3OFNA 4QJ4A 4QGAA 4K8OA 1Q21A 3QE0A 5LD2C 2Q3FA 3QEJA 2WZQA 4BFYA 5AJYA 3V00A 2C98A 3MAAC 4XWOA 3HJNA 3KDSE 4OKSA 3QG5A 4W5JA 1HQCA 1CR4A 2WPDA 4WIAA 4A9AA 1L4YA 1G7SA 2CEAA 3UANA 2RGCA 1T9HA 1W49A 3BWDD 4LYFA 1UBCA 5D3MB 1SKQA 5FUVA 1TTTA 2J45A 2QORA 4W7SA 2YOFA 5CK5A 1MRNA 5A4JA 3TSZA 2ZIAA 2H17A 2JA1A 2VH5R 2ZYTX 1Z6XA 2FSIA 3NKVA 4MGYR 2ORVA 5J5CA 4Q18A 3SZRA 3I3SR 1KKLA 1X1SA 4KSBA 2D2FA 3VR5A 2OT3B 4LJAA 2ZAOA 1MR3F 4NYIQ 1T91A 2GTPA 3SN6A 2JIZD 4E22A 1H8EA 4YDHB 4A6PA 3AVXA 2H18A 4JVNA 3A1UA 5CDFE 3DKVA 1T6NA 2VQSA 3TAHA 3QKRB 1IY0A 3GLHE 3U4QA 1E3MA 4V0ME 1CJKC 3M1IA 4PHGA 3QIAA 4BLRA 5DNYB 1W44A 1VKJA 3UMRA 4OQMA 4F92B 1C9KA 5JZVA 4YONB 2ZXUA 3L0PA 1E9EA 1HY3A 4CVNA 2R2AA 3PCRB 2ZJYA 1G5TA 5FTJA 4PHFA 1Z08A 4M1SA 2ZRJA 4DSTA 1JALA 1E1QA 4OQFA 2JDIA 2ANBA 2ERYA 2ZUBA 4Q4AB 2PCJA 3KXIA 4TYYA 2GXQA 3SS8A 4NZYA 3IQWA 4Q4LA 1XJQA 2O8EA 1C1YA 2GZAA 1W4CA 4A0HA 4TZ6A 2KBFA 1E9SA 2EWWA 1S4QA 5G40A 2IYTA 3QF4A 4X8OA 3WNCA 2OFXA 4AY2A 2H5EA 3A1TA 5J4VA 4LBWA 2AFIE 4U7DA 2XZLA 3TQCA 2XB4A 5IHPA 4EIWA 2GJKA 2XNDA 2YOHA 1LS1A 1N3BA 2MSCB 2ZJZA 4UJ5A 5IRCD 4BEBA 5E7IA 4NCNA 3WRXC 4MYTA 5A0FA 2C99A 5FFMA 3L0OA 3WP0A 3K09C 5L3QB 3CO5A 5JWHA 1AS3A 2G6BA 4AD8A 1W5TA 2D7DA 1J70A 4BQSA 2WJJA 4NDZA 1SHKA 1LW7A 2ZS7A 3NBFA 2J5XA 4OI2A 2JLUA 2Q9BA 4MRNA 3GPLA 2O0KA 1XEXA 2IUTA 4M9SA 3B85A 4IFBA 4AKEA 2ZI5A 5B2ZA 4NCHA 2GXUA 2HV8A 5JBQA 3Q72A 3ICQB 1DAMA 1DAEA 1ZM4A 1KI8A 3BERA 4NE2A 2CL0X 521PA 5G53C 1PLKA 1N2CE 1PV4A 1SHZA 4JMPA 3KQHA 2OCAA 2FPKA 4Q9HA 4P31A 1TMKA 2F9MA 2OHFA 3DOFA 2X77A 4JIMA 1OFIA 1DOAA 4DB4A 3PR1A 5LBIA 1R7RA 1DE0A 1XD8A 2QMUA 3NC0C 4WXPA 5FBRB 2VP5A 1S9HA 4GMDA 1V43A 2DWOA 4PQRA 3GLGE 4B2LA 5DLQC 1UKVY 3VFDA 1X3SA 3QG1A 1SULA 2XITA 3B1XA 5FPYA 1N6HA 3R8FA 2IS4A 1ZNZA 3AEZA 5JI2E 4GOJA 1SVOA 1XU4A 3KKNA 4BFZA 2WJGA 2DBYA 1E0KA 4DC9A 3QBTA 1K5DA 2R6DA 1DVRA 5IK2D 1T8TA 3QEOA 4ZDWA 4B47A 1ANKA 1G3MA 1YZUA 3VKWA 5JEEA 1U2RA 4DEXA 3X2SA 2CNWA 4NPHA 4PPGA 4D4KA 2IYVA 4XVUA 2RMKA 3A36A 2AFHE 1NVUQ 3K1JA 4C9BA 1W36B 3LH5A 1ZVQA 4A0RA 2W2XA 4JLDA 1Q1QA 4XTRA 1VIYA 2VF7A 2J7PA 1ZIPA 3PUYA 3FE2A 3EIEA 4IVQA 3DZDA 1FMJA 1FUUA 2WWGA 2B8WA 4LHXA 2V55B 4BFUA 1E9BA 3I73A 2D74A 1E2DA 1MO4A 1OHHA 2FX3A 4G3XA 2QENA 1E2GA 2CCKA 3TRFA 4D0GA 3OEEA 3B6EA 5EP1A 4GDFA 1O3YA 2R62A 1OXTA 5GJWC 4D0NA 2ZRMA 4WVFA 4QGHA 2O0JA 2CBZA 2DWQA 3KFXA 4CW7A 2IL1A 3SFZA 1OYYA 4IOJA 3KJGA 2CHVA 4YMUA 5SZIA 1E1QD 1GL7A 5TXGA 1QHXA 4XSGA 1E9AA 2PH1A 2WWIA 4KFSA 3FMPB 3LY5A 2KSQA 5GVRA 5KSPA 1E6CA 2GCOB 3N2IA 3NBXX 5EP4A 1CU1A 2LKDA 1T0HB 4IKEA 1BIFA 3CRMA 1XD2B 1GZSA 4Q7KA 2G1JA 4TYQA 3UMSA 3AF2A 3BXZA 5FI0B 4ABYA 4KVGA 4E5UA 2IUUA 1QF9A 1N5IA 3I92A 4OK5A 4MYUA 1FUKA 1Z5ZA 2JJ1D 2O5VA 4EQ6A 2XOKA 2ZREA 4URXR 1ODFA 4R9UC 3LQQA 5KNCA 4IRUB 1VCOA 5EQTA 2JLYA 4JKYA 2IYSA 3GLGB 1XXHA 2VP0A 2NQ2C 1R10A 4V0NA 5TB5A 3CRW1 2KWIA 2A5FA 3MRSA 1DAKA 4EDHA 3TKLA 2ZR9A 3RS7A 4E07A 4KVAA 2NPIA 4LYAA 2RGBA 1YE8A 3K70C 4P32A 2FSGA 2AD5A 2Z83A 1Z0JA 3GJXC 1M6NA 1IN8A 2BEKA 3AVQA 3U2QA 1KSGA 1L2TA 4C2TA 4F7WA 1PVOA 3B7GA 4ON9A 5EE3A 4TLAA 1Z3IX 3MLEA 3CW2A 2BEJA 2HDNB 1AJEA 3NDPA 5CLQA 2FFHA 2JASA 1Z07A 621PA 1XTIA 2ZRNA 4AKIA 1GM5A 1XXHB 4NHOA 4NYJQ 4MRSA 3CH4B 1TUEA 3U44B 3VNVA 2H57A 2FOLA 2PBRA 2VTKA 1AS0A 4QL3A 3WP1B 3PUWA 4ARZB 2HT6A 2Q9AA 3LD9A 3VMFA 4A6XA 1VPLA 4I1UA 4BPBA 2BBSA 4UXJA 3AUXA 5AWFC 4PC7A 5FUWA 2FDCA 2JDID 1RKBA 2J87A 1FNNA 2YYZA 2ZJ8A 3WYGA 3U5ZB 1A4RA 4IOMA 4B3DA 4LJ5A 4O2RA 4RZUA 2QY9A 3EIQA 3RWMB 5F9HA 1L7VC 3Q7PA 2QGNA 2C95A 4ZPXA 4QKQA 1Q12A 1KSHA 4Q9IA 3TK1A 3NHAA 3B1VA 2R8RA 3QVVA 3ZYCA 3UXMA 4C0LA 1S1CA 4TTRA 1W4AA 1H8HA 2OCPA 2VHQA 4G01B 4B48A 2XOKD 4DIDA 2FJUA 1T4GA 1KNQA 2ZPTX 1F2TA 2A5JA 1EGAA 3B9QA 3A1SA 1Z6YA 1ZMXA 4LPKA 1II8B 3UKDA 3AVOA 5HKKA 1N5JA 1E94E 3GJ3A 1YR7A 2CXXA 3D3QA 3QQ5A 3AKCA 3JZMA 1DPFA 2VRWA 1TX4B 4PO9A 4PC3A 3VR3A 3EW9A 1IXZA 4P4UA 2ODBA 4Z54A 4JLKA 3U60B 3ADDA 1ZM7A 2ORIA 1G21E 1UFQA 3GLHB 5JSZB 3AM1A 2QUZA 4RFSB 2A3RA 2PZGA 1G8PA 2HUPA 3T1VA 4DSOA 2XXAB 2WV9A 1G4AE 4OHVA 4RCZA 4EPWA 1ESMA 3KQUA 3VR1A 1P9NA 1T3LA 1TU3A 2YWFA 1XJCA 2WJIA 4ACBA 4UQOA 3VTKA 2OEPA 3SR0A 3OEED 2VP6A 4RD2A 2ZRBA 3CUEF 2AWOA 4ERNA 4IEIA 1KIMA 4DHEA 3THXB 2RGNC 2HYIC 3SI7A 1KI1A 1YKSA 5G3ZA 1C4OA 1G41A 2JATA 2FU5C 3KB2A 1E2PA 2RH5A 2N1BA 3MSXA 4L15A 5DN6A 3D6TB 5KNDA 2CCJA 1OIVA 4IDHA 3GJ8A 4UNNA 4A2PA 4D4MA 3BD9A 4BFSA 4C0AC 1AS2A 1WBDA 3W34A 4RSGA 4OBEA 4GSYA 4QM7A 4PSAA 2QT1A 3GFTA 3L8YA 1XPRA 1T0JB 3QENA 4R7ZA 5LD2B 2F1RA 1Z63A 1UKZA 4YLGA 4OQNA 2B92A 3DEFA 1YR8A 1RZ3A 4DVGA 5EXXA 2ZI9A 2WKRA 2WVJA 4HAVA 2ZEJA 1OFUX 2GHIA 3KJEA 1NN5A 1KDOA 2HEIA 1P61B 4DUGD 3T5GA 5KSZA 2YHSA 4GT1A 2XB2A 1Q1ZA 1IHUA 2G0TA 2J0UA 2G88A 2I3BA 1GWNA 4RD6A 3Q9LA 4FINA 3R8CA 2XTMA 3CIOA 2VA8A 2DB3A 3PIRA 2G77B 3TR0A 2NO7A 3V9PA 2BBWA 1BS1A 3TIFA 4L16A 3C7KA 3VNUA 2WICA 4UJ3A 5KDLA 1E0AA 2WIBA 3CM0A 5CJPA 3ZLJA 1S9DA 1ZD1A 3U61B 5ELXA 3IO5A 3A6PC 2FFAA 2QTFA 4IHQA 4TL6A 2GJ9A 1VG0B 1G19A 5DIFA 4WOPA 1ZUHA 3W9YA 5EE0A 1R5OA 2A2ZA 2QP9X 5L3VA 1CBUA 3IIJA 1ZCBA 1UBFA 2OAP1 1G7CA 1ZD9A 3VHLB 5DYGA 3WY9A 4Q7MB 2K5UA 1JJ7A 4DJTA 2G0NA 1OF1A 1Q3HA 1CLUA 1G64A 4ACAA 5E7JA 1Q22A 2KI5A 3C8UA 1LV7A 2A7QA 1G3QA 2IYZA 4JBXA 1JJVA 3IO3A 1H8ED 2CE2X 3P1JA 4M9QA 1SZPA 1RRPA 1TQDA 3C41J 2JJ1A 2OILA 3P26A 1Z0FA 2W6IA 5AUPB 1J99A 3OEHA 2FPLA 4A2WA 4MRPA 5K8UA 5UKDA 3WBKA 1KJWA 2V3CC 3EIHA 1HE1C 3BORA 3FWYA 3EPKA 5FTMA 1GKUB 4B6EA 2AL7A 1E2KA 4ZKEA 2QL6A 3K0AB 4NU0A 4DUGA 2SHKA 2D62A 5FOVA 1R2QA 3GLIE 2F43B 1NBMA 2GCOA 4JL6A 1QHHB 4DCTA 2W83A 4TTPA 1SXJC 4BFTA 3EZ2A 3CB4A 2NZ8A 4G5RA 1I4TD 4PFSA 1QHSA 1XRJA 1KKMA 1MABA 2D2EA 2FNAA 1UADA 2RGAA 4OK6A 4O3MA 5TMPA 2HCJB 2QAJA 3P4YA 3U7EB 1TUIA 3W8RA 3RVBA 4TL8A 1GL6A 1D9ZA 1YJ5A 3DO6A 3W6OA 2CJWA 2ZVPX 3LW7A 5C2JB 1EFRA 1WE2A 5FTNA 5IF9A 3QBVA 2Q9CA 4PO1A 2DFLA 3CF0A 3JVVA 1TQ4A 1W36D 3OAAD 1GUAA 2CLDX 5DN6D 4PC2A 4HAWA 4AWXA 2F1JA 1E9DA 4N0EA 3T15A 4HUQB 1CKEA 2YJTD 1NBME 2ONKA 3RC3A 4B3BA 4JKIA 4PZLA 4Q1BA 3M0EA 1ZUNB 2RGEA 1ONBA 3U6KA 2A30A 4URUR 5KU1A 1EXMA 4KO8A 4DKXA 2NIPA 1IN4A 1Q1EA 4JSYA 3QNUA 4WAUA 1LTQA 2N42A 1BYUA 4BZXA 3WHLA 5CIWA 4Q1AA 3EASA 1LS6A 4DEYA 1G6HA 4DCUA 5H70A 1MO6A 5TY0A 2HYDA 4F4JA 1NKTA 1CXZA 2F7SA 4M1MA 2BJVA 4P3YA 4URZR 4KYUA 3RANA 3WXMA 1R6BX 1XBTA 5JRJA 2W6JA 2P67A 4GOXA 4DT1B 1Z83A 4UXIA 4BLOA 1NIPA 3LV8A 3T1OA 2CLCX 3CZQA 4BWYA 4WBSA 3H1TA 2ZSEA 3B5JA 4DDVA 1EFUA 2IEZA 4IJMA 3FHOA 1GIAA 2ZI7A 4JVLA 3LLUA 3NH6A 3OE7A 3CNNA 2ZAMA 1DS6A 4FD2A 4OL0A 1E2JA 1E2EA 1ETUA 4LJ9A 1JXMA 4OI4A 5AJXA 3B2EA 2J0QA 1X8LA 1VTKA 3T61A 4MDFA 4RD0A 2AX4A 5KTYA 4XOIA 2C9YA 3Q3JB 2BDTA 1UM8A 2J3EA 1XCGB 3KUDA 1US8A 2ZYUX 4CDGA 3I5XA 3KB1A 3C16C 1O87A 2AXNA 1N0VC 4B3FX 3ZJYA 1GTVA 2ANCA 4S2EA 1I2MA 1NMYA 4LSGA 3CR7A 3WYAA 2HCBA 2CHQA 2J59A 1ZINA 2YVUA 2W2TA 4MYCA 2QMOA 4TN1A 3LRPA 1HT2E 3ZIAA 2X19A 1S2MA 1D2NA 1N6LA 3LVQE 2B7CA 5HTKA 4HAUA 4XWKA 1G7TA 1HT1E 3BIFA 2W0MA 3NHBA 4P4TA 4C30A 4FIDA 2OCBA 3T35A 2P3SA 4A15A 5BXQC 4LYJA 3CH5A 1A1VA 4ZIRB 1NVXQ 1KMHA 3Q8XB 5FL7A 3CWQA 1ZNYA 2JLSA 3IKJA 4YXWA 4Q7LA 3Q5EA 1AM4D 2H7VA 4HAXA 1ZP6A 4XJXA 3J81k 4PX9A 2FH5B 1G9XA 3GLIA 2C04A 4US0R 3U6BA 4U5XA 3UWKA 2F1HA 1Z6AA 2MMCA 2O8EB 5AUQA 5KNBA 1II0A 1IY1A 2BIFA 3PEYA 2R9VA 1EX7A 4JVSB 3ADKA 4P4SA 1DTSA 2QPTA 1Z2AA 1P72A 4NKRA 2YC4C 4W5HA 5J4KA 3AVTA 3TUZC 2NTYC 1OKKD 4N0DA 1TEXA 1GAJA 3TMKA 1KJYA 3FGNA 1Z0KA 4KYIB 1R0ZA 1E79D 2C8VA 3DPUA 2V9PA 2BMDA 3ZQ6A 3KQNA 3AV0B 1KO4A 4C3ZA 2WWXA 1F2UB 1JR3E 5LB4A 1AZSC 2A5GA 2BMFA 2ZRHA 1II9A 3LW8A 2CDNA 3TE6A 4JLAA 2CHGA 3VAAA 1WBBA 1RJ9A 2IYQA 2NO0A 3RRMA 1P5ZB 1D2MA 5BN5A 4QNMA 1NVWQ 4B3XA 3AVVA 1CJUC 4QG7A 2AKYA 1G8GA 1YRBA 4BLSA 2QSYA 4BECA 3S1AB 2YWEA 3AKEA 1E9FA
chains in the Genus database with same CATH superfamily
3ETGA 3S1SA 2EZTA 2BWJA 1PFQA 3T0FA 3A0RB 1W1IA 3UZUA 2XEDA 4LGMA 4N5NA 1ZU4A 2C5AA 3NT4A 3UXEA 1E2BA 2XQIA 2BFDA 2J9XB 3B6JA 3WLEA 2F48A 1T36B 3PDIA 3SKVA 2I91A 4A8TA 5J4YA 5KNDD 3FMGA 2ODTX 2OXCA 1RYHA 2XYHA 2YZMA 2ZRGA 5DX8A 4CF7A 1XZHA 1ZOSA 3NWOA 1K75A 4BE9A 1OBOA 4I1PA 1XZKA 2ZRAA 1PJQA 3H8JA 4LYHA 4YMSA 5I6DA 4EABA 1PGPA 1XD9A 3GNTA 1UKYA 3FMIA 3CBQA 2AEJA 5FAKA 4ZAGA 3K0SA 2XUGA 2A0YA 4EYQA 4JYBA 5LQJA 3QSYA 4NDAA 4RHEA 1WP9A 1K6XA 3G6WA 3EFEA 3OIWA 1IMOA 2CFTA 2YKGA 2H85A 2GZ3A 1P6UA 3OF3A 1GFIA 4FILA 3IBYA 5IWCA 5TE9A 4D5EA 2FN8A 1P19A 2ZJ4A 4M1EA 4MYSA 1EI9A 2PT9A 2QTHA 3Q11A 4R3NA 1XXHE 1JI0A 4NTZA 5AM3A 4RBNA 1VRWA 4M1TA 1LBSA 2PRKA 5J47A 5DCYA 5LCXA 3UAWA 1EFTA 2G4CA 2FSFA 4PG8A 4AJPA 1DKLA 5FQOA 1ZM9A 3M49A 3PS9A 2GJAA 2RGUA 3EA5A 3GGOA 4K2HA 4YJ2F 5KTPA 5A7FA 1G9SA 2H6EA 2FWIA 4QG3A 1QIFA 721PA 5CJJA 1GGFA 1KYZA 3EAGA 4QBGB 4BUJA 2VATA 5EJMA 1TK3A 3AF5A 2SKEA 3LA8A 4QQNA 4EATA 3CX3A 3Q7SA 2C2ZA 3BAFA 3OE4A 1J8YF 1ZJJA 2V6BA 4HDRA 4FDTA 2H1CA 3OETA 4BQPA 3H11B 4RV4A 1KQGA 4AM8A 1IQUA 1QF7A 1Z4NA 3N2YA 5JDCC 1HZJA 1E7RA 1G5IA 1X39A 2DQ4A 2XCTB 1W0KD 3G13A 4H6WA 1ZVMA 2ZM5A 2I0FA 3ZV6A 4N5MA 3MUOA 3OZTA 4RVCA 1Y34E 1O94D 3HPQA 5FT9A 2GF2A 1USUA 1RLTA 2I2AA 1FF9A 2I4IA 3C4JA 1WU8A 2P9FA 1YZVA 1PQ4A 3CEAA 5K6TA 1JFFA 1PTJA 4F11A 4IG4A 4TYPA 4YRZA 4KR2A 2JLZA 2G5PA 4YROA 1JDTA 4D4LA 3GCXA 2IXEA 5C31A 4D4HA 3D7MA 1ZFNA 5SYMA 1IRIA 3UWMA 2DR2A 3BH6A 4QEKA 4CMEC 2NNWB 3TDMA 2HO5A 1A2BA 1FTQA 1JQDA 2COKA 1KP2A 2IDMA 3IPAA 3LJKA 1IPFA 1K3FA 3PNOA 1DSSG 1VMKA 1VFNA 3QWBA 4LNUA 4HLNA 5BQFA 5JANA 4EHAA 1QVRA 3HMKA 4LSWA 4G0WA 2IHVA 3R1IA 1JG4A 1N9GA 4ENWA 1JEAA 3PE6A 4HEA6 5ENZA 1FNBA 2IE8A 1CUCA 4M7WA 3W78A 5HZHA 4EY5A 2I99A 5HRAA 3N76A 1BFDA 3BS4A 1COWD 3PPYA 1E2UA 1KH1A 2AA3A 2O1WA 5DTRA 3DYVA 3RFCA 4QPDA 3ZQKA 1HLGA 2V7GA 4G9GA 4M53A 2D0OB 4IHJA 4RPGA 4J03A 1OXXK 1XWIA 4X0EA 4AF6A 4O4HB 4UUBA 3K71B 5I3ZA 4JBWA 2VAPA 3A10A 3F5QA 4YTEA 5JHHB 4DQ0A 2H63A 4WOJA 2P3QA 5FOSA 1DJPA 5A4IS 3T7JA 2P9QA 4Q02A 5HF9A 4DJFC 1LFDB 3JASB 4IJQA 3ZHCA 3WXBA 4OKIA 1AB5A 3DO8A 5EIAA 4W1SA 2Q6VA 2PKQP 2ZSKA 1A5SB 1A2QA 1NY5A 4YRKA 4U9UA 2IW3A 5F5XA 3ETHA 3W9UA 3D5TA 2JGNA 3I9V6 4A8JC 1KOFA 2ZQZA 3C39A 2JGDB 1ZUIA 1WB5A 3JYQA 3R75A 5JDIC 3LUGA 4GR9A 4LC1A 3V33A 4EFMA 1N5DA 2ZGVA 1FW6A 2AW3A 3UHOA 4BFVA 7REQA 1Y48E 1XK7A 3VNSA 3IOMA 3RVPA 5ALOA 3CTPA 2AKAB 2ZCUA 1VBMA 3SJ7A 3PFHA 1G20A 1AZTA 1AXRA 5IKMA 5DM2A 4QE3A 2R6CA 2QIOA 2GUGA 3DJYA 3NASA 3WLKX 1VSUA 3I9FA 1R0LA 3E58A 3NHPA 2DCMA 4GHWA 3TOCA 3ZK8A 3FYTA 1FSZA 1ZGZA 3EEQA 3MS4A 3WL3A 4N0PA 3ZY5A 3G0IA 2WJVA 1SWVA 4YMTA 1R15A 1FLNA 1N7HA 1K9VF 3NOXA 3QY9A 1RXUA 4Q39A 2IHJA 4XJSA 2O19A 4ETMA 1X14A 4FLEA 4U63A 4IS2A 5E2IA 1FQJA 1N5OX 2ZTVA 4RE6A 3LGAA 2WD8A 1CF4A 2WYVA 3L5KA 4HAZA 4DPKA 2GN4A 2OV8A 2WIKA 4LPSA 3FTEA 1JEEA 3FRHA 1Z4OA 3NTQA 4ZVNA 3JQ8A 3LRTA 1SR8A 1EP1B 1WQ1R 2OFOA 4ERXA 3LC7O 2I65A 3L0IB 3NKFA 3KSUA 1KYXA 3ZU6A 1COWA 1S96A 5LR6A 3DTNA 4N39A 5F3DA 3CRRA 1P9LA 1J0BA 1FDOA 1GZ6A 2PMFA 3OJCA 1OIWA 4BMNA 3EDOA 1W0JD 3E8XA 2PZKA 2H11A 4AUMA 1ECGA 3DLAA 1VCNA 2POCA 3FKJA 2PRJA 2Z2IA 5JISA 5K7SA 2UXCB 1ORRA 2GZHA 1A8HA 3MT0A 3NALA 5HE9A 1H4SA 3KEOA 3IQGX 5B5SA 3QEMB 1SK8A 3A4LA 4MVCA 2VAXA 4BFWA 1EM8B 1BW9A 4QC2A 1XQYA 1P3JA 2CLOB 4ZAYA 3WE7A 1VSTA 4YR9A 4TWAA 1IQPA 2QM0A 3ZS9A 3SLKA 3SZOA 5B4UA 1JHDA 5CYGA 3F73A 5G3YA 3TVDA 3GHYA 2QD2A 4DJEC 1XTZA 4QXAA 5A5VA 5LWHA 5K8LA 1LKZA 1U9JA 5TJ9A 2UUOA 3T7TA 2GBLC 1OAOC 2QROA 3D5EA 1G60A 2QJFA 4OHYA 2HCRA 1FEZA 1PK8A 5ADUS 4M9UA 5ELXA 4HPWA 2OD7A 5E1BA 1IWPB 4B7AA 2DXIA 3QYJA 3FTNA 2ENWA 2YIDA 2NZ2A 4NJOA 2O5CA 3AXTA 3KYDB 3L8GA 1Z2PX 3ZDYB 2VUHB 3QVOA 1UBRS 5DH9A 3P9XA 3IPRA 5L6MB 4N7RA 4F12A 3C6KA 3MVEA 1YDMA 2MYPA 3AEXA 1SB9A 3OMXA 4HATA 4EF6A 5C4IA 5AIBA 1DRUA 4KEAA 1HV8A 3HBNA 4GSKA 5F2EA 1W0CA 4OQLA 4U1RA 4JJKA 1NMQA 4JJFA 3H4VA 2J46A 3NKLA 3VUEA 5L6LB 2J09A 1J7JA 1NVMB 2E5WA 2VL7A 2WMOB 1JLSA 4KLZA 2BE9A 3SYNA 4AJOA 2CF5A 3OJ0A 3NCTA 5HSGA 2J6CA 1RP1A 4B33A 2C9DA 4O25A 1UCFA 4S1WA 1L5WA 3QHQA 4DGQA 2QG6A 2DTXA 3LFHA 3C3MA 3EXEA 1QDLB 3N28A 3G5UA 2MR6A 4KSCA 4EARA 4MV7A 3CS3A 3KTOA 3LDAA 1A71A 5FL7D 5EIHA 3K0CC 3DF7A 3ZE1B 1VYVA 4ZI3A 4DS3A 1FLAA 4EGFA 1DXYA 2UXBB 2C2OA 4C0QC 5FI1B 4HDQB 1ISIA 3F6SA 5TF4A 1L7EA 2QZJA 1T5IA 1H4TA 3ZZNA 4PHTA 4RKYA 3CLUC 1F2DA 1NX9A 3I4LA 1F60A 2H4FA 5JLJA 3W3ZB 4ZMRA 2O59A 3IV6A 4IDAA 2GYWA 2IX3A 1T5HX 3NORA 4HDMB 2FFQA 3L1IA 1FUIA 3IMGA 4AN1A 1Y3HA 5JSYA 1J2UA 3DOEA 2VDLB 4EJSB 4XX0B 2QS9A 1U1CA 5J4HA 3CXRA 1EE9A 2HLDD 3IUPA 3KELA 3LM8A 4IUDS 1XJ5A 2JJYA 2BGTA 2PMCA 4Q3AA 2O06A 4MV6A 1MG5A 1L5VA 2QSJA 3FF1A 3Q10A 4R2MA 4WXRA 3QP9A 3K2QA 4X41A 1JDJA 3SC4A 1U3DA 1L7RA 4UAGA 2YN4A 2P11A 3IV9A 1B42A 2PL9A 2XH8A 3B13B 4I1VA 2Y68A 4HO1X 2NZJA 2VJKA 5ETJA 1DAIA 4Q16A 3L4KA 1UAGA 3KT8A 4RD4A 1FZTA 2C82A 1T43A 1F0KA 3GQBB 4W1QA 2FXIA 1PO7A 3EXHA 4PLYA 4TS3A 2GHQA 3CCFA 3H87A 4N8SA 4YMVA 4JLUA 3RT9A 2ZI3A 3PL5A 4IV8A 4FVTA 5C8ZA 4WLEA 5FEUA 5BY2A 5C7IO 1QHHA 2VSXA 2FUEA 3QOFA 4PZYA 4ES6A 3EZ9A 1WSWA 3OT1B 5ALSA 1YQQA 4Q3LA 1OROA 3HLYA 2OLKA 1HUQA 4JOCA 5CIQA 5IX8A 5B64A 2NMVA 3WSTA 5DYNA 1QU3A 4UW9A 4FR2A 4BNGA 1YZLA 4C4TA 3W8DA 1CFZA 1JFRA 1NLZA 4B17A 1QRSA 3OE5A 1M8KA 4MO9A 4ZDIA 4UCWA 5IUJC 1V35A 1EBUA 4C4AA 4V2UA 1RWOA 3HNRA 5IEBA 3EAFA 4LOHA 3BTUA 3CN9A 3JPYA 1PYDA 3K9HA 1JR3A 2VHYA 3OCXA 4GP9A 1JR3D 2ZRFA 3MJFA 4QHTA 3ZEAA 3DEHA 2FUCA 5C7OO 3S29A 2OO5C 1C0IA 1E1RD 3TSOA 5AJUA 4G07A 3GDFA 3FPGA 1X74A 4M1OA 2A14A 4XX0A 2DFPA 5ANRB 1ZUWA 4KI0A 1WPGA 3HADA 4S1PA 4DDKA 1IATA 2ODWA 3V5NA 4KO3S 4DREA 1ZRSA 1YI8A 3STYA 4PC6A 5ALIA 3TOVA 1DKPA 2PZMA 3BB4A 3IBTA 2WZDA 3SHQA 3NU1A 2AG6A 2PLRA 5K3BA 3TJZA 4LNAA 1WPXA 4ML3A 2QI9C 3OD1A 3VV3A 3IGFA 5C3UA 1QIEA 5L7WA 5JS6A 1LV8A 1HO3A 1R18A 1VCIA 2YQ5A 1IN6A 1PI3A 1V8OA 3EH1A 3LAWA 4KGDA 1ZGCA 4OBBA 3O94A 1Z17A 3FPCA 1DU4A 4KK4A 3UQYS 4C4SA 1Q7GA 3VHRA 1U90A 1I1NA 1UJCA 3P4XA 1RCUA 1NVEA 2AEFA 1RP7A 1DWUA 3W4KA 3NBKA 1PSZA 4CG3A 4NNJA 3CCBA 3HU3A 1E3SA 1BE1A 1NXTA 3OKFA 2IOFK 1ECLA 4OGKA 5K0JA 1ZOLA 3A8TA 1DAOA 1Y4DE 3AESB 4B6GA 4MV0A 1P4GA 1SXJB 4JMLA 1NN3A 1YU6A 2YVLA 3NHKA 2P7HA 4BQNA 3AVYA 2WDZA 2PT7A 3ET4A 1UODA 2H7XA 2YJ3A 4N0QA 1D09A 1B41A 2ZUCA 2CUZA 4LVUA 4DA8A 1RRFA 4O4JA 4JBNA 2DUJA 3GVIA 3A1NA 2O3QA 2OK8A 4Q6WA 5LYJA 3WGNA 3R3HA 1GKIA 5CCBA 4UHJA 1QE0A 1X1EA 3PD0A 4C3OB 4RULA 1DIAA 3MD0A 1OX4B 5LQRA 2WF7A 5HA5A 2UVQA 4KPYA 4UBLA 1SBTA 4KG7A 3CINA 3DDHA 4TV8A 1E1DA 4NBUA 3OQMA 1WO8A 4FCVA 2WAYA 4ENUA 4NCXA 5LXTB 1QDEA 4M22A 4H7DA 2ZJBA 3JVDA 5KNLA 1SC3A 1Z13A 3L1KA 3HUEA 4LV5B 4DIMA 4GS5A 1VC2A 3KXPA 1JW9B 3NM4A 4D92A 2FMIA 1E7MA 3NZEA 1RMTA 3FTCA 5GVSA 2ATCA 2XBMA 3FUUA 3RAFC 5BOVA 5E8RA 4X20B 4OFXA 3IMCA 3BE4A 3NP7A 4A0GA 5BXYA 1VIMA 2A94A 2CVPA 4LISA 3EULA 3IJ5A 5HKKD 1P81A 3PUJA 2V4UA 5L3ZA 3UB3A 5SY4A 3ON5A 3WL4A 1F1BA 1N75A 4DWWA 4DMRA 5DHSA 1L4KA 2QN2A 3GNSA 1GPBA 3W7AA 4B3CA 4OH7A 3H4MA 1NATA 4YJ3A 2TS1A 3WNDA 4NMXB 2VQ6A 4MYRA 4P98A 3SF8B 4X45A 4XUDA 4MCJA 1RIFA 1D1TA 2O6LA 3SSMA 3G9QA 4JLBA 4KAXA 4R81A 1JAYA 5JAIA 3WG9A 3ZBTA 3IP3A 8OHMA 4XEUA 4D3DA 2RJNA 1XP8A 1SMKA 2IPXA 4IDGA 4K81B 1SXJE 4V02A 1QP0A 3PITA 2B1QA 4G26A 1XMIA 4G5GA 4URYR 1KJZA 2K87A 1V7QA 2X9GA 1LEHA 5F78A 1X70A 4LNHA 5HMLA 3RU3A 5AW3A 3HCFA 5ALRA 4TL7A 3AXSA 5DCWA 2I4RA 3CKLA 5PNTA 4DCPA 2FF7A 4QOGA 1I51A 9LDTA 2IP2A 2VSQA 3AH8A 5AW8A 1DB3A 2BYTA 2WF8A 2QEQA 4IY1A 4D46A 4POAA 1WS6A 3FLMA 2GZ2A 4DMLA 3A6HA 1C3EA 4QSMA 4KIFA 1M6VB 4NMMA 5IDWA 2TMYA 2VT6A 3HA7A 5DM60 2A9KA 3SJZA 1UDWA 1W36C 2PTGA 4KWTA 3SHVA 2IYXA 4Q7EA 1HXHA 4CN9A 4CQMB 3QFTA 4X3PA 1MC5A 4AX4A 3Q7IA 3F1LA 4PANA 2CMKA 4OCZA 3N6XA 3B1WA 1QB8A 4MP6A 4BBZA 4GZMA 3JAWB 4WLVA 2CT8A 3OM9A 4KXMA 3ZWOA 2R5FA 3TRJA 1GJRA 4HYYA 2JCGA 4MVJP 2V5AA 4XIJA 4ABTA 1LBHA 4EA7A 1RQGA 2OGTA 3NYQA 2IOFA 4UMDA 3HGMA 3OAAA 4BN4A 5KNCD 3PPXA 3BKXA 4RD3A 4YCBA 5JAQA 2HK6A 3D64A 3O8LA 3OQPA 1QX3A 3SHFA 4KR6A 2J6IA 4JBYA 4X7MA 2ATIA 5ITWA 4YUVA 1OUMA 1P29A 2MYNA 4AG5A 4BNMA 3NEYA 4ZU1X 1NLYA 4F4IA 5LLSA 1PT7A 1OXKB 3Q85A 1NY6A 4GOKA 4PXAA 3X1KA 1CUFA 3GAMA 2NO1A 1X94A 5EQJB 2QA5A 5DSTA 2H0RA 1IUOA 5LLDA 2ZIGA 3A6ZA 3VHXA 5FBWB 3QXHA 4KRYA 4YIKA 2PCLA 1TM3E 3ZVMA 2A9FA 1IBCA 2V7WA 3LRXA 2UVPA 5BMOA 3U1VA 1BKYA 4E30A 3LQYA 2PIAA 2WFAA 3I72A 3T3DA 4OREX 3AEQA 4IXWA 2WTUA 2OO7A 1YV9A 3K96A 4IQ8A 3NJ8A 4GXTA 4LBVA 3OTIA 2Y1DA 1V8PA 3FMOB 3OIGA 3OWXA 3QLJA 3HJCA 3RNLA 3ZNOA 4BNHA 1IHYA 2NM0A 4WD3A 1G6OA 2G9VA 3ELYA 3SZ3A 4RE5A 1NM5A 5KCZA 5HWSA 2J9FA 2RJ3A 4XUEA 1EUZA 1QO0A 2R6AA 1BSVA 4P34A 3NHSA 3BQNB 1KK1A 3C3PA 3M4NA 3SEQA 2YASA 5AW1A 1U31A 4I0WB 4QFBA 5BQ5A 4LHYA 2JI4A 3CNBA 4QASA 4UDOA 3L49A 3JQ9C 3PQCA 2PJRA 1RS0A 1X1DA 5BV2P 3ELWA 3BC1A 5GM2A 2XE8A 3DGFC 2PX6A 4O4JF 5FPTA 1EFPA 4M8IA 5DI9A 4EW2A 2XTZA 3NG1A 4ZA2A 4CTKA 5KYUA 5T6MA 1R4AA 3KQTA 3OTQA 3WHKA 1M2EA 1I8TA 2ZI4A 4IFEA 1M2VA 6REQB 1KYIA 5IDQA 1SOWA 1K5PA 1VG1A 3ZHQA 3F3YA 5B57C 5JASA 4AY5A 1DWPA 2MINA 6YASA 2PJDA 5H82A 3CIFA 3V2UA 1W0JA 2GEJA 3TECE 1N3IA 5ALLA 1CZNA 3BYZA 1H1TA 4LZNA 1XZ8A 3TTWA 5JZ9A 2AZDA 3GD7A 3OQIA 3DD5A 3UXHA 1JVNA 1RI4A 3OHSX 5SZHB 4GLOA 3B1ZA 2PX3A 3BRCA 5CXXA 4BWVA 2HY7A 2VF8A 4GWLA 3TE7A 5C1OA 2W6QA 2Q0HA 1PJLA 1WBJB 1GTG1 4I1OA 5FR1A 3WGHA 4CFYA 5ALTA 3AU9A 4TKUA 2QMEA 1SA0A 4CF4A 1C7EA 1QK3A 2JH9A 3KQWA 4BGUA 3LVBA 3GUHA 3O8QB 3QU4A 1PKEA 4B4WA 2QE6A 1ENZA 2ZSIA 2XQJA 2BKEA 3ILHA 1PGOA 2QN9A 1M3SA 2L82A 1K7SN 4RZSA 5JJLA 2B2NA 3C5WP 3KUXA 3MAJA 4ZKDA 2QM3A 5LQNA 3TGPA 3OC6A 4I99A 1XZLA 3KEQA 3TOXA 4A03A 2IS1A 3D5QA 1JU9A 3PC6A 3ORFA 4JK3A 1VMIA 4JL8A 5D51S 1M5TA 2IDJA 2NXCA 4DY4A 4QELA 1BDHA 2BFWA 2F00A 4DNQA 3WLPA 3CE6A 1J2RA 3OQJA 1RWXA 1ZSNA 1EFHA 4U2EA 1SG0A 4ZOLF 2EW2A 2IYWA 2ZZKA 1P1RA 4ESVA 1C9EA 2LE0A 3SQMA 3VU8A 3AR7A 5BWMA 5CIYA 5F33A 1BAPA 2W2NA 4OXYA 4UBJA 5FD8A 2E6KA 3ZJVA 3AJDA 4GGPA 2BTEA 1XDDA 2JI8A 4MV3A 3RYFA 1H9BA 1R4MB 4ZCSA 2CYAA 3L8FA 4MITA 5IYZF 3RS4A 4CL3A 4DM4A 3T1NA 1BXKA 2Q0XA 3T4UA 2VDRB 4AIRA 2P9EA 3LQFA 3DR5A 1ECPA 1EWQA 1NQUA 4J75A 5D86A 2FPPA 2WW8A 4CMKA 1YB6A 3WLSA 2IHTA 1MVLA 2IKSA 4GRAA 2TYSB 4JJ7A 4L02A 1MAHA 5AJZA 4WUTA 3F7OA 4QOHA 1V95A 4II7A 3PQ8A 3WK6A 2OO3A 1UBHS 5LA6A 5IN5A 4GP7A 1Z18A 3CPSA 3ET5A 4J2OA 1NSTA 3EWSA 4LCEA 3S5UA 2AKEA 2PWAA 2P6OA 2MMGA 3UY4A 1JJIA 2YR0A 4CQNA 1VCMA 4WQMA 1XDWA 2C5LA 1P74A 4X1YA 4BCBA 1YOVA 4DFDA 2O8FB 3GUYA 2XSZD 4EECA 1MC4A 3WFZA 2VQFB 4Q9DA 1KXJA 1UEIA 4EW1A 5JAUA 4UZEA 3OBIA 2C2MA 4JEUA 1AQ6A 3RSOA 1YDEA 3SJBA 4CEIA 5DN9A 4R71A 2J9RA 3N86A 3KKLA 3AYXB 3PEVA 4K2AA 3WYBA 5HUQA 2QMZA 2QRNA 1JECA 1Q0UA 3WNQA 2DWCA 1U2SA 1AURA 1XVIA 3GMTA 3MQFA 1MGPA 4DOMA 3QPCA 2ZAGA 3HJTA 3MWEA 2VPQA 3L8EA 4H9GA 4X85A 5BO5A 2AN4A 5LLTA 1A9XA 5JFGA 1TK9A 4EK9A 2G82A 2YMLA 4DCOA 2F8MA 5HQJA 1GAXA 4MVWA 5KOHA 4MVYA 5K3CA 4ZN6A 5AFSA 3QXCA 2OVFA 4ND5A 6AT1A 2O0LA 1VKZA 4QO7A 3T94A 1V1RB 2GBCA 3H6KA 5K09A 4DNPA 2JFYA 3KJZA 1G63A 2JFNA 3U3RA 3CNQS 3NJRA 1L0BA 1GNRA 1BHSA 4W8OA 5FTKA 1CVIA 4NX2A 4PYIA 5T7BA 2VLBA 5A9RA 1G66A 1CJTC 2V65A 2C4MA 1USIA 3NHZA 2G5TA 1DCFA 3FI9A 3QKSB 2Q3DA 1WSAA 1QV6A 3C48A 5KKNB 3EPLA 2GQ0A 1JLMA 3KTFA 1EUDA 2QYSA 3WDSA 4BJHB 5CGQB 2ECQA 4R2WA 1UEJA 1WAMA 3BHJA 2XD4A 4GE0A 3UUEA 1IEQA 5F9MA 3OOEA 4AJHA 2HZ7A 3ZGZA 1KVTA 4WCFA 3I39X 5EHXA 2X4IA 2CJPA 2IU4A 4UM5A 5L3RA 4F1KA 3F47A 4WT7A 2WEKA 4UNQA 3TXYA 3Q1KA 5KYWA 5KHOC 2W6ZA 3W5AA 4RVNA 1BEZA 2EBHX 4FSHA 1Q17A 2JAWA 4GPTA 3VNRA 4Z1MD 1TVKA 2HWWA 3C85A 3GROA 3INGA 3ITKA 1IZ0A 1SD2A 2ZJOA 4K40A 4M6WB 4U5QA 2B8TA 1YQTA 1XTPA 2Q45A 4OB8A 1HSOA 3KCNA 4NFYA 2B2XA 4BO8A 2MINB 2J0SA 2XCSB 2W0SA 4OXXA 4KJZA 2WIDA 3VTFA 2QW8A 3E9CA 2CCGA 2VC2B 3O95A 5K0TA 1L7BA 1L1QA 2WG0A 5TPZA 2IPOA 3BHMA 4EFLA 1JG7A 1B1AA 3MLAA 2XYVA 5CD1A 1QP7A 1F6WA 3OFKA 4GQAA 4KNVA 3ZXXA 4RVHA 4IVPA 4P0QB 1QAQA 1Y5IA 4LJLA 5KU7A 4JXZA 4M21A 3C8ZA 1AO3A 1KZ9A 1OXSC 1SGWA 1X8XA 2EWMA 3QVLA 4HUQA 4MKGA 1F2VA 3SEFA 5KJFA 3T38A 5M04A 5KMGB 3O83A 5ISMA 4OGFA 4S05A 4LBZA 2N46A 3EGDB 2W42A 3W2IA 1M7BA 2ZSJA 3STUA 3UBTA 4DMFA 1QTRA 4UPEA 4ZHQF 2BGGA 3KZCA 5DCUA 3N2GA 2WTBA 4KN6A 1VB5A 2H2GA 2CJWB 3VRHA 3S8YA 3PEUA 3RSLA 2QTWB 3KWFA 3KK0A 2OKCA 1RYNA 4CJXA 3P2EA 1H0KA 1IZYA 2VXOA 4PN7A 3QWIA 1XALA 4HVAA 1QOPB 3N7AA 1NC1A 1V7CA 3OCZA 4TS4A 1UDXA 3WNBA 3II6X 4I9UA 1YE5A 2FJPA 3GGPA 3QU9A 5F1YA 3U1BA 1JQBA 1M6HA 1UMDB 2EFHB 4PNPA 1Q50A 2X3FA 1XRMA 5IJ9A 2XECA 3H6HA 4NJMA 3JY6A 1NSYA 1NTRA 4H0FA 3QXSA 3AR2A 4QVGA 4GKVA 4MA0A 3LUJA 1JPNA 1V4BA 4FYWA 3REOA 4Z4QA 5GPBA 1X6VA 3IHLA 3B1YA 4AY4A 1RRGA 3K0BA 3A27A 1DARA 4BGVA 3X1XA 2QRMA 3KJHA 1MAAA 1E66A 1JDPA 5INTA 2C4WA 3Q4GA 4KR7A 4WOBA 1M1YE 5CUQA 3LQKA 2V7QD 1E8MA 1EHYA 2GVZC 2IW1A 2NV2B 1JDSA 3HKCB 3RSHA 3DXFA 4O6VA 4ZICA 1JMYA 4G8JA 2ETXA 2XF8A 1RFLA 1G6Q1 4BO4A 1T15A 1SCUA 3RJMA 5BSGA 2IPAB 2ZWPA 4TXLA 1IUNA 1GU0A 2VN8A 1YDHA 1KYYA 4LDZA 5BWNA 5F9FA 4YAFA 4RKRA 4DRZA 2WQ6A 3AHJA 2VHJA 2FOXA 4MB0A 2JJ2D 3OPYB 4HDOB 4AROA 3OKCA 5HK9A 4YXFA 4EG3A 4MW5A 1ZOIA 2IHNA 4F06A 1EU1A 1SHUX 2HLDA 2PKRA 3KE8A 5D7NA 2HB6A 5CDFA 4QUEA 5GONF 3REQA 2O2JA 4PYRA 4D9MA 1D2AA 1XL1A 3O21A 3HXKA 4JX8A 1VE3A 2RHBA 3W5JA 2RH4A 4OQXA 2ODQA 4H3VA 4JQYA 4IIGA 1YASA 4MIOA 5IK2A 2HIMA 3AESA 4CWAA 4OQ4A 1YBFA 1X1AA 1TUBB 3PA6A 2H7YA 3A2KA 1RD4A 2ZQ5A 1C30B 3N07A 4Z7QB 1P9RA 3LP6A 1NW7A 3C7CB 1NPTO 1H2EA 2QK4A 3JYPA 5LMCA 2GLXA 4XVCA 2WF5A 2VXBA 3T3GA 3GEEA 1AY0A 4O2LA 5JMWA 1GG2A 2PGLA 1Z73A 3GJQA 1IU9A 1J4AA 3GF4A 3MMPA 1KMMA 2QRVA 3IVCA 4QOJA 5FWAA 2ZDQA 1EVIA 3VUFA 4DRXB 1AUOA 1DC3A 5IZCA 4K6CA 4CLOA 2HCTA 1X3LA 4LWZA 5EA2A 3PLAE 1NUTA 5DBFA 1K8XB 2QTCA 3R6WA 1Z88A 4RA6B 4B32A 2EFGA 2DKFA 3BJMA 3FCCA 2Z6VA 5FUQA 4IIJA 4KPUB 3LXXA 4C0HA 1YR6A 4PTZA 4YB8A 5KYUB 2BOVA 3R9XB 4G0MA 2PMBA 3FCOA 4MIYA 4RD1A 2AMFA 4TTTS 3L6OO 2PZAA 2IXAA 5A5EA 2R47A 4AG6A 4LZAA 2ZBPA 2I8CA 2NXEA 1DXQA 1P2UA 5AM2A 1N34B 3IOYA 4HGOA 3ZV4A 1WM1A 5BNZA 4HXEB 1DRKA 1UL1X 3E48A 3TLXA 3DG9A 4ZI7F 4HLQB 4MWSA 3QFHA 5K0GA 3FVTA 3G9TA 3W2HA 3G0HA 3DLBA 2Z1MA 4QHYA 4ZCTA 3NIBA 3S2ZA 1PJCA 2W48A 1R0BA 4PZ0A 3QXGA 3DL7A 4G5XA 4LZLA 5JMPA 4M2LA 2JJ2A 2OWEA 2Z5GA 5D2CA 4L28A 1BA2A 1SBIA 2GNPA 2YZKA 3TW8B 3X43A 1C3OB 5ERXA 3AL0C 1IPEA 2B4KA 3VO2A 4KO1S 3OOSA 1IQRA 1EWKA 3BIXA 1RE0A 1T5LA 2BFAA 1YXMA 3E23A 2XUQA 1C9JA 4QECA 5D3ZA 1K7XB 4B6PA 3W5DA 3HNPA 3U19A 1RLMA 2R65A 2QR5A 4O59O 3IDSA 4RORA 5ALUA 1J39A 4LMBA 1DBSA 3MOGA 5A06A 2UV8A 1N7GA 3KKZA 2ZE6A 3G2LA 2HSZA 4H4EA 1J25A 2HHLA 3N3AC 2X8JA 3NHRA 1P45A 2FPSA 1FS5A 4QXPA 3ZUPA 4HNTA 5C5DA 4JI8B 4GZ6A 3DV0A 5EJ5A 3U7FB 4FHCA 1WCV1 1N9GB 4A2QA 3F2VA 2OZEA 3N0VA 3JQ7B 1DINA 3JQAA 4J07A 5AHOA 1C0EA 4DCMA 3TF5A 1IN1A 1YFJA 3B6ZA 3NVMB 1FFXA 3FYCA 1L5HB 2GYVA 3IIKA 1PYGA 4MQEA 1XPJA 2DJ5A 2JGMA 3CKKA 5HIAA 1JKJB 1E6MA 3QLVC 4KIWA 5CFNA 1U7XA 3U37A 2F6RA 3L6UA 2Z6UA 3H86A 1OC4A 3GA7A 2XHZA 3V7WA 3KKQA 2PD4A 1S8AA 2Z3ZA 3HZZA 1U0HC 5E4TA 2FP4B 4QNNA 2BR4A 4LHEA 4DIUA 5F76A 4QXMA 4MS1A 2BBOA 1YJ8A 1ZBQA 4ITRC 2IRWA 1ZONA 1KMQA 3PUXA 4CXMA 1ITZA 3KQLA 3DWEX 3ESQA 1CNFA 1OH6A 2I6FA 3N8IA 4IDCA 3UJBA 3EXFA 1OLUB 3ANTA 2AYYA 2JEOA 1PWHA 3ASYA 4MQBA 4MX8A 3ZWQA 5I8WA 1OH8A 3PEEA 1SH7A 1QVVA 1M34E 1LWNA 1UJNA 1XCJA 2YY6A 4MQFB 4PX5A 1I3NA 3HY4A 4RENA 4XJVA 3OUTA 4WV3A 1R4NA 1DT5A 2FY8A 2PMDA 2RHDA 4ASUD 4JYAB 3Q2OA 3DMDA 4MJLA 1REQA 2W90A 4YLEA 1CP2A 1M2HA 4PNZA 3R77A 3RRNA 2LD4A 4GP6A 4L9SA 5FWYB 1XTBA 3LK6A 1UIMA 4WA7A 3PBKA 3H04A 3IUBA 3UJ7A 3ZZUA 3ZVNA 5L53A 2H1IA 5H3LA 3FNRA 1QIJA 2IVFA 1NBWB 3MT7A 1XVVA 4JODA 4MUEA 2QIPA 4RUKA 3TLGB 5L8VA 4PINA 2ZJ2A 4XSHA 5MDHA 3LDFA 3LT1A 3HA5A 1KI4A 1U0TA 2FMKA 2FV8A 4ZALA 3W4IA 1LCIA 1WXFA 1I7LA 1L4LA 2VLIA 2EZUA 1CX9B 3JATA 4RK0A 4CV0A 4JH0A 3IMEA 1LC0A 3RAPR 1Q0TA 4Z0HO 1XRLA 4PAGA 4R2KA 2VRBA 5BNIA 1A8IA 2P9YA 3UJCA 1EK1A 3Q8MA 4EUFA 1EA5A 1VM6A 2VF4X 2WZBA 3DWIA 3L1UA 3WWCA 3FYSA 1VZ3A 4BVHA 2C42A 3CVXA 4UTNA 4TTJA 5DEIA 1YMUA 4H27A 5E1OA 3L0CA 1CUDA 5C8YA 5AOVA 3EGXB 3ACCA 1J8MF 4KQKA 3PF8A 4M0PA 1CUJA 1K5GA 1VOTA 2VP3A 5AOBA 3HRHA 2X1HA 5EUMA 4U3JA 1N6KA 2WRZA 3FUCA 2FPWA 2ZIXA 4J0QA 4KHZA 4Q47A 3FNGA 3FPHA 4FM9A 4ARIA 2X42A 4K6GA 4Q9HA 1ZBDA 4YLYA 2Z1NA 3ID6C 3WKDA 4D2IA 1SOUA 3OE1A 1KU0A 2BDEA 2GBLA 4I9NA 4G1BA 4Y98A 3WLJA 4B35A 1PR4A 1TKAA 3BQMB 5KNBD 1EK0A 1ZH6A 1S02A 1NBOA 4CQMA 3RKUA 1DAGA 2YJ6A 2BHLA 2QAGC 1KDPA 2XGJA 4ZAVA 5F1PA 1NZFA 5F23A 3UV6A 3DMTC 4PSUA 4NABA 4U02A 3RT7A 4UBNA 3RC8A 3SZUA 1TCAA 3TUJC 2NO9A 3CZMA 2RGGA 2F1IA 4Z8YA 2KPOA 3O47A 2Q2WA 1I0ZA 4WINA 4UHFA 3L43A 1PEYA 1B4DA 4P22A 2WKWA 1Y7IA 5CLFA 4HN2A 3HSKA 2BFPA 1AO0A 2RB5A 3ASZA 1JB1A 1WPRA 2D7CA 2HMUA 2XQKA 4Y2XA 4FNMA 3TNDA 5JIBA 4HB2A 3MEQA 1FTYA 4GOMD 4JP8A 3U7RA 2H5JA 3AM4A 4OI1A 4B4KA 2O0HA 3KQMA 3BGDA 3OLQA 2JJ8A 2GT1A 4AJ2A 4MGZR 1EUQA 4KE7A 1CUVA 4G0QA 3T34A 4AXXA 1OT3A 1SVKA 1BDBA 4E5DA 1NWCA 3P71T 1CRQA 3HEBA 1VDZA 5LBTA 5M2QA 4GBMA 4K1LA 1OBHA 4IMRA 2FCAA 4L6CA 3SP1A 1PSDA 5EWLA 2QJOA 4JCOA 5B1IA 4BBPA 1BQ4A 2XKAA 4HBGA 4OYYA 5G1OA 4LE1A 4UEKA 1Y8CA 5K45A 4BVBA 1DMSA 3LNCA 3ZVLA 5P21A 2Y1WA 2KQUA 3FETA 4E2WA 3QLUC 3RK4A 1UMCB 3UJ8A 2Z08A 1BG6A 4ZU6X 3VKHA 4IJVA 3ZCPA 2AJCA 2ZS8A 3C1OA 1JR6A 4LYGA 1Q0PA 1AXGA 3EMVA 2VYQA 2XTNA 2Z1DA 3NTUA 4BQFA 1JWLA 3N8HA 5IVPA 1PDWA 4MW9A 1RPTA 4A26A 3EISA 3BSFA 5CT6A 1TLTA 2PKCA 3BD8A 1XEWY 4HVTA 4YJ3B 1PNOA 3H19A 2LPMA 3H0CA 4EJ6A 5LBUA 1AHNA 1TO1E 4X97A 5EKTA 4K0KB 1BN6A 4TTSA 4INAA 1YI0A 3TOSA 4DILA 2IEYA 3F6PA 1Z4KA 1ABEA 1IIBA 4G6ZA 2OCYC 3BMNB 1EB9A 2FW7A 4XB1A 3BIWA 3RBVA 4MWTA 3RWBA 2JVJA 2QGZA 4KQWA 3RREA 1FS4A 2ZE8A 4KQGA 3R7BA 1J8DA 3K2IA 3OQOA 1U5CA 4YIHA 3G7UA 2FG6C 4IILA 3H16A 4JLOA 5IMBA 4EYGA 4YPVA 2VNJA 4UNRA 3MTDA 3TH5A 4RMHA 5HKAA 3SBEA 3HABA 4M1KA 4HDKA 4XYBA 4JI4B 3G2MA 1HMYA 1LB1B 4RACA 1J9EA 4G0OA 3TZKA 3OWOA 4TS9A 3VKGA 2P41A 4WOCA 1Y3AA