1KDQB

Crystal structure analysis of the mutant s189d rat chymotrypsin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
95
structure length
95
Chain Sequence
TPEKLQQAALPIVSEADCKKSWGSKITDVMTCAGASGVDSCMGDSGGPLVCQKDGVWTLAGIVSWGSGVCSTSTPAVYSRVTALMPWVQQILEAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHYMOTRYPSIN B, B CHAIN
publication title Three Dimensional Structures of S189D Chymotrypsin and D189S Trypsin Mutants: The Effect of Polarity at Site 189 on a Protease-specific Stabilization of the Substrate-binding Site
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 13
structure length 95
sequence length 95
ec nomenclature ec 3.4.21.1: Chymotrypsin.
pdb deposition date 2001-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1kdqB00
3ZYEA 3O8RA 2ZI2H 1PPEE 1C2JA 4ISOA 1QL9A 3BV9B 4B2BA 2BX4A 1DS2E 1GHBG 1MD8A 2D8WA 4INHA 5E0HA 1MBMA 4NIVA 1P3CA 2WYJA 1EP5A 3A89A 2UUFB 3KQCA 2XRCA 1C5OH 4K69A 5JBBS 3SUEA 3QO6A 4CRAA 4UONA 1MKWK 1K1OA 4BAQB 1GJ6A 1SI5H 3D62A 1O3OA 3TGJE 1L2EA 3F9GA 1SGEE 3U8TH 1CHGA 4FUCA 1CHOG 4I7YH 1JOUB 3MMGA 1EJMA 2YNAA 1P8VC 1C4U2 1HRTH 2HOBA 2SGFE 1G3CA 1D3QB 4K1SA 2BZ6H 5FXLA 4TY7A 1DY9A 4DY7B 2VGCB 4WH8A 3RUOA 1V2JT 2ZQ1A 1T4VH 4K5ZA 3ZVBA 1N1LA 4E06H 3RXRA 3V3MA 1BTWA 1MQ5A 1UVUH 2R0LA 4ISLA 1H8DH 3A7VA 1C1TA 1GJ5H 1P09A 4JZFH 1BMMH 2OC7A 4B74A 2W3KA 3BEFB 3DHKH 2BB4A 1AZZA 4NGAH 1DUEA 1HJAC 2QF3A 4Y76A 1RIWB 1AWFH 1VITF 3RXJA 1EJNA 1BB0B 3FVFB 3SJOA 3U9AH 5JB8S 1AZ8A 1RTLA 1AQ7A 5JPMH 4U2WA 4Q80A 1SGRE 1QHRB 1S85A 3SGQE 3DA9B 4ZKOU 1XUKA 4BTTB 4DW2U 1EASA 2PUQH 1EOJA 3DUXH 1GJAB 1NFWA 1AUJA 1IHTH 4GUXA 1G9IE 2TGDA 2XXLA 1QGFA 1Z1JA 3S9BA 1BRBE 5DP3A 2W7SA 1GJ4H 1G2LA 4IGDA 3TJNA 2G55A 1Y3YA 3LGUA 5I25A 2CV3A 4FVBA 2ANWA 3VB5A 1W3CA 2P94A 2FEQH 2Z94A 2BX3A 2XYAA 5DG6A 3E8LA 1CT0E 1FPHH 4YT7H 2A2XH 2ODYB 3EDXB 1IQEA 1C1NA 3STIA 1TNHA 3GCHB 4NSVA 4Q2KA 3TJUA 2WUBA 1A7SA 2BQWB 1GJ7B 2HPPH 2FOCA 3K9XB 1DXWA 4IMQA 1Y5UT 1Q31A 3RC4A 3GY3A 1AD8H 2V3HH 4LXBH 3MNXA 2PR3A 3MU8A 2GDDA 2TRMA 2HGTH 3RM2H 4AYVB 4SGAE 2GVFA 1O2LA 3NXPA 1HCGA 3GY6A 1MTSA 1FJSA 1S84A 5GXPA 1GHYH 1FMGA 3SV2H 2FOMB 1SG8B 1XUIA 1TPOA 4KKDA 1HAZB 3A8BA 3F68H 2AMQA 6CHAC 1RD3B 1C2KA 2IOTA 2SGQE 1TGTA 2ZHDA 1HAXB 1ZMLA 5EXNA 3TVJB 4X6MA 1CHOF 1O3MA 4WMDA 1MBQA 4ABAA 2ZHQH 3K65B 4A1VA 2ULLA 5EQRA 1Y3VA 1NRNH 3ZZ8A 1MMJN 2IPHA 3EAJA 4Y6DA 2BVRH 1V2UT 2FOEA 1HGTH 4Q7ZA 2ZDLA 1YKTA 2ZFQH 5LPEA 2HRVA 2SNWA 4JYTA 1H8IH 3SGBE 1THPB 1A3BH 2ZFPH 1NM6A 3SNCA 1G3BA 1WCZA 1GCTB 1S6FA 4IC5A 1VGCC 1EZUC 1O0DH 3MH6A 4AYYB 2BDIA 2PKSB 1D6RA 1F5LA 3LPRA 1VITH 5ESBA 3SNBA 1GL1A 1KDQB 1P11E 1DWDH 3M7TA 1AKSB 1ETTH 5G4BA 2GT8A 1V2PT 1PPHE 1EX3A 3RU4E 4WXIA 4BAHB 1TA2A 5EU8A 1WYKA 1V6DA 4ABHA 5ETXA 3OY5U 5FPTA 3P6ZB 5SGAE 1BMNH 1BRCE 3SW2B 2OC8A 4ZHAA 2CJIA 1C1WH 2ZGCA 3RXHA 2JETB 1A0HB 2BXTH 4H42U 2A2QH 1EPTC 1ESAA 5C20A 2BY5X 4RKOB 3SJIA 1A2CH 1MUEB 3FANA 3VXEH 5DP7A 2PKAB 1C2EA 1QTFA 3PMJA 1QB1A 1TNJA 1ELFA 2ZGHA 1EZQA 1XVOA 5T6DA 1YPGH 4YOJA 3HK6B 3BG8A 2RCEA 4XDEA 4THNH 1OWEA 1TGSZ 1AUTC 1CA0B 1S6HA 1NTPA 3M7UA 1YCPK 2ANMH 4DOQA 3MNSA 5F6MA 3UNQA 1L4ZA 2A1DB 2JKHA 4O3UA 2QA9E 3V0XA 1Z6EA 2GX4A 3IWMA 2FOAA 1TGNA 3TU7H 1T8LA 2VJ1A 3KNXA 3VGCC 2Y5GA 1GBMA 1AGJA 1HBTH 1PPBH 2A5IA 1DDJA 1GJBB 1P0SH 1GJ8B 4D76A 3PWCA 1QBOA 1G3DA 3NUMA 1VJAU 5C1XA 2ZDVH 1ZTJA 2RA3A 1YPEH 5E2PA 2Z7FE 1E37B 1H9LB 1KDQA 3PTBA 1F5RA 1UVSH 3P17H 1O5EH 1C5TA 1SVPA 5CE1A 3DD2H 2ZFTA 4XOJA 1IQFA 1WSSH 1HAIH 2D1JA 1O3AA 1DE7H 2TGPZ 1TOMH 1F0UA 1EUFA 1AN1E 3RLWH 1SMFE 2CN0H 1DICA 1FONA 2WV4A 4GCHG 3KN2A 5J4QA 4AFZA 1O3IA 4BAOB 1ARCA 2EA3A 2Z9LA 1BTYA 1CE5A 1W0ZU 1ZTKA 2DE9A 4DURA 1XMNB 2ZECA 4KELA 1JIRA 3E90B 2XWAA 1C1OA 3FP8E 2BY6X 2FOHA 5DO4H 3A83A 1NZQH 2O8TA 1SHYA 1KLJH 5HXFA 1O3LA 1ZMNA 1T32A 1C2GA 3BEIB 4ESTE 1GHVH 3LT3A 1C1VH 2A4OA 3MNBA 3SV9A 1DPOA 4O3TA 5DP5A 1NPMA 3ZVCA 1NFUA 3RXLA 1O2ZA 1O5FH 5EGMA 1AWHB 1C2IA 2RDLA 1GVLA 2F3CE 3MOCA 2AIPA 2FS9A 4Y8ZA 5GIBA 2B5TB 1GMHG 4JYUH 1O2RA 1K1PA 1BQYA 1O5CB 3BTHE 2LNCA 2OINA 3BN9A 1IQKA 3M5NA 1OWJA 1C2FA 1F92A 4ZHMU 3SHCH 3QGJA 2Z9GA 3EA9A 2BMGB 2Z3EA 1FAKH 1C2MA 2IJOB 2BY8X 3D65E 4NZQA 1A3EH 4Y0ZE 1T4UH 2GCTC 1O2QA 4WH6A 1HFDA 4X1NU 2ZPQA 1DFPA 3T5FH 3NZIA 3C1KA 2OLGA 3HKIB 4UFEH 2R3YA 1O32A 2J38A 1FY1A 5A8YA 2P16A 4MLFB 2C4FH 1D3DB 4FUFA 1C5LH 1WQSA 3GY2A 1D3TB 3KGPA 2R0KA 3UR6A 1GDUA 5FBIA 3GYLB 1T7CA 1S5SA 1W8BH 5A09A 1N6YA 1QFKH 3UQOA 1ZSLA 1O2PA 1TNKA 1GJDB 1LHFH 3SUFA 1GHZA 3TH2H 1E38B 2B8OH 1G36A 1TMUH 3LU9B 2OQUA 1P2MA 1UTQA 2BDCA 3OX7U 4FUIA 1HAVB 3RXIA 2EI7A 2FI3E 1AVXA 3GICB 3M61U 1LPKB 3TH4H 1N8OC 9LPRA 3MYWA 1O39A 2VIQA 3KHVA 1PYTC 4UE7H 3T29A 3PO1B 4GCHF 4HGCA 2HWLB 1BHXB 5DPAA 1OP8A 1ZYOA 1TWXB 3SUGA 3FP6E 3BF6H 1GVKB 2B0FA 4B71A 1TX8A 1YPKH 4I8JA 3MU1A 3R3GB 1NT1A 2VB0A 1UK4A 3Q76A 2Y5HA 2NU1E 4NCYA 1A61H 1HDTH 1IHSH 2G81E 4R8TB 3PMHB 4TPIZ 2QXHA 4CRBA 3VB6A 5JBAS 3TH3H 4HFPB 1A5IA 2Y80A 3A8CA 2VU8E 1NESE 3ZZAA 1P12E 1SGFA 1IQNA 2BOHB 1RTKA 1OWKA 1UHBB 1QIXB 4YOIA 3SU6A 5B6OA 3ZVFA 3RXAA 1GI7B 4WY3A 2F9UA 2PSXA 2XCFA 2CGAA 2AIQA 4OS2A 3MTYA 1SGYE 4ABIA 3KF2A 1C5YB 1SQOA 2ZHFH 1QRWA 4X2WA 2CXVA 2J9NA 4Y7BA 1GBLA 2XBYA 1T8NA 2SGAA 3E91A 2JH0D 1TFXA 6GCHF 1MKXH 4OGYA 1G2MA 1FXYA 1QA7A 3O8CA 1BBRE 3RC5A 4ISHH 2SGDE 1HNEE 1XKBC 3LGTA 1S0QA 1YPMH 2PTCE 4OS7A 4CRGA 4K1TA 3GDVA 1ZHRA 3MWIU 2QN5T 3K6YA 1O2VA 2AGIX 1O2KA 3UTUH 3SJ8A 1L1GA 2HVXA 1PFXC 5CHAC 1CBWC 2I6SA 4LOYH 2FYRA 4JK5A 2BD4A 2YOLA 2Y7ZA 2O8MA 1G37A 2STBE 2QIQA 1OXGA 4K3JA 3M37A 1ZZZA 3EQ0H 3BTME 3TGIE 1SOTA 1ZJKA 2BDGA 1PPCE 4Y10E 1O3CA 2KAIA 3ZZ5A 1F0RA 4ABJA 4Y8YA 4ABEA 1BRUP 2H1UA 1O3PB 1GCDA 4YT6H 1B5GH 1UMAH 3LH3A 4O97A 3RMNH 2ZU5A 1NU7B 1AVWA 1TRMA 2V3OH 3A8DA 3UWJH 3UY9A 3HK3B 1C5MD 6ESTA 1O2OA 3T27A 1BMLA 4AG2A 3OTJE 2Q6GA 2VWOA 4LZ4B 1GI6A 1TBZH 3PMAB 2K1QA 4ZROA 4CBNA 4INKA 1CSOE 4JMYA 1YC0A 2BYAX 2J95A 1QY6A 1UTNA 2F9PA 4I8GA 1FY4A 1UHBA 2FZZA 4H4FA 2PTNA 5FX6A 5LPRA 5C67A 1P10A 2ZU2A 2F9BH 2ZZUH 4VGCC 4D7FA 2P8OC 2WUCA 2Z9IA 4FUDA 2ZFSA 4FU9A 5TCCA 2C3SA 4ISIH 3BTGE 1MQ6A 1P01A 4U32A 3V13A 4DJZB 1LCYA 3SOSA 1VCPA 5HM2A 3PTNA 3RC6A 3F6UH 2DUCA 1L0ZA 3LIWA 1NS3A 1ANEA 1O3FA 1P2QA 4RSPA 4TYDA 3ZZ7A 2GCHG 1FN8A 1NRQH 1AB9C 2ZC9H 1W12U 1ZR0A 1UVPA 1O2XA 3H7TA 3L33A 1K1LA 1G3EA 1HXEH 1W14U 2A4QA 2UWPA 4X1QU 2HLCA 1P9UA 1RTFB 1QNJA 1GBAA 4BTIB 3SZNA 3S9CA 1OX1A 1W11U 1O31A 4XBBA 2VH6A 1DXPA 3SV7A 1HAPH 1A1RA 1KLTA 5E0GA 2P59A 1C2LA 2NU3E 2C8YB 1ACBE 1E35B 4TWWA 8GCHG 2QC2A 1W7XH 6CHAB 3PV4A 2DE8A 2FIRH 3GCTF 1GGDC 2FDAA 5TCAA 8LPRA 4FUEA 1K1NA 3SI3H 2I6QA 2BD3A 1TYNA 1NRRH 2BDAA 2V6NA 2TBSA 2Y7XA 1K1MA 1DWBH 5EW1H 1GMCG 1Z7KA 1O3NA 3RXOA 4LZ1H 2AMDA 2OUAA 1OWIA 3ENSB 5HMAA 4GAWA 4ZAEA 3Q77A 2NU0E 3S0NA 1AIXH 3RXGA 6LPRA 3A7WA 2XBVA 3ZV8A 1JXPA 5AVDA 4MG3A 3A7ZA 1LQDB 5DP8A 5LPFA 2A5AA 2W7UA 1NRSH 4ZKSU 1C5NH 4UDWH 4Y79A 1CGHA 1DLEA 1VGCB 4NSYA 3K6ZA 2ALVA 1M9UA 2F9OA 1TRNA 2QYIA 1O5BB 3UREA 4CHAC 4X1PU 4JZEH 1C5ZB 5EG4A 1IAUA 5IDKA 2BM2A 3KIDU 2ZPSA 1P3EA 3RXPA 3QTVH 1SFQB 2FM2A 4YOGA 3GY5A 1DSUA 1Y5AT 1JBUH 1EATA 1P06A 1Z71A 3LC5A 1LPGB 1HLTH 1CVWH 3DFLA 4X1SU 3MU5A 1K22H 1TMTH 4X1RU 2FTMA 4JZDH 2VNTA 2Y81A 1QRXA 1GHBF 3M7QA 3RU4D 2OXSA 1WQVH 1FAXA 2J34A 3BTEE 2Z3CA 2UWOA 1EPTB 2H6MA 2OTVA 1H4WA 2PGBB 1ETRH 1FQ3A 3W95A 1ZLRA 5C2ZA 4E7NA 3TITA 3ZVGA 1KXBA 3RXKA 1L1NA 1GBBA 3LJOA 1ELAA 1ZGIA 4BAKB 1GDQA 3ATKA 1T8MA 2ZGBH 1C2DA 1RS0A 3KQBA 4RKJB 5FPSA 2QXGA 4OS1A 2VIOA 1YF4A 1MH0A 1TX7A 3RMLH 2AFQB 3P92A 4CREA 1V2QT 3P8GA 3DT0H 1SGCA 2F83A 2BQ7B 1MCTA 3M3TA 1MTNC 1J15A 3GY4A 1D4PB 1HIAB 1PPZA 1MTUA 4YLQH 3H5CB 1KXFA 2GP9B 3ZZCA 2J92A 5AFYH 2VIDA 4OS6A 5A8ZA 3U8OH 4CR9A 4NA7A 3MH5A 3QTOH 1A5HA 4E7RG 3BG4C 2AMPA 1GMCF 3VGCB 1EP6A 3SHAH 5ABWA 3RXTA 1EAUA 1CO7E 1J9CH 4YTAA 7KMEH 3ZVEA 3KQDA 1Z1IA 1CA8B 4MPWA 2GV6A 5FHTA 3S69A 1GBJA 2J4IA 4WWYA 4X8SH 1QJ7B 1NN6A 3EA8A 5DK1A 1LKAA 1OPHB 1Q3XA 4GPGA 1A46H 1IQIA 3ZZ3A 3L6PA 2G00A 1OKXA 5IYTA 4DG4A 1BCUH 5LGOA 3QUMP 1YPHC 1UCYE 2SGEE 4I8LA 1ZHMA 2ZU4A 3MO6A 1OYTH 3ZV9A 1S82A 5EODA 2A7JA 3QDZB 1UTJA 3A87A 1E0FD 3HATH 5EPNA 1HUTH 3TK9A 4K8YA 2B9LA 3KCGH 4ABBA 4BAMB 4FVDA 4MDSA 2EI8A 2PWXA 4UFGH 3E3TA 2IN2A 1J8AA 1BTUA 2FX6A 1INCA 1NFYA 2A4RA 2CHAC 3LONA 4NIWA 3UNRA 2P3TB 1WAYB 2FOGA 1EAIA 3TK6A 7ESTE 4B73A 1GI3A 2ZKSA 4TY6A 3UIRA 1MZDA 2GT7A 1KY9A 3C27B 1E34B 1ABIH 2LPRA 5GDSH 4Y71A 1FLEE 1LVMA 4ZUHA 1EB1H 5DP9A 2HNTC 1JRTA 1V2ST 3VB4A 2ZPRA 1KYNA 3I29A 3ODDA 3QZRA 1QJ1B 1BTXA 4NFEA 1LHDH 1SGIB 4H6TA 3OYPA 2BY9X 2Q6DA 1DLKB 1SOZA 2CF8H 2ASUB 4IC6A 1ARBA 1XXDA 3KL6A 2QAAA 4KTUA 2C93B 3I77A 4ZKNU 4CH8B 3TNTA 4XBDA 3P8FA 1GCTC 1LO6A 4MPXA 3TIUA 5AHGH 3UFAA 1ID5H 1AKSA 1TGBA 3PWBA 3NCLA 4UEHH 1AE5A 2NWNA 3PB1E 1DVAH 2TGAA 1T8OA 1V2VT 1WV7H 2OBOA 1C4V2 4F4OC 2BZAA 1W2KH 3NPSA 1V3XA 2R3UA 3B9FH 4M7GA 1MKWH 2STAE 1QRZA 1TLDA 1GPZA 3MNCA 3A81A 3RXFA 1WTHD 4FXGH 1SGFG 5H4IB 1O34A 3Q00A 1XKAC 3OY6U 2ZDAH 2ODQA 3RXQA 2RG3A 3S9AA 2BD9A 5K7RA 1YPHE 2VVVA 2G4UA 1QR3E 1O3GA 2THFB 3SNEA 3RXSA 2A32A 5GCHG 2PHBA 1L4DA 2CF9H 2RA0A 1BTZA 3MH7A 2WPMS 1FNIA 1TBQH 1GMDG 1Q2WA 2JH6D 2QY0B 2PKAA 3SV6A 1YPLH 2P93A 2WPIS 1QA0A 2J94A 1ZGVA 3U8RH 5A0BA 2PLXA 3O8DA 2ZGJA 1N8OB 1O2YA 1JWTA 1QB6A 3LH1A 3VXFH 4D8NA 1Y3XA 3ZZ6A 1GHAG 3F9FA 4A6LA 2WPKS 3A84A 2FMJA 2F9VA 4UFFH 1GBCA 3SU5A 1CT2E 1NY22 3RXCA 5DKMA 1Y59T 4FUHA 5A0AE 3URDA 5L2ZH 4MNXA 4MPUA 3UUZA 1C5SA 1K21H 2XW9A 2SNVA 1HB0B 1TALA 4MNVA 2FWWA 2BY7X 4GHQA 3WY8A 7GCHG 1ESBA 5A2MH 5HM9A 3M5MA 4Y11E 3V12A 1QQUA 1TRYA 2Z6BD 3VFEA 3A8AA 1SHHB 2OCVB 1LDTT 5GPIB 1GI2A 5EQQA 2A4GA 2GD4B 2ZFFH 1TPSA 2AH4X 2J2UA 4X2VA 3SGAE 3ESTA 2ODPA 3F1SB 4Y8XA 1Z8GA 4XSKU 3UR9A 1O5DH 4HTCH 2M5TA 1TONA 4DGJA 4X6OA 1DSTA 1EAWA 4JYVH 1D6WA 1BTPA 2VIVA 3SN8A 5L2YH 1G30B 1JMOH 1W13U 3UOPA 3G01A 1TBRH 1H9IE 4FU7A 3SQEE 1XXFA 3NWUA 2ZGXH 4A92A 4O03A 4AB8A 1TIOA 2O8WA 1P02A 5ESTE 1NO9H 1Z6JH 1C5RA 1UK2A 7LPRA 1Y5BT 2OP9A 2ZWLH 4CBOA 9ESTA 1W0YH 1AFQC 5CHAB 2D2DA 1CBWB 5DGJA 1RXPA 3LKWA 2TGTA 2A7HA 4AFSA 4ASHA 3T25A 3U1JB 3PROA 3TJOA 3GY8A 3RU4T 1SL3A 2GGVB 1SFIA 3RDZA 3ZZ4A 3IITA 2EEKA 1P2OA 2XNIA 1CT4E 1XM1A 2XC5A 1IQHA 4ABFA 2ALPA 1C5UA 5K0HA 1FY3A 3LGYA 1ZSJA 4NA9H 2Q1JA 4JK6A 1OSSA 1O35A 1OYQA 1O38A 2H9EH 2W5EA 3GOVB 2TPIZ 3A86A 1FPCH 1J17T 4FU8A 2FESH 1GBDA 3A80A 1HAOH 3F9HA 1QURH 5FCKA 1F0TA 2A0QB 3URCA 3U98H 5JBCS 1BBRH 1O2JA 2ZG0H 1JRSA 1C5QA 2GV7A 4NFFA 2O8UA 2G8TA 1XUJA 1GMHF 5LH8A 5EOKA 1SQAA 3MU4A 5BRRE 3SQHE 2BDBA 1ELBA 4VGCB 1TA6A 2P8OB 3ITIA 1A0JA 1YLDA 4ISNA 1O37A 1BA8B 2Z9KA 1K28D 1YLCA 1DWCH 2QCYA 3GY7A 3B23B 4MTBA 2QXJA 5JYIA 1O3JA 1NC6A 2YNBA 1V2NT 2VVUA 1UTPA 4HZHA 1MTWA 4CH2B 1WU1A 1AB9B 4BNRA 3Q3KA 2QV1A 4JZIA 4KTCA 1B0EA 1PQAA 1O2MA 2ZDMA 3SJKA 3H7OA 1MAXA 3LC3A 1HAVA 4X2YA 5HGGA 2H9HA 3VPKA 1BITA 1QL8A 2ZU1A 1Z8RA 5TJXA 3QGNB 1ELEE 4X8VH 1OP2A 2ANKH 4ZHLU 3LGVA 2PFEA 5FAHA 4AB9A 2FYQA 1NU9A 1O2GH 2Y5FA 4X6NA 3M36A 1SGTA 3SU2A 2G52A 4QT8C 5T6GA 1YCPH 4K2YA 1BRAA 4DT7B 3PLPA 2BD5A 2ZDNA 3W94A 3KQEA 3SBKA 1VITG 1IQMA 2GMTC 4Z6AH 3A7XA 1HJAB 1NFXA 5F8XA 5DJ7A 3RMMH 1EQ9A 1FIZA 4IW4E 3PLKA 4FUBA 3A7TA 1UTKA 4NIXA 3S7HB 1FIWA 4GLYA 1HYLA 1O2IA 4OS5A 1ABJH 3EGKH 2ZCLP 4Z0KA 4ZKRU 2ZTXA 2PSYA 3QZQA 3SUDA 3SU1A 1GBIA 1FI8A 3E1XB 5EXLA 3RXVA 1SLXB 3FZDA 4LK4A 1VZQH 1P2IA 1THRH 1C1PA 1PPGE 5BPEA 4CHAB 2GTBA 4ABGA 3SNAA 2A5KA 1ANBA 5JB9S 5HYOA 1SLWB 1TAWA 4YESB 1UVTH 2P95A 3EE0B 3HGNA 1TABE 3A7YA 1TX6A 4JZ1A 1GI0A 3TJVA 1QJ6B 1GG6C 3M3VA 1C5PA 1ZPZA 1KLIH 4KTSA 2QXIA 1V2OT 2BOKA 4MNYA 4GSOA 4R0IA 5E0JA 2ZU3A 1EXFA 4Q7XA 3RXUA 2FX4A 2Z3DA 1ANDA 5L30H 1UTLM 3M5OA 1GL0E 1ELVA 5GWZA 1MU8B 4CRCA 3SO3A 1ZRKA 1TPAE 1ZPCA 2UUKB 3N7OA 3M35A 3ODFA 1GVZA 1F7ZA 4Y7AA 1SLVB 4E05H 2H9TH 2BVSH 3D49H 1LVBA 1O2TA 3A88A 3GCNA 4MQAA 1PPFE 1HPGA 2ANYA 1WOFA 3AW1A 2H2ZA 5AFZH 4D9RA 2AEIH 1KXEA 2FODA 1BMAA 4X0WU 1O3BA 1DY8A 3Q3XA 3GISB 1O3DA 1GWAA 2GZ7A 4UFDH 1MTNB 4BXWA 1C1QA 4ZH8A 4RN6A 1W10U 1XX9A 2P3FH 1ORFA 1SSXA 3P8NA 3NKKA 1O33A 2BHGA 3BG4B 2CMYA 4NWKA 5FPYA 1XUGA 1DANH 1MAYA 2VWMA 5C3NA 1GI1A 1DITH 5JBTA 1O2WA 4J2YB 1O2HA 2UWLA 2SFAA 2ZNKH 3MU0A 3BTKE 2VWNA 3VEQB 2BLQA 4DVAU 1DX5M 2H5DA 2Y6TA 1D9IA 1C5VA 2FOFA 1GI5A 3LDXH 3BSQA 1SBWA 1U6QA 1YBWA 1QB9A 2G51A 3A82A 1WTGH 1HJ9A 4AZ2B 3VB3A 1TNLA 1DOJA 1FDPA 3PYHA 1KXCA 3E16B 3QK1A 2GCHF 1O2UA 3E0NB 5E8EH 1IQJA 2VINA 4A1XA 3RM0H 2AERH 3V7TA 5L6NH 3PMBB 1P57B 4XE4A 5DP4A 2O8LA 4X8TH 1O2NA 1LHEH 5PTPA 2VGCC 1YYY1 3A85A 1HAYB 3ATIA 1C4Y2 1SGQE 2A7CA 4UD9H 1TQ0B 2CHAB 2ZDKA 1MCVA 4O9VA 1DWEH 3JZ2B 1GI9B 1AU8A 3U1IB 1O36A 1TQ7B 4MVNA 4BOHA 1TGCA 2C90B 3OSYA 2ESTE 3MFJA 8GCHF 2Q6FA 2OQ5A 1TNIA 3QWCH 1EKBB 1MU6B 1V2TT 3BIVH 1DM4B 1HV7A 5E2OA 2AGGX 2Y82A 1H1BA 1RIWC 3DFJA 1ZTLA 2R9PA 4WJG2 3TK5A 2VIWA 3LGWA 1T31A 1J14A 1QBVH 1UK3A 3FP7E 4B2AA 2QF0A 2FPZA 1GJCB 1LKBA 3MI4A 2BD2A 1GI4A 1S81A 3CS0A 2BD8A 1UVOA 3E6PH 1UCYH 8KME2 1N6XA 2ZHWH 2VWLA 1C1UH 5EXMA 1LTOA 1NROH 2BLVA 3VB7A 2HALA 3STJA 1YPJH 5EW2H 2PV9B 4IN2A 2VIPA 1MTVA 3T26A 2G5NA 3P8OA 4A7IB 1O2SA 1VJ9U 1ZHPA 1BBRK 1VCQA 3D23A 4NIYA 1KXAA 5FBEA 3M3SA 3MO3A 1K1IA 2A45B 2HNTF 2WPHS 4AFQA 4SGBE 3BTFE 4B75A 4FUJA 1SR5C 3RXDA 3GCHC 3QN7A 4WVPE 4GHTA 2UUYA 3BTWE 1J16A 1O5GH 1O3KA 2BQ6B 1V2LT 2BTCE 2BLWA 1EPTA 1MKXK 2AGEX 1KSNA 1VR1H 1QQ4A 2WINI 3EA7A 1S0RA 4Q7YA 3EYDA 3UNSA 3SU4A 3P95A 4X6PA 4AX9H 1BOQA 1EZXC 4MPVA 4FUGA 1ANCA 3T62A 2FI5E 1PQ5A 5A8XA 1WBGB 2H5CA 1F5KU 4NZLA 1BDAA 1YM0A 4XFQA 2XBXA 1IQGA 4I33A 1SPJA 4D9QA 2ZIQH 1LVYA 3HGPA 1KXDA 2D26C 1C1SA 5AF9H 1C5WB 1HIAA 4TPYA 2NU2E 1FN6A 1K1JA 4XBCA 5F8ZA 1THSH 1HJ8A 3QLPH 1EAXA 2ZTZA 1S83A 4AFUA 1SGNE 2XC0A 1Z8IB 1BJVA 1FZZA 2GCTB 2G4TA 1HAHH 2ZP0H 1ZOMA 1G32B 3ATWA 3LOXA 1O3HA 1Y3WA 2ZTYA 4I8HA 2PKSC 2OC1A 2TIOA 4IBLH 3RXBA 2WPLS 1BZXE 2W3IA 3Q3YA 3P70B 5T3HA 1P2KA 1V2RT 1K9OE 3AAUA 2PW8H 1BJUA 2WYGA 2OC0A 2PUXB 1P03A 4WF8A 2BD7A 3TLOA 4DCDA 1UTOA 3NK8A 4K8BA 4HI3A 1KTSB 3S7KB 2JH5D 2V0BA 4U30A 1XUFA 1ZRBA 1ZPBA 1MD7A 3ZVAA 3ZZDA 1UTMA 2GZ9A 3UWIA 1P05A 2JETC 1O30A 4ABDA 3FAOA 5A0CA 1AFQB 3LJJA 2FP7B 4AOQA 2FLRH 5FX5A 4I8KA 3BTTE 2V35A 1EOLA 3CP7A 1RFNA 1P2JA 1IOEA 4B2CA 1ETSH 2BDYA 3T2NA 1GDNA 1BIOA 1TB6H 1CA0C 4GVUA 1W7GH 2PGQB 3RXEA 2BDHA 2ZF0H 1CGJE 3UQVA 3I78A 3TPIZ 2VH0A 2HNTE 1LHGH 4NA8A 5C5OA 1YCPM 3SU0A 1CGIE 1AO5A 1C9PA 5F03A 5EQSA 3T28A 4WMFA 4DIIH 1PQ8A 2OBQA 2ZCKP 2FTLE 2XBWA 3UOUA 4F49A 1TPPA 3GYMA 3RXMA 4J1YA 1LHCH 1AFEH 2FI4E 1TOCB 2ZO3H 8ESTE 3MO9A 6GCHG 1ELGA 1FV9A 1LVOA 1XUHA 1V2WT 1RJXB 1ELTA 2GKVE 1O3EA 3QX5H 1X7AC 1K2I1 1L1JA 5J4SA 1TNGA 1SC8U 3PLBA 3FFGA 3ELAH 1A5GH 3GDSA 1PQ7A 4OS4A 4NWLA 4AGKA 1FUJA 1H9HE 4AN7A 4IN1A 2A31A 3M5LA 1DT2A 2XWBI 1BUIA 1TE0A 1UO6A 2QGRA 5T6FA 4BXSA 1YP9A 1Z8JB 3F9EA 1QCPA 1TMBH 1ZJDA 3BIUH 3ATLA 2W26A 1BT7A 3AW0A 3MH4A 3TGKE 1OWHA 4CRDA 1VCWA 3ZZBA 5GCHF 1GJ9B 1B0FA 3HPTB 2AYWA 4NG9H 1GMDF 4AGJA 1AE8H 1LPZB 3JZ1B 3SJ9A 1SB1H 2R2WU 1D3PB 4DIHH 4K1EA 4D7GA 1UJ1A 1O5AB 1HXFH 4U01A 2G5VA 1XVMA 1PYTD 4Y0YE 1EB2A 4WMEA 1GHAF 2GMTB 3OU0A 3U69H 1GBTA 2KAIB 1F0SA 4TWYA 4YLUA 1CQQA 3BEUA 4OGXA 3ZYDA 3ZVDA 1LMWB 3L3TA 2EI6A 1AHTH 2BLOA 1GBEA 1Y8TA 1C9TA 1Y3UA 3GDUA 1IQLA 2WPJS 4ZXYH 1ZSKA 3HKJB 7GCHF 4MNWA 3CENA 4BANB 1E36B 4YZUA 2O9QA 3ATMA 3RLYH 2FLBH 4INLA 3KEEA 2FOBA 3BTDE 1BHXF 2UUJB 5EPYA 2BXUH 4B1TA 1V2MT 5FCRA 2Z9JA 1QBNA 3AASA 3SV8A 3SI4H 5C5NA 1CU1A 2ZFRH 4YO9A 3LGIA 3SNDA 4CRFA 4X8UH 1UCYK 2BVXH 1P9SA 3GCOA 4I31A 1KTTB 3IG6B 2C8WB 4AORA 1GHWH 2WV5A 1HAGE 1GG6B 2SGPE 4KP0A 1EZSC 2ZQ2A 2VVCA 1EJAA 4IMZA 4I32A 1AVGH 3SORA 2F9NA 2GDEH 2XTTB 5C1UA 3BTQE 5I46H 2R2MB 1SGDE 1MZAA 2NU4E 5JDUB 1JIMA 2C8ZB 3RP2A 4X2XA 4A5TS 1ELCA 5GJ4B 4WXVA 4B76A 2ZA5A 3GCTG 1ELDE 1FY8E 3K2UA 3O8BA 4K60A 3AAVA 1FY5A 1OS8A 1AI8H 4ZXXH 2ZHEH 4CR5A 1A0LA 4AG1A 1GI8B 4ZMAH 1C5XB 3E0PB 3PM3A 1GGDB 3PO1C 2ZEBA 1QL7A 3MHWU 1OP0A 2P3UB 1YGCH 2AS9A 2OD3B 2EC9H 4JCNA 1C1MA 2FO9A 2XC4A 1B7XB 1GBKA 4IS5A 1A4WH 3B8JA 4H6SB 3TNSA 1GBHA 2HPQH 3R0FA 1BTHH 1V2KT 2ZCHP 2FS8A 1RRKA 5DP6A 4BTUB 1PJPA 1F2SE 4PROA 3CS7A 1WUNH 1C1RA 2GZ8A 4YM9A 1AY6H 3UPEA 1SGPE 1OWDA 1SLUB 2C8XB 1KIGH 2XCNA 3FZZA 1ESTA 2ILNA 2F91A 3RMOH 5CMXH 5C1YA 1SQTA 3SU3A 3AVZA 1RGQA 1DUAA 1NRPH 1P04A 1GBFA 4KGAA 1LQEA 2B7DH 1OOKB 1C2HA 4A1TA 1GHXH 1ZMJA 3ZZ9A 2FXRA 5F8TA 1P2NA 1AMHA
chains in the Genus database with same CATH superfamily
3ZYEA 3O8RA 2ZI2H 1PPEE 1C2JA 4ISOA 1QL9A 3BV9B 4B2BA 2BX4A 1DS2E 1GHBG 3N7DA 1MD8A 2D8WA 4INHA 5E0HA 1MBMA 4NIVA 1P3CA 2WYJA 1EP5A 3A89A 2UUFB 3KQCA 2XRCA 1C5OH 4K69A 5JBBS 3SUEA 3QO6A 4DT4A 4CRAA 4UONA 1MKWK 1K1OA 3GS9A 4BAQB 1GJ6A 1SI5H 3D62A 1O3OA 3TGJE 1L2EA 3F9GA 1SGEE 3U8TH 1CHGA 4FUCA 1CHOG 4I7YH 1JOUB 3MMGA 1EJMA 2YNAA 1P8VC 1C4U2 1HRTH 2HOBA 2SGFE 1G3CA 5KEDA 1D3QB 4K1SA 2BZ6H 5FXLA 4TY7A 1DY9A 4DY7B 2VGCB 4WH8A 3RUOA 1V2JT 2ZQ1A 1T4VH 4K5ZA 3ZVBA 1N1LA 4E06H 3RXRA 4ACBA 3V3MA 1BTWA 1MQ5A 1UVUH 2R0LA 2HLDD 4ISLA 1H8DH 3A7VA 1C1TA 1GJ5H 1P09A 4JZFH 1BMMH 2OC7A 4B74A 4Z1MD 2W3KA 3BEFB 3DHKH 2BB4A 1AZZA 4NGAH 1DUEA 1HJAC 2QF3A 4Y76A 1RIWB 1AWFH 1VITF 3RXJA 1EJNA 1BB0B 3EE7A 3FVFB 3SJOA 3U9AH 5JB8S 1AZ8A 1RTLA 1AQ7A 5JPMH 4U2WA 4Q80A 1SGRE 1QHRB 1S85A 3SGQE 3DA9B 4ZKOU 1XUKA 4BTTB 4DW2U 1EASA 2PUQH 1EOJA 3DUXH 1GJAB 1NFWA 1AUJA 1IHTH 4GUXA 1G9IE 2TGDA 2XXLA 1QGFA 1Z1JA 3S9BA 1BRBE 5DP3A 2W7SA 1GJ4H 1G2LA 4IGDA 3TJNA 2G55A 1Y3YA 3LGUA 5I25A 2CV3A 4FVBA 1S6LA 2ANWA 3VB5A 1W3CA 2P94A 2FEQH 2Z94A 2BX3A 2XYAA 5DG6A 3E8LA 1CT0E 1FPHH 4YT7H 2A2XH 2ODYB 3EDXB 1IQEA 1C1NA 3STIA 1TNHA 3GCHB 4NSVA 4Q2KA 3TJUA 2WUBA 1A7SA 2BQWB 1GJ7B 2HPPH 2FOCA 3K9XB 1DXWA 4IMQA 1Y5UT 1Q31A 3RC4A 3GY3A 1AD8H 2V3HH 4LXBH 2WHXA 3MNXA 2PR3A 3MU8A 5C94A 2GDDA 2TRMA 2HGTH 3RM2H 4AYVB 4SGAE 2GVFA 1O2LA 3NXPA 1HCGA 3GY6A 1MTSA 1FJSA 1S84A 5GXPA 1GHYH 1FMGA 3SV2H 2FOMB 1SG8B 1XUIA 1TPOA 4KKDA 1HAZB 3A8BA 3F68H 2AMQA 6CHAC 1RD3B 4I86A 1C2KA 2IOTA 2SGQE 1TGTA 2ZHDA 1HAXB 1ZMLA 5EXNA 3TVJB 4X6MA 1CHOF 1O3MA 4WMDA 1MBQA 4ASUD 4ABAA 2ZHQH 3K65B 4A1VA 2WV9A 2ULLA 5EQRA 1Y3VA 1NBMD 1NRNH 5CDFE 3ZZ8A 2F43B 1MMJN 2IPHA 3EAJA 4Y6DA 2BVRH 3DSPA 1V2UT 2FOEA 1HGTH 4Q7ZA 2ZDLA 1YKTA 2ZFQH 5LPEA 2HRVA 2SNWA 4JYTA 1H8IH 3SGBE 1THPB 1A3BH 2ZFPH 1NM6A 3SNCA 1G3BA 1WCZA 1GCTB 1S6FA 4IC5A 2EY4C 1VGCC 1EZUC 1O0DH 3MH6A 3KYFA 4AYYB 2BDIA 2PKSB 1D6RA 1F5LA 3LPRA 1VITH 5ESBA 3SNBA 1GL1A 1KDQB 1P11E 1DWDH 3M7TA 1AKSB 1ETTH 5G4BA 1SKYE 2GT8A 2YMSC 1V2PT 1PPHE 1EX3A 2KCPA 4WXIA 3RU4E 2LELA 4BAHB 1FX0B 1TA2A 5EU8A 1WYKA 1V6DA 4ABHA 5ETXA 4F55A 3OY5U 5FPTA 3P6ZB 5SGAE 1BMNH 1BRCE 3SW2B 2OC8A 4ZHAA 2CJIA 1C1WH 2ZGCA 3RXHA 2JETB 1A0HB 2BXTH 4H42U 2A2QH 1EPTC 1ESAA 5C20A 5EJZA 2BY5X 4RKOB 3SJIA 1A2CH 1MUEB 3FANA 3VXEH 5DP7A 3KYGA 2PKAB 1C2EA 1QTFA 3PMJA 1QB1A 1TNJA 1ELFA 2ZGHA 1EZQA 3VG8A 1XVOA 5T6DA 1YPGH 4B6FA 4YOJA 3HK6B 3BG8A 2RCEA 4XDEA 4THNH 1OWEA 1TGSZ 1AUTC 1CA0B 1S6HA 1NTPA 3M7UA 1YCPK 2ANMH 4DOQA 3MNSA 5F6MA 3UNQA 1L4ZA 2A1DB 2JKHA 4O3UA 2QA9E 3V0XA 1Z6EA 2GX4A 2RDEA 3IWMA 2FOAA 1TGNA 3TU7H 1T8LA 2VJ1A 3KNXA 3VGCC 2Y5GA 1GBMA 1AGJA 1HBTH 1W0KD 1PPBH 2A5IA 1DDJA 1GJBB 1P0SH 1GJ8B 4D76A 3PWCA 1QBOA 1G3DA 2CK3D 3NUMA 3OFND 1VJAU 5C1XA 2ZDVH 1ZTJA 2RA3A 1YPEH 5E2PA 2Z7FE 1E37B 1H9LB 1KDQA 3PTBA 1F5RA 1UVSH 3P17H 1O5EH 1C5TA 1SVPA 5CE1A 3DD2H 2ZFTA 4XOJA 1IQFA 1WSSH 1HAIH 2D1JA 1O3AA 1DE7H 2TGPZ 1TOMH 1F0UA 1EUFA 1AN1E 3RLWH 3ZIAD 2QF4A 1SMFE 2CN0H 1DICA 1FONA 2WV4A 4GCHG 3KN2A 5J4QA 4AFZA 1O3IA 4BAOB 1ARCA 2EA3A 2Z9LA 1BTYA 1CE5A 1W0ZU 1ZTKA 2DE9A 4DURA 1XMNB 2ZECA 4KELA 1JIRA 3E90B 1OHHD 1C1OA 2XWAA 3FP8E 2BY6X 2FOHA 5DO4H 3A83A 1NZQH 2O8TA 1SHYA 1KLJH 5HXFA 1O3LA 1ZMNA 1T32A 1C2GA 3BEIB 4ESTE 1GHVH 3LT3A 1C1VH 2A4OA 3MNBA 3SV9A 1DPOA 4O3TA 5DP5A 1NPMA 3ZVCA 5B6LA 1NFUA 3RXLA 1O2ZA 1O5FH 1E79D 5EGMA 1AWHB 1C2IA 2RDLA 1GVLA 2F3CE 3MOCA 2AIPA 2FS9A 4Y8ZA 5GIBA 2B5TB 1GMHG 4JYUH 1O2RA 1K1PA 3PRBA 1BQYA 1O5CB 3BTHE 2LNCA 2OINA 3BN9A 1IQKA 3M5NA 1OWJA 1C2FA 3PV2A 1F92A 4ZHMU 3SHCH 3QGJA 2Z9GA 3EA9A 2BMGB 2Z3EA 1FAKH 1C2MA 2IJOB 2BY8X 3D65E 4NZQA 1A3EH 4Y0ZE 1T4UH 2GCTC 1O2QA 4WH6A 1HFDA 4X1NU 2ZPQA 1DFPA 3T5FH 3NZIA 3C1KA 2OLGA 3HKIB 4UFEH 2R3YA 1O32A 2J38A 1FY1A 5A8YA 2P16A 4MLFB 2C4FH 1D3DB 4FUFA 1C5LH 1WQSA 3GY2A 1D3TB 3KGPA 2R0KA 3UR6A 1GDUA 5FBIA 2J97A 1T7CA 1S5SA 1W8BH 3GYLB 5A09A 1N6YA 1QFKH 3UQOA 1ZSLA 1O2PA 1TNKA 1GJDB 1LHFH 3SUFA 1GHZA 3TH2H 1E38B 2B8OH 1G36A 1TMUH 3LU9B 2OQUA 1P2MA 1UTQA 2BDCA 3OX7U 4FUIA 1HAVB 3RXIA 2EI7A 2FI3E 1AVXA 3GICB 3M61U 5C0TA 1LPKB 3TH4H 1N8OC 9LPRA 3MYWA 1O39A 2VIQA 3KHVA 1PYTC 4UE7H 3FN8A 3T29A 3PO1B 4GCHF 4HGCA 2HWLB 1BHXB 5DPAA 1OP8A 1ZYOA 1TWXB 3SUGA 3FP6E 3BF6H 1GVKB 2B0FA 4B71A 1TX8A 1YPKH 4I8JA 3MU1A 3R3GB 1NT1A 2VB0A 1UK4A 3Q76A 2Y5HA 2NU1E 4NCYA 1A61H 1HDTH 1IHSH 2G81E 4R8TB 3PMHB 4TPIZ 2QXHA 4CRBA 3VB6A 5JBAS 2WSSD 3TH3H 4HFPB 1A5IA 2Y80A 3A8CA 2VU8E 1NESE 3ZZAA 1P12E 2JDID 2XOKD 1SGFA 1IQNA 4ZCNA 2BOHB 1RTKA 1OWKA 1UHBB 1QIXB 4YOIA 1K0HA 3SU6A 5B6OA 3ZVFA 3RXAA 1GI7B 4WY3A 2F9UA 2PSXA 2XCFA 4F48B 2CGAA 2AIQA 4OS2A 3MTYA 1SGYE 4ABIA 3KF2A 1C5YB 1SQOA 2ZHFH 1QRWA 4X2WA 2CXVA 5KGOA 2J9NA 4Y7BA 1GBLA 2XBYA 1T8NA 2SGAA 3E91A 2JH0D 1TFXA 6GCHF 1MKXH 4OGYA 2HVYB 1G2MA 1FXYA 1QA7A 3O8CA 1BBRE 3RC5A 4ISHH 2SGDE 1HNEE 1XKBC 3LGTA 1S0QA 1YPMH 2PTCE 4OS7A 3H09A 4K1TA 4CRGA 3F3BA 3GDVA 1ZHRA 3MWIU 2QN5T 3K6YA 1O2VA 2AGIX 1O2KA 3UTUH 3SJ8A 1L1GA 2HVXA 1PFXC 5CHAC 1CBWC 2I6SA 4LOYH 2FYRA 4JK5A 2BD4A 2YOLA 5F53A 3CNRA 2Y7ZA 2O8MA 1G37A 2STBE 2QIQA 1OXGA 4K3JA 3M37A 1ZZZA 3EQ0H 3FOAA 3BTME 3TGIE 1SOTA 1ZJKA 2BDGA 1YY3A 1PPCE 4Y10E 1O3CA 5T1VA 2KAIA 3ZZ5A 1F0RA 4ABJA 4Y8YA 4ABEA 1BRUP 2H1UA 1O3PB 1GCDA 4YT6H 5HKKD 1B5GH 1UMAH 3LH3A 4O97A 3RMNH 2ZU5A 1NU7B 1AVWA 1TRMA 2V3OH 3A8DA 3UWJH 3UY9A 3HK3B 1C5MD 6ESTA 1O2OA 3T27A 1BMLA 4AG2A 3OTJE 2Q6GA 2VWOA 4LZ4B 1GI6A 1TBZH 3PMAB 2K1QA 4ZROA 4CBNA 4INKA 1CSOE 4JMYA 1YC0A 2BYAX 2J95A 1QY6A 1UTNA 2F9PA 4I8GA 1FY4A 1UHBA 2FZZA 4H4FA 2PTNA 5FX6A 5LPRA 5C67A 1P10A 2ZU2A 4FETA 2F9BH 2ZZUH 4VGCC 4D7FA 2P8OC 2WUCA 2Z9IA 4FUDA 2ZFSA 4FU9A 5TCCA 2C3SA 4ISIH 3BTGE 1MQ6A 1P01A 4U32A 3V13A 4DJZB 1LCYA 3SOSA 1VCPA 5HM2A 3PTNA 3RC6A 3F6UH 3UAIC 2DUCA 1L0ZA 3LIWA 1NS3A 1ANEA 1O3FA 1P2QA 4RSPA 4TYDA 3ZZ7A 2GCHG 1FN8A 1NRQH 1AB9C 2PP6A 2ZC9H 4ACAA 1W12U 1ZR0A 1UVPA 1O2XA 3H7TA 3L33A 1K1LA 1G3EA 1HXEH 1W14U 2A4QA 2KCOA 2UWPA 4X1QU 2HLCA 1P9UA 1RTFB 1QNJA 5EIYA 1GBAA 4BTIB 3SZNA 3S9CA 1OX1A 1W11U 1O31A 4XBBA 2VH6A 1DXPA 3SV7A 1MABB 1HAPH 1A1RA 1KLTA 5E0GA 2P59A 1C2LA 3WWBA 2NU3E 2C8YB 1ACBE 1E35B 4TWWA 8GCHG 2QC2A 1W7XH 6CHAB 3PV4A 2DE8A 2FIRH 3GCTF 1GGDC 2FDAA 5TCAA 8LPRA 4FUEA 1K1NA 3SI3H 2I6QA 2BD3A 1TYNA 1NRRH 2BDAA 2V6NA 2TBSA 2Y7XA 1K1MA 1DWBH 5EW1H 1GMCG 1Z7KA 2F4LA 1O3NA 3RXOA 4LZ1H 2AMDA 2OUAA 1OWIA 3ENSB 5HMAA 4GAWA 4TSFD 4ZAEA 3Q77A 2NU0E 3S0NA 1AIXH 3RXGA 6LPRA 3A7WA 2XBVA 3ZV8A 1JXPA 5AVDA 4MG3A 3A7ZA 1LQDB 5DP8A 5LPFA 2A5AA 2W7UA 1NRSH 1EFRD 4ZKSU 1C5NH 4UDWH 4Y79A 1CGHA 1DLEA 1VGCB 4NSYA 3K6ZA 2ALVA 1M9UA 2F9OA 1TRNA 3F0OA 2RFKC 2QYIA 1O5BB 3UREA 4CHAC 4X1PU 4JZEH 1C5ZB 5EG4A 1IAUA 5IDKA 2BM2A 3KIDU 2ZPSA 1P3EA 3RXPA 2YMSB 3QTVH 1SFQB 2FM2A 4YOGA 3GY5A 1DSUA 4Q4LA 1Y5AT 1JBUH 1EATA 1P06A 1Z71A 3LC5A 1LPGB 1HLTH 1CVWH 3DFLA 4X1SU 3MU5A 2OK5A 1K22H 1TMTH 4X1RU 2FTMA 4JZDH 2VNTA 2Y81A 1QRXA 1GHBF 3M7QA 3RU4D 2OXSA 1WQVH 1FAXA 2J34A 3BTEE 2IPQX 2UWOA 2VBCA 1EPTB 2Z3CA 2H6MA 2OTVA 1YLNA 1H4WA 2PGBB 1ETRH 1FQ3A 3W95A 1ZLRA 5C2ZA 4E7NA 3TITA 4P02A 3ZVGA 1KXBA 3RXKA 1L1NA 1GBBA 3LJOA 1H8HD 1ELAA 1ZGIA 4BAKB 1GDQA 3ATKA 1T8MA 2ZGBH 1C2DA 1RS0A 3KQBA 4RKJB 5FPSA 2QXGA 4OS1A 2VIOA 1YF4A 1MH0A 1TX7A 3RMLH 2AFQB 3P92A 4CREA 1V2QT 3P8GA 3DT0H 1SGCA 2F83A 2BQ7B 1MCTA 3M3TA 1MTNC 1J15A 3GY4A 1D4PB 1HIAB 1PPZA 1MTUA 4TT3D 4YLQH 3H5CB 1KXFA 2GP9B 3ZZCA 2J92A 5AFYH 2VIDA 4OS6A 5A8ZA 3U8OH 4CR9A 4NA7A 3MH5A 3QTOH 1A5HA 4E7RG 3BG4C 2AMPA 1GMCF 3VGCB 1EP6A 3SHAH 5ABWA 3RXTA 1EAUA 2KCYA 1CO7E 1J9CH 4YTAA 7KMEH 3ZVEA 3KQDA 1Z1IA 1CA8B 4MPWA 2GV6A 5FHTA 3S69A 1GBJA 2J4IA 4WWYA 4X8SH 1QJ7B 1NN6A 3EA8A 5DK1A 2W6JD 1LKAA 1KMHB 1W0JD 1OPHB 1Q3XA 4GPGA 1A46H 1IQIA 3ZZ3A 3WW7A 3L6PA 2G00A 1OKXA 5IYTA 4DG4A 2GJGA 1BCUH 5LGOA 3QUMP 1YPHC 1UCYE 3F2GA 2SGEE 4I8LA 1ZHMA 2ZU4A 3MO6A 1OYTH 3ZV9A 1S82A 5EODA 2A7JA 3QDZB 1UTJA 3A87A 1E0FD 3HATH 5EPNA 1HUTH 3TK9A 4K8YA 2B9LA 3KCGH 4ABBA 4BAMB 4FVDA 4MDSA 2EI8A 3AK5A 2PWXA 4UFGH 3E3TA 2IN2A 1J8AA 1BTUA 2FX6A 2K8IA 1INCA 1NFYA 2A4RA 2CHAC 1NBME 3LONA 4NIWA 2P3TB 3UNRA 1WAYB 2FOGA 1EAIA 3TK6A 7ESTE 4B73A 1GI3A 2ZKSA 4TY6A 3UIRA 1MZDA 2GT7A 1KY9A 3C27B 1E34B 1ABIH 2LPRA 5GDSH 4Y71A 1FLEE 1LVMA 2AHME 4ZUHA 1EB1H 5DP9A 2HNTC 1JRTA 1V2ST 3VB4A 2ZPRA 1KYNA 3I29A 3ODDA 3QZRA 1QJ1B 1BTXA 4NFEA 1LHDH 1SGIB 4H6TA 3OYPA 2BY9X 2Q6DA 1DLKB 1SOZA 3F2HA 2CF8H 2ASUB 4IC6A 1ARBA 1XXDA 4M9FA 3KL6A 2QAAA 4KTUA 2C93B 3I77A 4ZKNU 4CH8B 3TNTA 4XBDA 3P8FA 1GCTC 1LO6A 4MPXA 3TIUA 5AHGH 3UFAA 1ID5H 1AKSA 1TGBA 3PWBA 3NCLA 4UEHH 5HIZA 1AE5A 2NWNA 3PB1E 1DVAH 2TGAA 1T8OA 1V2VT 1WV7H 2OBOA 1C4V2 4F4OC 2BZAA 5C0UA 1W2KH 3NPSA 1V3XA 2R3UA 3B9FH 2EQNA 4M7GA 1MKWH 2STAE 1QRZA 2QF5A 1TLDA 1GPZA 3MNCA 3A81A 3RXFA 1WTHD 4FXGH 5DN6D 1SGFG 2KFWA 5H4IB 1O34A 3Q00A 1XKAC 4P00A 3OY6U 2ZDAH 2ODQA 3RXQA 2RG3A 3S9AA 2BD9A 5K7RA 1YPHE 2VVVA 2G4UA 1QR3E 1O3GA 2THFB 3SNEA 3RXSA 2A32A 5GCHG 2PHBA 1L4DA 2CF9H 2RA0A 1BTZA 3MH7A 2WPMS 1FNIA 1TBQH 1GMDG 1Q2WA 2JH6D 2QY0B 2PKAA 3SV6A 1YPLH 2P93A 2WPIS 1QA0A 2J94A 1ZGVA 3U8RH 5A0BA 2PLXA 3O8DA 2ZGJA 1N8OB 1O2YA 1JWTA 1QB6A 3LH1A 3VXFH 4D8NA 1Y3XA 3ZZ6A 1GHAG 3F9FA 4A6LA 2WPKS 3A84A 2FMJA 2F9VA 4UFFH 5EJ1A 1GBCA 3SU5A 1CT2E 1NY22 3PRDA 3RXCA 5DKMA 1Y59T 4FUHA 5A0AE 3URDA 5L2ZH 4MNXA 4MPUA 3UUZA 1C5SA 1K21H 2XW9A 2SNVA 1HB0B 1TALA 4MNVA 2FWWA 2BY7X 4GHQA 3WY8A 7GCHG 1ESBA 5A2MH 5HM9A 4HG6A 3M5MA 4Y11E 3V12A 5IK2D 1QQUA 1TRYA 2Z6BD 3VFEA 3A8AA 1SHHB 2OCVB 1LDTT 5GPIB 1GI2A 5EQQA 2A4GA 2GD4B 2ZFFH 1TPSA 2AH4X 2J2UA 4X2VA 3SGAE 3ESTA 2ODPA 3F1SB 4Y8XA 1Z8GA 4XSKU 3UR9A 1O5DH 4HTCH 2M5TA 1TONA 4DGJA 4X6OA 1DSTA 1EAWA 4JYVH 2J98B 1D6WA 1BTPA 2VIVA 3SN8A 5L2YH 1G30B 1JMOH 1W13U 3UOPA 3G01A 4RI0A 3WWFA 1TBRH 1H9IE 4FU7A 3SQEE 1XXFA 3NWUA 2ZGXH 4A92A 4O03A 4AB8A 1TIOA 2O8WA 1P02A 5ESTE 1NO9H 1Z6JH 1C5RA 1UK2A 7LPRA 1Y5BT 2OP9A 2ZWLH 3DCLA 4CBOA 9ESTA 1W0YH 1AFQC 1QZ8A 2L6OA 5CHAB 2D2DA 1CBWB 5DGJA 1RXPA 3LKWA 2TGTA 2A7HA 4AFSA 3W1EA 3T25A 4ASHA 3U1JB 3PROA 3TJOA 3GY8A 3RU4T 1SL3A 2GGVB 1SFIA 3RDZA 3ZZ4A 3IITA 2EEKA 1P2OA 2XNIA 1CT4E 1XM1A 2XC5A 1IQHA 4ABFA 2ALPA 1C5UA 5K0HA 1FY3A 1E1RD 3LGYA 1ZSJA 4NA9H 2Q1JA 4JK6A 1OSSA 1O35A 1OYQA 1O38A 2H9EH 2KZ4A 2W5EA 3GOVB 2TPIZ 3A86A 1FPCH 1J17T 4FU8A 2FESH 1GBDA 3A80A 1HAOH 3F9HA 4RT0A 1QURH 5FCKA 1F0TA 2A0QB 3URCA 3U98H 5JBCS 1BBRH 1O2JA 2ZG0H 1JRSA 5DSFA 1C5QA 2GV7A 4NFFA 2O8UA 2G8TA 1XUJA 1GMHF 5LH8A 5EOKA 1SQAA 2QE7D 3MU4A 5BRRE 3SQHE 2BDBA 1ELBA 4VGCB 1TA6A 2P8OB 3ITIA 1A0JA 1BMFD 1YLDA 4ISNA 1O37A 1BA8B 2Z9KA 1K28D 1YLCA 1DWCH 2QCYA 3GY7A 3B23B 4MTBA 2QXJA 5JYIA 1O3JA 1NC6A 2YNBA 1V2NT 2VVUA 1UTPA 4HZHA 1MTWA 2KM0A 4CH2B 1WU1A 1AB9B 4BNRA 3Q3KA 2QV1A 4JZIA 4KTCA 3U28C 1B0EA 1PQAA 1O2MA 2ZDMA 3SJKA 3H7OA 1MAXA 3LC3A 1HAVA 4X2YA 5HGGA 2H9HA 3VPKA 1BITA 1QL8A 2ZU1A 1Z8RA 5TJXA 3QGNB 1ELEE 4X8VH 1OP2A 2ANKH 4ZHLU 3LGVA 2PFEA 5FAHA 4AB9A 2FYQA 1NU9A 1O2GH 2Y5FA 4X6NA 3M36A 1SGTA 3SU2A 3SYJA 2G52A 4QT8C 5T6GA 2JJ2D 5EJLA 1YCPH 3NRLA 4K2YA 1BRAA 3OTPA 4DT7B 3PLPA 1VKYA 2BD5A 2ZDNA 3W94A 3KQEA 3SBKA 1VITG 1IQMA 2GMTC 4Z6AH 3A7XA 1HJAB 1NFXA 5F8XA 5DJ7A 3RMMH 1EQ9A 1FIZA 4IW4E 2V7QD 3PLKA 4FUBA 3A7TA 1UTKA 4NIXA 3S7HB 1FIWA 4GLYA 1HYLA 1O2IA 3DSGA 2IJD1 4OS5A 1ABJH 3EGKH 2K0QA 2ZCLP 4Z0KA 4ZKRU 2ZTXA 2PSYA 3QZQA 3SUDA 3SU1A 2KX4A 1GBIA 1FI8A 3E1XB 5EXLA 3RXVA 1SLXB 3FZDA 4LK4A 1VZQH 1P2IA 1THRH 1C1PA 1PPGE 3OEED 5BPEA 4CHAB 2GTBA 4ABGA 3SNAA 2A5KA 1ANBA 5JB9S 5HYOA 1SLWB 1TAWA 4YESB 1UVTH 2P95A 3EE0B 3HGNA 1TABE 3A7YA 1TX6A 4JZ1A 1GI0A 3TJVA 1QJ6B 1GG6C 3M3VA 1C5PA 1ZPZA 1KLIH 4KTSA 2L74A 2QXIA 1V2OT 2BOKA 4MNYA 4GSOA 4R0IA 5E0JA 2ZU3A 1EXFA 4Q7XA 2WPDD 2FX4A 3RXUA 2Z3DA 1ANDA 5L30H 1UTLM 3M5OA 1GL0E 1ELVA 5GWZA 1MU8B 4CRCA 3SO3A 1ZRKA 1TPAE 1ZPCA 2UUKB 3N7OA 3M35A 3ODFA 1GVZA 1F7ZA 4Y7AA 1SLVB 4E05H 2H9TH 2BVSH 3D49H 1LVBA 1O2TA 3A88A 3GCNA 4MQAA 1PPFE 2KCAA 1HPGA 2ANYA 1WOFA 3AW1A 2H2ZA 4YXWD 5AFZH 4D9RA 2AEIH 1KXEA 2FODA 2LP6A 1BMAA 4X0WU 1O3BA 1DY8A 3Q3XA 3GISB 1O3DA 1GWAA 2GZ7A 4UFDH 1MTNB 4BXWA 1C1QA 4ZH8A 4RN6A 1WDIA 1W10U 1XX9A 2P3FH 1ORFA 1SSXA 3DSOA 3P8NA 3NKKA 1O33A 2BHGA 3BG4B 2CMYA 4NWKA 5FPYA 1XUGA 1DANH 1MAYA 2VWMA 5C3NA 1GI1A 1DITH 5JBTA 1O2WA 4J2YB 1O2HA 2UWLA 2SFAA 2ZNKH 3MU0A 3BTKE 2VWNA 3VEQB 2BLQA 4DVAU 1DX5M 2H5DA 2Y6TA 1D9IA 1C5VA 2FOFA 1GI5A 3LDXH 3BSQA 1SBWA 1U6QA 1YBWA 1QB9A 2G51A 3A82A 1WTGH 1HJ9A 4B6EA 4AZ2B 5CHBA 3VB3A 1TNLA 1DOJA 1FDPA 3PYHA 1KXCA 3E16B 3QK1A 2GCHF 3FKSD 1O2UA 3E0NB 5E8EH 1IQJA 2VINA 4A1XA 3RM0H 2AERH 3V7TA 5L6NH 3PMBB 1P57B 4XE4A 5DP4A 4XRNA 2O8LA 4X8TH 1O2NA 1LHEH 5PTPA 2VGCC 3KQ5A 1YYY1 3A85A 1HAYB 3ATIA 1C4Y2 1SGQE 2A7CA 4UD9H 1TQ0B 2CHAB 2ZDKA 1MCVA 4O9VA 1DWEH 3JZ2B 1GI9B 1AU8A 3U1IB 1O36A 1TQ7B 4MVNA 4BOHA 1TGCA 1SQRA 2C90B 3OSYA 2ESTE 3MFJA 8GCHF 2Q6FA 2OQ5A 1TNIA 3QWCH 1EKBB 1MU6B 1V2TT 3BIVH 1DM4B 1HV7A 5E2OA 2KR7A 2AGGX 2Y82A 1H1BA 1RIWC 3DFJA 1ZTLA 2R9PA 4WJG2 3TK5A 2VIWA 3LGWA 1T31A 1J14A 1QBVH 1UK3A 3FP7E 4B2AA 2QF0A 2FPZA 1GJCB 1LKBA 3MI4A 2BD2A 1GI4A 1S81A 4FOUC 3CS0A 2BD8A 1UVOA 3E6PH 1UCYH 8KME2 1N6XA 2ZHWH 2VWLA 1C1UH 5EXMA 1LTOA 1NROH 2BLVA 3VB7A 2HALA 3STJA 1YPJH 5EW2H 2PV9B 4IN2A 2VIPA 1MTVA 3T26A 2G5NA 3P8OA 4A7IB 1O2SA 1VJ9U 1ZHPA 1BBRK 1VCQA 3D23A 4NIYA 1KXAA 5FBEA 2M2AA 3M3SA 3MO3A 1K1IA 2A45B 2HNTF 2WPHS 4AFQA 4SGBE 3BTFE 4B75A 4FUJA 1SR5C 2YMSD 3RXDA 3GCHC 3QN7A 4WVPE 4GHTA 2UUYA 3BTWE 1J16A 1O5GH 1O3KA 2BQ6B 1V2LT 2BTCE 3OE7D 2BLWA 1EPTA 3F2FA 1MKXK 2AGEX 1KSNA 1VR1H 1QQ4A 2WINI 3EA7A 1S0RA 4Q7YA 3EYDA 3UNSA 3SU4A 3P95A 4X6PA 4AX9H 1BOQA 1EZXC 4MPVA 4FUGA 1ANCA 3T62A 2FI5E 1PQ5A 5A8XA 1WBGB 2H5CA 1F5KU 4NZLA 1BDAA 1YM0A 4XFQA 2XBXA 1IQGA 4I33A 1SPJA 4D9QA 2ZIQH 1LVYA 3HGPA 1KXDA 2D26C 1C1SA 5AF9H 1C5WB 1HIAA 4TPYA 2NU2E 1FN6A 1K1JA 4XBCA 5F8ZA 4Q63A 1THSH 1HJ8A 3QLPH 1EAXA 2ZTZA 4OM9A 1S83A 4AFUA 5FL7D 1SGNE 2XC0A 1Z8IB 3OEHD 1BJVA 1FZZA 2GCTB 2G4TA 1HAHH 2ZP0H 1ZOMA 1G32B 3ATWA 3LOXA 1O3HA 1Y3WA 2ZTYA 4I8HA 2PKSC 2OC1A 2TIOA 5HIYA 4IBLH 3RXBA 2WPLS 1BZXE 2W3IA 3Q3YA 3P70B 5T3HA 1P2KA 1V2RT 1K9OE 3AAUA 3PV5A 2PW8H 3MQKC 1BJUA 2WYGA 2OC0A 1UW7A 2PUXB 1P03A 4WF8A 2BD7A 4RT1A 3TLOA 4DCDA 1UTOA 3NK8A 4K8BA 4HI3A 1KTSB 3N7EA 3S7KB 2JH5D 2V0BA 4U30A 1XUFA 1ZRBA 1ZPBA 1MD7A 3ZVAA 3ZZDA 1UTMA 2GZ9A 3UWIA 1P05A 2JETC 1O30A 4ABDA 3FAOA 5A0CA 2J5UA 1AFQB 3LJJA 2FP7B 4AOQA 2FLRH 5FX5A 4I8KA 3BTTE 2V35A 1EOLA 3CP7A 1RFNA 2XNDD 1P2JA 1IOEA 4B2CA 1ETSH 2BDYA 3T2NA 1GDNA 1BIOA 1TB6H 1CA0C 4GVUA 1W7GH 2PGQB 3RXEA 2BDHA 2ZF0H 1CGJE 3UQVA 3I78A 3TPIZ 2VH0A 2HNTE 1LHGH 4NA8A 5C5OA 1YCPM 3SU0A 1YWUA 1CGIE 1AO5A 1C9PA 5F03A 5EQSA 3T28A 4WMFA 4DIIH 1PQ8A 2OBQA 2ZCKP 5GNDA 2FTLE 2XBWA 3UOUA 3UB0A 4F49A 1TPPA 1H8ED 3GYMA 3RXMA 4AC9A 4J1YA 1LHCH 1AFEH 2FI4E 1TOCB 2ZO3H 8ESTE 3MO9A 6GCHG 1ELGA 1FV9A 2JIZD 1LVOA 1XUHA 1V2WT 1RJXB 1ELTA 2GKVE 1O3EA 3QX5H 1X7AC 1K2I1 1L1JA 5J4SA 1TNGA 1SC8U 3PLBA 3FFGA 3ELAH 1A5GH 3GDSA 1PQ7A 4OS4A 4NWLA 4AGKA 1FUJA 1H9HE 4AN7A 4IN1A 2A31A 3M5LA 1DT2A 2XWBI 1BUIA 1TE0A 1UO6A 2QGRA 5T6FA 4BXSA 1YP9A 1Z8JB 3F9EA 1QCPA 1TMBH 1ZJDA 3BIUH 3ATLA 2W26A 1BT7A 3AW0A 3MH4A 3TGKE 1OWHA 4CRDA 1VCWA 3ZZBA 5GCHF 1GJ9B 1B0FA 3HPTB 2AYWA 4NG9H 1GMDF 4AGJA 1AE8H 1LPZB 3JZ1B 3SJ9A 1SB1H 2R2WU 1D3PB 1E1QD 4DIHH 4K1EA 4D7GA 1UJ1A 1O5AB 1HXFH 4U01A 2G5VA 1XVMA 1PYTD 4Y0YE 1EB2A 4WMEA 1GHAF 2GMTB 3OU0A 3U69H 1GBTA 2KAIB 1COWD 1F0SA 4TWYA 4YLUA 1CQQA 3BEUA 4OGXA 3ZYDA 3N99A 3ZVDA 1LMWB 3L3TA 2EI6A 1AHTH 5KECA 2BLOA 1GBEA 1Y8TA 1C9TA 1Y3UA 3GDUA 1IQLA 2WPJS 4ZXYH 1ZSKA 3HKJB 7GCHF 4MNWA 3CENA 4BANB 1E36B 4YZUA 2O9QA 3ATMA 3RLYH 2FLBH 4INLA 3KEEA 2FOBA 3BTDE 1BHXF 2UUJB 5EPYA 2BXUH 2J98A 1V2MT 4B1TA 2WZQA 2JJ1D 5FCRA 2Z9JA 1QBNA 3AASA 3SV8A 3SI4H 5C5NA 1CU1A 2ZFRH 4YO9A 3LGIA 3SNDA 4CRFA 4X8UH 1UCYK 2BVXH 1P9SA 3GCOA 4I31A 1KTTB 3IG6B 2C8WB 3FO8D 4AORA 1GHWH 2WV5A 1HAGE 1GG6B 2SGPE 4KP0A 1EZSC 2ZQ2A 2VVCA 1EJAA 4IMZA 4I32A 1AVGH 3SORA 4XD7D 2F9NA 2GDEH 2XTTB 5C1UA 3BTQE 5I46H 2R2MB 1WXRA 1SGDE 1MZAA 2NU4E 3SZEA 5JDUB 1JIMA 2C8ZB 3F0PA 3RP2A 4X2XA 4A5TS 1ELCA 5GJ4B 4WXVA 4B76A 2ZA5A 3GCTG 1ELDE 1FY8E 3K2UA 3O8BA 3OAAD 4K60A 3AAVA 1FY5A 1OS8A 1AI8H 4ZXXH 2ZHEH 4CR5A 1A0LA 4AG1A 1GI8B 4ZMAH 1C5XB 3E0PB 3PM3A 1GGDB 3PO1C 2ZEBA 1QL7A 3MHWU 1OP0A 2P3UB 1YGCH 2AS9A 2OD3B 2EC9H 4JCNA 1C1MA 2FO9A 2XC4A 1B7XB 1GBKA 4IS5A 1A4WH 3B8JA 4H6SB 3TNSA 1GBHA 2HPQH 3R0FA 1BTHH 1V2KT 2ZCHP 2FS8A 1RRKA 5DP6A 4BTUB 1PJPA 1F2SE 4PROA 3CS7A 1WUNH 1C1RA 2GZ8A 4YM9A 1AY6H 3UPEA 1SGPE 2W6ID 1OWDA 1SLUB 2C8XB 1KIGH 2XCNA 3FZZA 1ESTA 2ILNA 5C17A 2F91A 3RMOH 5CMXH 5C1YA 1SQTA 2V3MA 3SU3A 3AVZA 1RGQA 1DUAA 1NRPH 1P04A 1GBFA 4KGAA 1LQEA 2B7DH 1OOKB 1C2HA 4A1TA 1GHXH 1ZMJA 3ZZ9A 2FXRA 5F8TA 1P2NA 1AMHA
chains in the Genus database with same CATH topology
3ZYEA 3O8RA 2ZI2H 1PPEE 1C2JA 4ISOA 1QL9A 3BV9B 4B2BA 2BX4A 1DS2E 1GHBG 1MD8A 2D8WA 4INHA 5E0HA 1MBMA 4NIVA 1P3CA 2WYJA 1EP5A 3A89A 2UUFB 3KQCA 2XRCA 1C5OH 4K69A 5JBBS 3SUEA 3QO6A 4CRAA 4UONA 1MKWK 1K1OA 4BAQB 1GJ6A 1SI5H 3D62A 1O3OA 3TGJE 1L2EA 3F9GA 1SGEE 3U8TH 1CHGA 4FUCA 1CHOG 4I7YH 1JOUB 3MMGA 1EJMA 2YNAA 1P8VC 1C4U2 1HRTH 2HOBA 2SGFE 1G3CA 1D3QB 4K1SA 2BZ6H 5FXLA 4TY7A 1DY9A 4DY7B 2VGCB 4WH8A 3RUOA 1V2JT 2ZQ1A 1T4VH 4K5ZA 3ZVBA 1N1LA 4E06H 3RXRA 3V3MA 1BTWA 1MQ5A 1UVUH 2R0LA 4ISLA 1H8DH 3A7VA 1C1TA 1GJ5H 1P09A 4JZFH 1BMMH 2OC7A 4B74A 2W3KA 3BEFB 3DHKH 2BB4A 1AZZA 4NGAH 1DUEA 1HJAC 2QF3A 4Y76A 1RIWB 1AWFH 1VITF 3RXJA 1EJNA 1BB0B 3FVFB 3SJOA 3U9AH 5JB8S 1AZ8A 1RTLA 1AQ7A 5JPMH 4U2WA 4Q80A 1SGRE 1QHRB 1S85A 3SGQE 3DA9B 4ZKOU 1XUKA 4BTTB 4DW2U 1EASA 2PUQH 1EOJA 3DUXH 1GJAB 1NFWA 1AUJA 1IHTH 4GUXA 1G9IE 2TGDA 2XXLA 1QGFA 1Z1JA 3S9BA 1BRBE 5DP3A 2W7SA 1GJ4H 1G2LA 4IGDA 3TJNA 2G55A 1Y3YA 3LGUA 5I25A 2CV3A 4FVBA 2ANWA 3VB5A 1W3CA 2P94A 2FEQH 2Z94A 2BX3A 2XYAA 5DG6A 3E8LA 1CT0E 1FPHH 4YT7H 2A2XH 2ODYB 3EDXB 1IQEA 1C1NA 3STIA 1TNHA 3GCHB 4NSVA 4Q2KA 3TJUA 2WUBA 1A7SA 2BQWB 1GJ7B 2HPPH 2FOCA 3K9XB 1DXWA 4IMQA 1Y5UT 1Q31A 3RC4A 3GY3A 1AD8H 2V3HH 4LXBH 3MNXA 2PR3A 3MU8A 2GDDA 2TRMA 2HGTH 3RM2H 4AYVB 4SGAE 2GVFA 1O2LA 3NXPA 1HCGA 3GY6A 1MTSA 1FJSA 1S84A 5GXPA 1GHYH 1FMGA 3SV2H 2FOMB 1SG8B 1XUIA 1TPOA 4KKDA 1HAZB 3A8BA 3F68H 2AMQA 6CHAC 1RD3B 1C2KA 2IOTA 2SGQE 1TGTA 2ZHDA 1HAXB 1ZMLA 5EXNA 3TVJB 4X6MA 1CHOF 1O3MA 4WMDA 1MBQA 4ABAA 2ZHQH 3K65B 4A1VA 2ULLA 5EQRA 1Y3VA 1NRNH 3ZZ8A 1MMJN 2IPHA 3EAJA 4Y6DA 2BVRH 1V2UT 2FOEA 1HGTH 4Q7ZA 2ZDLA 1YKTA 2ZFQH 5LPEA 2HRVA 2SNWA 4JYTA 1H8IH 3SGBE 1THPB 1A3BH 2ZFPH 1NM6A 3SNCA 1G3BA 1WCZA 1GCTB 1S6FA 4IC5A 1VGCC 1EZUC 1O0DH 3MH6A 4AYYB 2BDIA 2PKSB 1D6RA 1F5LA 3LPRA 1VITH 5ESBA 3SNBA 1GL1A 1KDQB 1P11E 1DWDH 3M7TA 1AKSB 1ETTH 5G4BA 2GT8A 1V2PT 1PPHE 1EX3A 3RU4E 4WXIA 4BAHB 1TA2A 5EU8A 1WYKA 1V6DA 4ABHA 5ETXA 3OY5U 5FPTA 3P6ZB 5SGAE 1BMNH 1BRCE 3SW2B 2OC8A 4ZHAA 2CJIA 1C1WH 2ZGCA 3RXHA 2JETB 1A0HB 2BXTH 4H42U 2A2QH 1EPTC 1ESAA 5C20A 2BY5X 4RKOB 3SJIA 1A2CH 1MUEB 3FANA 3VXEH 5DP7A 2PKAB 1C2EA 1QTFA 3PMJA 1QB1A 1TNJA 1ELFA 2ZGHA 1EZQA 1XVOA 5T6DA 1YPGH 4YOJA 3HK6B 3BG8A 2RCEA 4XDEA 4THNH 1OWEA 1TGSZ 1AUTC 1CA0B 1S6HA 1NTPA 3M7UA 1YCPK 2ANMH 4DOQA 3MNSA 5F6MA 3UNQA 1L4ZA 2A1DB 2JKHA 4O3UA 2QA9E 3V0XA 1Z6EA 2GX4A 3IWMA 2FOAA 1TGNA 3TU7H 1T8LA 2VJ1A 3KNXA 3VGCC 2Y5GA 1GBMA 1AGJA 1HBTH 1PPBH 2A5IA 1DDJA 1GJBB 1P0SH 1GJ8B 4D76A 3PWCA 1QBOA 1G3DA 3NUMA 1VJAU 5C1XA 2ZDVH 1ZTJA 2RA3A 1YPEH 5E2PA 2Z7FE 1E37B 1H9LB 1KDQA 3PTBA 1F5RA 1UVSH 3P17H 1O5EH 1C5TA 1SVPA 5CE1A 3DD2H 2ZFTA 4XOJA 1IQFA 1WSSH 1HAIH 2D1JA 1O3AA 1DE7H 2TGPZ 1TOMH 1F0UA 1EUFA 1AN1E 3RLWH 1SMFE 2CN0H 1DICA 1FONA 2WV4A 4GCHG 3KN2A 5J4QA 4AFZA 1O3IA 4BAOB 1ARCA 2EA3A 2Z9LA 1BTYA 1CE5A 1W0ZU 1ZTKA 2DE9A 4DURA 1XMNB 2ZECA 4KELA 1JIRA 3E90B 2XWAA 1C1OA 3FP8E 2BY6X 2FOHA 5DO4H 3A83A 1NZQH 2O8TA 1SHYA 1KLJH 5HXFA 1O3LA 1ZMNA 1T32A 1C2GA 3BEIB 4ESTE 1GHVH 3LT3A 1C1VH 2A4OA 3MNBA 3SV9A 1DPOA 4O3TA 5DP5A 1NPMA 3ZVCA 1NFUA 3RXLA 1O2ZA 1O5FH 5EGMA 1AWHB 1C2IA 2RDLA 1GVLA 2F3CE 3MOCA 2AIPA 2FS9A 4Y8ZA 5GIBA 2B5TB 1GMHG 4JYUH 1O2RA 1K1PA 1BQYA 1O5CB 3BTHE 2LNCA 2OINA 3BN9A 1IQKA 3M5NA 1OWJA 1C2FA 1F92A 4ZHMU 3SHCH 3QGJA 2Z9GA 3EA9A 2BMGB 2Z3EA 1FAKH 1C2MA 2IJOB 2BY8X 3D65E 4NZQA 1A3EH 4Y0ZE 1T4UH 2GCTC 1O2QA 4WH6A 1HFDA 4X1NU 2ZPQA 1DFPA 3T5FH 3NZIA 3C1KA 2OLGA 3HKIB 4UFEH 2R3YA 1O32A 2J38A 1FY1A 5A8YA 2P16A 4MLFB 2C4FH 1D3DB 4FUFA 1C5LH 1WQSA 3GY2A 1D3TB 3KGPA 2R0KA 3UR6A 1GDUA 5FBIA 3GYLB 1T7CA 1S5SA 1W8BH 5A09A 1N6YA 1QFKH 3UQOA 1ZSLA 1O2PA 1TNKA 1GJDB 1LHFH 3SUFA 1GHZA 3TH2H 1E38B 2B8OH 1G36A 1TMUH 3LU9B 2OQUA 1P2MA 1UTQA 2BDCA 3OX7U 4FUIA 1HAVB 3RXIA 2EI7A 2FI3E 1AVXA 3GICB 3M61U 1LPKB 3TH4H 1N8OC 9LPRA 3MYWA 1O39A 2VIQA 3KHVA 1PYTC 4UE7H 3T29A 3PO1B 4GCHF 4HGCA 2HWLB 1BHXB 5DPAA 1OP8A 1ZYOA 1TWXB 3SUGA 3FP6E 3BF6H 1GVKB 2B0FA 4B71A 1TX8A 1YPKH 4I8JA 3MU1A 3R3GB 1NT1A 2VB0A 1UK4A 3Q76A 2Y5HA 2NU1E 4NCYA 1A61H 1HDTH 1IHSH 2G81E 4R8TB 3PMHB 4TPIZ 2QXHA 4CRBA 3VB6A 5JBAS 3TH3H 4HFPB 1A5IA 2Y80A 3A8CA 2VU8E 1NESE 3ZZAA 1P12E 1SGFA 1IQNA 2BOHB 1RTKA 1OWKA 1UHBB 1QIXB 4YOIA 3SU6A 5B6OA 3ZVFA 3RXAA 1GI7B 4WY3A 2F9UA 2PSXA 2XCFA 2CGAA 2AIQA 4OS2A 3MTYA 1SGYE 4ABIA 3KF2A 1C5YB 1SQOA 2ZHFH 1QRWA 4X2WA 2CXVA 2J9NA 4Y7BA 1GBLA 2XBYA 1T8NA 2SGAA 3E91A 2JH0D 1TFXA 6GCHF 1MKXH 4OGYA 1G2MA 1FXYA 1QA7A 3O8CA 1BBRE 3RC5A 4ISHH 2SGDE 1HNEE 1XKBC 3LGTA 1S0QA 1YPMH 2PTCE 4OS7A 4CRGA 4K1TA 3GDVA 1ZHRA 3MWIU 2QN5T 3K6YA 1O2VA 2AGIX 1O2KA 3UTUH 3SJ8A 1L1GA 2HVXA 1PFXC 5CHAC 1CBWC 2I6SA 4LOYH 2FYRA 4JK5A 2BD4A 2YOLA 2Y7ZA 2O8MA 1G37A 2STBE 2QIQA 1OXGA 4K3JA 3M37A 1ZZZA 3EQ0H 3BTME 3TGIE 1SOTA 1ZJKA 2BDGA 1PPCE 4Y10E 1O3CA 2KAIA 3ZZ5A 1F0RA 4ABJA 4Y8YA 4ABEA 1BRUP 2H1UA 1O3PB 1GCDA 4YT6H 1B5GH 1UMAH 3LH3A 4O97A 3RMNH 2ZU5A 1NU7B 1AVWA 1TRMA 2V3OH 3A8DA 3UWJH 3UY9A 3HK3B 1C5MD 6ESTA 1O2OA 3T27A 1BMLA 4AG2A 3OTJE 2Q6GA 2VWOA 4LZ4B 1GI6A 1TBZH 3PMAB 2K1QA 4ZROA 4CBNA 4INKA 1CSOE 4JMYA 1YC0A 2BYAX 2J95A 1QY6A 1UTNA 2F9PA 4I8GA 1FY4A 1UHBA 2FZZA 4H4FA 2PTNA 5FX6A 5LPRA 5C67A 1P10A 2ZU2A 2F9BH 2ZZUH 4VGCC 4D7FA 2P8OC 2WUCA 2Z9IA 4FUDA 2ZFSA 4FU9A 5TCCA 2C3SA 4ISIH 3BTGE 1MQ6A 1P01A 4U32A 3V13A 4DJZB 1LCYA 3SOSA 1VCPA 5HM2A 3PTNA 3RC6A 3F6UH 2DUCA 1L0ZA 3LIWA 1NS3A 1ANEA 1O3FA 1P2QA 4RSPA 4TYDA 3ZZ7A 2GCHG 1FN8A 1NRQH 1AB9C 2ZC9H 1W12U 1ZR0A 1UVPA 1O2XA 3H7TA 3L33A 1K1LA 1G3EA 1HXEH 1W14U 2A4QA 2UWPA 4X1QU 2HLCA 1P9UA 1RTFB 1QNJA 1GBAA 4BTIB 3SZNA 3S9CA 1OX1A 1W11U 1O31A 4XBBA 2VH6A 1DXPA 3SV7A 1HAPH 1A1RA 1KLTA 5E0GA 2P59A 1C2LA 2NU3E 2C8YB 1ACBE 1E35B 4TWWA 8GCHG 2QC2A 1W7XH 6CHAB 3PV4A 2DE8A 2FIRH 3GCTF 1GGDC 2FDAA 5TCAA 8LPRA 4FUEA 1K1NA 3SI3H 2I6QA 2BD3A 1TYNA 1NRRH 2BDAA 2V6NA 2TBSA 2Y7XA 1K1MA 1DWBH 5EW1H 1GMCG 1Z7KA 1O3NA 3RXOA 4LZ1H 2AMDA 2OUAA 1OWIA 3ENSB 5HMAA 4GAWA 4ZAEA 3Q77A 2NU0E 3S0NA 1AIXH 3RXGA 6LPRA 3A7WA 2XBVA 3ZV8A 1JXPA 5AVDA 4MG3A 3A7ZA 1LQDB 5DP8A 5LPFA 2A5AA 2W7UA 1NRSH 4ZKSU 1C5NH 4UDWH 4Y79A 1CGHA 1DLEA 1VGCB 4NSYA 3K6ZA 2ALVA 1M9UA 2F9OA 1TRNA 2QYIA 1O5BB 3UREA 4CHAC 4X1PU 4JZEH 1C5ZB 5EG4A 1IAUA 5IDKA 2BM2A 3KIDU 2ZPSA 1P3EA 3RXPA 3QTVH 1SFQB 2FM2A 4YOGA 3GY5A 1DSUA 1Y5AT 1JBUH 1EATA 1P06A 1Z71A 3LC5A 1LPGB 1HLTH 1CVWH 3DFLA 4X1SU 3MU5A 1K22H 1TMTH 4X1RU 2FTMA 4JZDH 2VNTA 2Y81A 1QRXA 1GHBF 3M7QA 3RU4D 2OXSA 1WQVH 1FAXA 2J34A 3BTEE 2Z3CA 2UWOA 1EPTB 2H6MA 2OTVA 1H4WA 2PGBB 1ETRH 1FQ3A 3W95A 1ZLRA 5C2ZA 4E7NA 3TITA 3ZVGA 1KXBA 3RXKA 1L1NA 1GBBA 3LJOA 1ELAA 1ZGIA 4BAKB 1GDQA 3ATKA 1T8MA 2ZGBH 1C2DA 1RS0A 3KQBA 4RKJB 5FPSA 2QXGA 4OS1A 2VIOA 1YF4A 1MH0A 1TX7A 3RMLH 2AFQB 3P92A 4CREA 1V2QT 3P8GA 3DT0H 1SGCA 2F83A 2BQ7B 1MCTA 3M3TA 1MTNC 1J15A 3GY4A 1D4PB 1HIAB 1PPZA 1MTUA 4YLQH 3H5CB 1KXFA 2GP9B 3ZZCA 2J92A 5AFYH 2VIDA 4OS6A 5A8ZA 3U8OH 4CR9A 4NA7A 3MH5A 3QTOH 1A5HA 4E7RG 3BG4C 2AMPA 1GMCF 3VGCB 1EP6A 3SHAH 5ABWA 3RXTA 1EAUA 1CO7E 1J9CH 4YTAA 7KMEH 3ZVEA 3KQDA 1Z1IA 1CA8B 4MPWA 2GV6A 5FHTA 3S69A 1GBJA 2J4IA 4WWYA 4X8SH 1QJ7B 1NN6A 3EA8A 5DK1A 1LKAA 1OPHB 1Q3XA 4GPGA 1A46H 1IQIA 3ZZ3A 3L6PA 2G00A 1OKXA 5IYTA 4DG4A 1BCUH 5LGOA 3QUMP 1YPHC 1UCYE 2SGEE 4I8LA 1ZHMA 2ZU4A 3MO6A 1OYTH 3ZV9A 1S82A 5EODA 2A7JA 3QDZB 1UTJA 3A87A 1E0FD 3HATH 5EPNA 1HUTH 3TK9A 4K8YA 2B9LA 3KCGH 4ABBA 4BAMB 4FVDA 4MDSA 2EI8A 2PWXA 4UFGH 3E3TA 2IN2A 1J8AA 1BTUA 2FX6A 1INCA 1NFYA 2A4RA 2CHAC 3LONA 4NIWA 3UNRA 2P3TB 1WAYB 2FOGA 1EAIA 3TK6A 7ESTE 4B73A 1GI3A 2ZKSA 4TY6A 3UIRA 1MZDA 2GT7A 1KY9A 3C27B 1E34B 1ABIH 2LPRA 5GDSH 4Y71A 1FLEE 1LVMA 4ZUHA 1EB1H 5DP9A 2HNTC 1JRTA 1V2ST 3VB4A 2ZPRA 1KYNA 3I29A 3ODDA 3QZRA 1QJ1B 1BTXA 4NFEA 1LHDH 1SGIB 4H6TA 3OYPA 2BY9X 2Q6DA 1DLKB 1SOZA 2CF8H 2ASUB 4IC6A 1ARBA 1XXDA 3KL6A 2QAAA 4KTUA 2C93B 3I77A 4ZKNU 4CH8B 3TNTA 4XBDA 3P8FA 1GCTC 1LO6A 4MPXA 3TIUA 5AHGH 3UFAA 1ID5H 1AKSA 1TGBA 3PWBA 3NCLA 4UEHH 1AE5A 2NWNA 3PB1E 1DVAH 2TGAA 1T8OA