1KDRA

Cytidine monophosphate kinase from e.coli in complex with ara-cytidine monophosphate
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
221
structure length
221
Chain Sequence
b'AIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKGFSVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYARQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTIDYLATE KINASE
publication title Sugar specificity of bacterial CMP kinases as revealed by crystal structures and mutagenesis of Escherichia coli enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 62
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2001-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kdrA00
2ONKA 2K5UA 3ICEA 2YWGA 4KFTA 4UNQA 4PPFA 1W47A 3B6EA 3NWJA 5E7MA 1SHKA 2QMUA 4FIDA 1KHTA 1NLYA 4A2QA 2WV9A 4ERNA 1RKBA 2YOFA 4XVRA 3U6BA 3GLGA 1A1VA 5KSZA 4IOJA 1E79D 1W0KD 3I8SA 4M8NE 1JNYA 5HE9A 2Z6VA 5H70A 4QBIA 1BO6A 1B0UA 2C5LA 2VHUA 4OHVA 5AJYA 2R6FA 5JHGB 1OLOA 3IPXA 1QHYA 1OKKA 1TU4A 1L4YA 2BM0A 1EWQA 2ZR7A 3CPEA 2Y8EA 5HCIA 1QHXA 1WQ1R 4A15A 2VP4A 2JAQA 3IHLA 3B78A 1NSTA 4GDFA 2HYIC 2E87A 3FDIA 2ZJBA 5TV2A 3EIEA 2IUUA 4ARZB 5JJKA 2B6HA 2ZYUX 3PFIA 2CK3A 3C4JA 5JFGA 4N0DA 4Q01A 4IRUB 2JLQA 5FUWA 2GAOA 2XEXA 1NVWQ 4MKIA 1TU3A 4NDZA 3NXSA 1ELOA 1WDTA 3HYRA 2V8OA 1TEVA 1SGWA 4C9BA 4KSCA 1G8PA 2C77A 1EK0A 4ZDKA 1KAOA 1OJLA 2GF9A 1ZNYA 4YONB 2O8DB 1DO2A 3V9PA 1BYUA 4XVQA 4GP7A 5FPHA 1XRJA 3A1VA 2ZJZA 3CO5A 4LI0A 3JVUA 3B5JA 2PT7A 5E7IA 1U0LA 1N5KA 3U4QA 3FVQA 1GP2A 4URUR 5FPYA 1YZQA 1HQYE 2PL3A 1I2MA 4UNRA 5GADl 1N2CE 4YDHB 1KK1A 4HLUC 4PQFA 2R6AA 5D3MB 1D2MA 2ZYVX 3Q85A 3ZZTA 1D9ZA 3SJBA 1TX4B 4DCUA 1J7KA 3QF4B 4P3YA 1TUIA 3CPHA 4MDFA 3VKWA 2H5EA 4LBWA 4GSYA 3KQLA 2OCBA 4CEHB 1N3BA 2FJUA 1R0XA 3WXMA 2FN4A 4EUNA 2SHKA 2IHYA 1ZUNB 4LWZA 4M4SA 1PVOA 1PLJA 4US2R 3B9QA 4I81A 3VNUA 1GFIA 4AK9A 1ESNA 3KFXA 1G18A 1SZPA 2QM7A 4IFBA 4P4SA 1LV7A 5KSYA 2FE4A 2ODEA 3TNFA 1T8UA 3PUZA 4ARZA 2WSSA 3R8FA 3BB4A 8OHMA 4EPXA 1IHUA 4B2PA 3QSYA 3VR5A 2PZEA 2PLFA 2FEMA 4B35A 2QAJA 2N42A 5E3HA 5BN4A 1P61B 4ON9A 5F9HA 3RANA 2IYXA 2BJVA 2Q9AA 4B2IA 3FMPB 3P32A 1E0KA 2CVHA 3K09C 4OL0A 4JZKA 4YMSA 4RD2A 3GLIE 3BE4A 2KB0A 2VO1A 3AF1A 2VP5A 3VR3A 2O8DA 1HQCA 1SVMA 1F60A 4LDJA 2QZ4A 4DZZA 2EWWA 2XZOA 3L0OA 4K81B 1E99A 4TLDA 4FN5A 4LZZA 3G5UA 3E5HA 4I4LA 4JT4A 1XTJA 1J2JA 3P20A 1RRFA 2ZAOA 2JLRA 3QUSA 3VX3A 4DLUA 5ANRB 1ZVQA 4TTPA 3LX8A 4DXAA 3A6PC 2IBMA 1IOZA 1VHLA 1UFQA 3T35A 3GJ7A 4L9SA 4HDCA 2ZRIA 1CR4A 2AXPA 1S96A 1E79A 1W0KA 2AFIE 2QM8A 4GI7A 1R8SA 3LY5A 4MRSA 2A30A 2I3BA 4P31A 2FGKA 5HZHA 4CW7A 3I73A 4HAWA 4TL7A 4HEJA 4M1YA 1XD9A 2CXXA 2ZRCA 1ZIOA 4PPQA 2HLDD 2NTYC 1GL9B 4MKFA 3ZVLA 1QVRA 3ECCA 3GJ8A 2RGCA 4BGDA 1EXMA 3BC1A 3H2YA 1XDBA 4LYAA 1NN0A 4I1UA 4MUBA 4M22A 2G0TA 3QXHA 2ZRBA 2CHQA 3KB1A 3LX5A 2QMHA 1ZRHA 4RKEA 2XXAB 2GRJA 5SZKB 1OPXA 2NO6A 4H9GA 4DIDA 1C4OA 4DLXA 3I61A 2GZHA 2HEIA 3EA5A 5F3WB 4HI0E 2O8FA 1I4DD 4U5XA 3B85A 1WBBA 1GRRA 4OYHA 3EC2A 1HUQA 3DO6A 1FFHA 3C5HA 2QTVB 1RC8A 2IHBA 1G17A 1CBUA 1ESMA 2CHGA 3ZDQA 4Q9HA 3BB3A 2VF8A 1VHTA 1FMLA 3L0SA 2ERXA 4KYUA 2D06A 5JWRA 5KU1A 4PXAA 3MGCA 2WJJA 1W46A 2IF0A 1DOAA 3KFVA 4QFMA 4WIAA 2CL7X 4NP6A 2W83A 3OF5A 3EW9A 5B30A 3Q7PA 1IQPA 4LBYA 4NMMA 3K9GA 4CT5A 3BH6A 4EPTA 5KDDA 1S0UA 3QENA 2O0JA 1T3HA 3FE2A 4M9QA 3OZXA 2JJ8A 4NE2A 2OCYC 3ADBA 2OBMA 1Y3AA 1Z0FA 2FNAA 2XJ9A 1SKYB 4MRVA 1BOFA 2GXSA 3HU1A 3K0CC 3AVTA 4QGGA 1GG2A 2F43B 3L43A 1SVIA 5FOXA 1E96A 5FTNA 1XTRA 2JJ1D 4FCVA 2JASA 2QEQA 6Q21A 2ZUCA 3U3OA 2WKPA 1Z0IA 5EXTA 3CRVA 2GF0A 4BUJA 1CKEA 3K09A 3O8RA 3CLVA 2W2TA 4ASUD 3SJAA 5BXQC 1E2GA 5CDFA 2L0XA 1OXTA 4YMWA 4DHEA 3BGWA 4D4KA 2NQ2C 4OQMA 3K8YA 4QGFA 1UAAA 4LHVA 1OXXK 2IS6A 1NLZA 3KQKA 2XXAA 2OO7A 4BRWA 3QKRB 1ZM3A 1YZKA 1X8JA 3ZVMA 2VP9A 3LLUA 1HTWA 3KUCA 4BLQA 2VL7A 1F3OA 1CJMA 1W4AA 2BBWA 4TL8A 4B73A 2VEDA 3RRZA 3TUIC 4A36A 2HCJB 5BW8A 1L2TA 1W2HA 4DKXA 4GP6A 1MRNA 1E2EA 2GXQA 2DWQA 3RNLA 4TT3D 3MJHA 2J41A 2OHFA 4BASA 3O8CA 2JCSA 1MV5A 1JAIA 1PJRA 2RH5A 2VTKA 4UNPA 5C18A 4DSTA 3AEZA 3DHWC 4I1VA 4WVFA 3TVDA 1CEEA 1E2MA 2JEOA 3B1YA 1XPOA 2X1VA 1PLKA 2WJVA 4Z8XA 5KO2A 4AY2A 1XZPA 3U7EB 4JL6A 2YJTD 1I2DA 1ZJ6A 3AVWA 1HE8B 4DLRA 1R10A 4K8OA 3R9XA 1AIPA 4JL8A 1TAGA 4LK2A 3K0EA 1LF0A 1Q12A 5HTKA 4XOIA 3KKQA 3LQRA 3THYA 2VA8A 1N5IA 3WNDA 1U2RA 4MRRA 1A5TA 3GLIB 3UK6A 1E3MA 1JJ7A 1JR3E 2HLDA 4DDUA 1KNQA 4B3CA 3B13B 1D2EA 4JLKA 4EFMA 3EIHA 3I1FA 1KO5A 1MOZA 3DKPA 1Z0JA 3NIBA 4GL2A 1B23P 1AJEA 4C7OB 1NKTA 4W9MC 3QKRA 4PC7A 2ASEA 4POAA 2IYSA 3IHWA 5DGXA 2X19A 2ZANA 5AK0A 4LV8B 2VSFA 2FPMA 4WA7A 3A58B 1CXZA 1FNNA 2FF7A 1LNZA 1VMAA 2P3SA 3CF0A 5F98A 1G6HA 2P2LA 4JMPA 3DM5A 4Q1BA 2WIBA 4KVGA 3PENA 5C1BA 5F2EA 3PUXA 2H17A 3RWOA 3K0CA 1SVLA 1V43A 5JECA 4NCNA 4Q1AA 1ZCBA 4C2TA 1R6BX 3X2SA 2D2FA 2QP9X 5HE8A 1FMJA 4QHTA 4W5WA 5G53C 4A6PA 1J8MF 3GLGE 1O87A 1LTQA 2EFDB 1IAQA 5EP1A 3TH5A 1E2NA 1KI9A 3A1TA 3A4MA 3CR8A 4PO9A 3W8RA 2Q0HA 2Z0MA 3P26A 4PSKA 3AV0B 4OI4A 3AF3A 3H0KA 4KV9A 4PPGA 2OE2A 2ORWA 3WMGA 3T61A 1XEFA 4CIDA 4KYIB 4X8MA 1XCGB 2JJ1A 2ZE7A 4IOKA 1CJVC 2QY9A 1AGRA 2B92A 3MJRA 3AF4A 5EP4A 2R6CA 1E2JA 3UKDA 1T6NA 2XTZA 2ZQ5A 3G82C 4DLWA 2HYDA 4E5UA 2IS4A 3WHLA 4EIWA 3AP2A 1II9A 2W00A 4AI6A 1KK3A 4D4MA 1JR6A 3QG5A 1G3IA 1H8ED 4MGYR 4MRPA 5EE1A 1W4RA 4PHHA 2C9OA 1OB5A 4C7OA 1QG2A 1XFAA 1Z6XA 2EYQA 4XVUA 2FX3A 1QBKC 3EXAA 5DI9A 1E4VA 4U00A 4QBFA 1XWIA 3VR2A 3D3QA 2BEKA 1KI2A 4LY6A 4V0LA 2RCNA 3CB4A 3MMPA 2XAUA 3K1JA 3LNCA 4KO8A 1KMHA 4KVAA 2A5DA 5B58C 3N5CA 1VPLA 1G8YA 4HUTA 4TT3A 1NBMD 3DVLA 5EQTA 4NBSA 3ZIAD 1G4AE 2C2HA 2KI5A 2ZSDA 3NBXX 4OQNA 5E4FA 4BZQA 3IQWA 1ODFA 5L3SA 1GILA 2B21A 1AS0A 1VG9B 2X8AA 1AZSC 1ZD8A 4TTQA 4DRZA 1OHHD 2CMKA 2HXYA 2WICA 2CVFA 2WVJA 4LHZA 1DAIA 2AKYA 1E2IA 1D5CA 2WWHA 4URYR 5JWHA 4PAOA 1HT2E 2R6DA 1KAGA 1V5WA 3BFVA 3B7GA 1FX0B 3I32A 4TMVA 1NF3A 3W34A 4MRNA 5CK4A 2ZRDA 1NJGA 1CRQA 2A3RA 1J70A 3I3SR 4G5OA 4DLVA 2IXFA 4QM7A 3CF2A 4JYBA 5J4VA 3IEUA 1SVKA 2RGBA 1HEIA 3QKUA 2RKOA 3F5FA 3SU8A 2ATVA 2GETA 2KJQA 3QEOA 1NIPA 4Q5IA 3ZZUA 5DIFA 1OIWA 2G9NA 1ZU5A 2H57A 4B44A 3DOFA 4UKDA 3U44B 2X77A 5HCNA 2WWWA 4M9XA 3KQHA 3THWB 1EESA 3WRXC 1S9HA 3TSZA 2F1HA 4CVNA 3ZD6A 2R44A 5IHPA 5H8WA 2O8CA 3QG1A 3EPKA 1WBDA 3ASYA 2V55B 4RZUA 4ZO4A 1ANKA 1WA5A 4IVRA 4W5JA 3DL0A 4MA4A 2AXNA 2G3YA 4C0KA 2HJGA 1N5LA 2QTHA 2R8RA 3MRSA 5J47A 2BM1A 3EWSA 4AIIA 1XTQA 2JATA 1P9NA 4PHFA 3IO3A 3AP3A 4LJAA 5K8TA 1LF5A 3M0EA 1P60A 1XNJA 4B3BA 2G83A 5C4MA 1KI6B 3VHXA 4PPNA 3PJRA 3WMEA 1E9DA 2QP4A 2IUSA 5ELXA 4HZUA 2O5VA 2AWOA 3KKOA 4TTRA 1WB9A 2NIPA 2ZS7A 4YDSA 3TGPA 4PQYA 1DG1G 1P75A 4M53A 4QRHA 2Q21A 2BC9A 4KI0A 1U90A 2AN9A 5FOWA 1DAMA 2J7PD 2ZSBA 3CKLA 4PO1A 521PA 1M74A 2RGNC 1G8FA 5HKKA 2ZI7A 3ETLA 1ZNZA 4RKFA 1QG4A 4O3MA 3VU9A 4GOXA 3L2OB 4DVGA 1KKLA 3QEJA 5TARA 3OIYA 2Q9CA 1OH6A 2R65A 3V4RA 5F9FA 2JDID 2H92A 3A37A 1ZM7A 4XSHA 4V0MA 1G5TA 1JPNA 3RAPR 1KO7A 2A5JA 3RLFA 4TZ0A 1E9BA 4AWXA 2GESA 4ITRC 1VYTA 3PEYA 4PAMA 3U7GA 3THXA 3X1WA 3UWOA 4CEJA 1S9DA 2Q3FA 3QXXA 2WAXA 2QORA 4FI3C 3RVBA 4DEYA 2ZXUA 4ZV4A 5KNCA 1TTTA 4B34A 3U44A 4BFTA 3O8BA 3RRMA 3THWA 1KDOA 2REOA 2YOHA 1HH4A 2J45A 1JXMA 2OESA 1U0JA 2ZRPA 3Q5DA 3NC0C 2PEZA 3Q7QA 1RYHA 5BWMA 1H8EA 2N1BA 5FL7D 5FOUA 1ZNXA 2A5YB 1GM5A 1DO0A 2QL6A 1OFTA 5LD2C 1OFUX 2DB3A 1M7BA 3SYLA 4ESVA 4URZR 2WZQA 3NG1A 3OIVA 4A8JB 5C46F 2QG6A 4WAUA 2GEUA 1IXSB 2PX3A 2VHQA 1XXHA 3ZZ0A 2CCKA 2P5TB 5C2JB 3HP1A 5CLLA 1NBMA 1VG8A 4Q21A 3D31A 3SBDA 4C4PA 2JIZD 3GMTA 3ZIAA 4N1AA 3EZFA 3WP1B 1KDRA 2NMVA 3KXLA 1OV4A 5JEEA 1GIAA 4Z1MD 2RGGA 1P5ZB 2OEPA 4DEXA 3BD9A 1Z5ZA 4EPWA 4IKEA 4IVPA 4UNNA 4LJ9A 1P62B 4OK5A 3NHBA 4G5RA 4XSGA 2NO9A 2BDTA 2OCAA 2J87A 1M6NA 4GBMA 1UF9A 4AYXA 2BV3A 4LJ5A 2WJHA 2BHRA 2ZRLA 5FBRB 2O8BB 2JLWA 2CDNA 1I4LD 1KI4A 2ZE8A 2GBLA 3LLMA 2AKAB 5LD2B 5P21A 5CDFE 4LBZA 3KJIA 3PV0A 2FFAA 3QQ5A 3B1WA 4WXRA 3CRQA 4M1MA 1HT1E 2NO0A 1QDEA 1LVGA 4WZ6A 1VCMA 1TQ6A 1ONBA 4DUGD 1PV4A 2F7SA 2IYUA 3DZDA 1YVDA 1FPMA 3UG7A 1O3YA 2FFHA 4Q4HB 1DADA 1C1YA 2ZYWX 2YNMA 5DH9A 2DFNA 1K6MA 1RRPA 2DYKA 2EFHB 4JSTA 1G41A 3BH0A 1DG3A 5DO9A 1MR3F 3RYTC 3TKLA 1UBEA 3SQXA 1U8AA 1Z6TA 3QBTA 2RGNA 5FPSA 4A8JA 3PCRB 4HAUA 3EZ2A 1IBRA 3IQXA 4G3XA 4JBWA 4C0SA 4ZI3A 2JJ2D 5DNYB 5BYKA 1Z6AA 4MYHA 2ODBA 4RJLA 4TMTA 1G3UA 3VQTA 4DCSA 3I62A 1YJ5A 2PCLA 1T0JB 3W3AA 3I72A 1Z28A 4HB2A 2IXGA 4OK3A 4P4SB 3MWJA 1NY6A 1MKYA 1MH1A 4C0LA 2J7PA 4A9AA 1XX6A 2ZVQX 3RWMB 1W1WA 4DT1A 2XOKD 1XMVA 3CWZA 1G9XA 1SKYE 2ZSAA 2RMKA 1IN8A 2YKGA 2BMDA 3T5DA 3ZJYA 1MO5A 3PUVA 5AUNB 3PEVA 4B6FA 4NU0A 3QVVA 4LV6A 2XJ4A 2DWOA 2HCBA 2E1RA 4JVLA 3DM9B 2FSHA 2FGJA 4B43A 2B8TA 4G5SA 2O8BA 1GKYA 2OFXA 5CK5A 2AR7A 3U7FB 1X86B 1D6JA 3UANA 2J0QA 1NL3A 1II8A 2YV5A 5A0FA 4QBHA 4R71A 1OYWA 1NG9A 1D2NA 4OJQA 2YINC 4O2RA 2QPTA 1Q1ZA 1ZUHA 2VLIA 2WAYA 1X8KA 3FPAA 4FMCF 4MUAA 3LRPA 3K0FB 1DBSA 1U0HC 3B2EA 5CM8B 5FL7A 1UJ2A 4ZIRA 3DOEA 4B75A 1S3GA 1Q1QA 1YR9A 4Q4HA 2NO7A 1ZM4A 5B57C 4DIEA 3MWYW 3TR0A 1SVSA 2ZRJA 4GOKA 3PEWA 4M2LA 3GJ0A 1A82A 2VH5R 2A9KA 1S4QA 1XTSA 4QHSA 4AYTA 3LV8A 1VYUA 2CCGA 3FKSD 4TSFD 2FZLA 2C95A 3HR7A 2ANCA 2ZITA 3G0HA 2OXCA 1NP6A 1Z63A 1DAEA 3RS3A 1IJFA 2MSDB 4MDEA 3KKMA 4XWOA 4E09A 1UKEA 4JT2A 3P1JA 1AK2A 2ZRGA 2VIIA 4KBGA 4DWJA 3LWNA 3DEFA 3A36A 4CZ2A 3CONA 4HSEA 2DCUA 3N2EA 5DISB 3JZAA 3TMKA 3VMFA 4Z1MA 3TK1A 1R8QA 1J99A 4TLEA 5JHHB 1E6CA 5E95A 2WSMA 4HB0A 5EP2A 4BLOA 5IDVA 5IT5A 4EJSA 2GCOB 3L82B 2O8FB 3VHLB 4XTRA 4CEIA 1FOEB 3MUFA 3U60B 5FTJA 3DMNA 5AUQA 3KJGA 2C78A 1E2QA 3Q9LA 1XEWX 1IN4A 3W6PA 2PZGA 2DFLA 3AUXA 4V0NA 1BS1A 3BWDD 2V3CC 1W7AA 4FCWA 3CH5A 1NMXA 1XU4A 1TQ2A 2YOGA 2OBNA 3K0FA 4QKQA 2IEYA 421PA 4DUGA 2IT1A 2J7KA 3E2IA 4PHTA 1T5IA 4EDHA 3SC3A 1RE0A 4L5BA 1RVDA 4LHWA 2JLVA 2GCNA 4NTZA 2QSYA 3M1IA 2XSZD 1EX6A 1G4UR 3GFPA 2BMJA 1R0ZA 4CDGA 3WNBA 1VG0B 2FFQA 4MYTA 1Z0DA 3BAFA 3KXKA 2P6UA 4Q66C 2RHMA 4Q03A 2EFEB 2XB2A 1EFCA 2W0MA 3ADCA 4TQAA 1KSJA 2JJ2A 1IY1A 4JJZA 1XF9A 2F1IA 1MO4A 1N0WA 4TLCA 2ZR9A 5FR2A 1G6OA 4BRUA 3X1DA 4ZCIA 3PG5A 2ZVPX 3EPHA 1W5SA 2AFHE 4PSVA 1KJYA 2MSCB 1MO3A 4IVQA 1XMSA 3CR7A 1OIVA 3CZQA 5FI1B 221PA 2FEOA 3W3ZB 1YU9A 5DE3A 2XGJA 3QXSA 4YMUA 1N0VC 3NBYC 5HPYB 2XOKA 1F6BA 3Q3JB 1H8HD 2IYVA 1E2PA 4NYJR 5DYIA 1VCIA 4QHYA 3QVUA 5FOSA 3B1ZA 4E22A 2FA9A 1BYIA 2GCOA 1SHZA 2QPOA 1Z3IX 5FH9A 3I4LA 4B71A 3HDTA 2WWFA 2ZI4A 2XZPA 3FWYA 5AUPB 1G8HA 1NMYA 4AG6A 4QBGB 3T12A 3WY9A 1TL7C 2PZFA 4CRWB 5G41A 2QRNA 4PSAA 4TLBA 1E9EA 1Z2AA 2UKDA 2ZU6A 4D81A 3LVQE 1Z6GA 4X8LA 4DLZA 3RHFA 1Z2CA 3AQ4A 3TIFA 1GUAA 5AR1A 3WYFA 3EAQA 2JLSA 3AM1A 2ZSFA 4C2UA 2FPLA 3T15A 2RGAA 1CTQA 1K8RA 1GNRA 1VIAA 2GJ8A 2YWHA 2CCJA 3B1VA 3SZRA 3TW8B 1W44A 3LBNA 4D4LA 3W5JA 3MFYA 2XX3A 5FBWB 1F48A 3R7WB 3LD9A 2EW1A 3CH4B 3IUYA 3EZ9A 4S2EA 2PX0A 2GZAA 2LKDA 4JVSB 3TW4A 4W7SA 2V7QD 3ND8A 3UPUA 5KDOA 4TSFA 3FKSA 2G88A 2CLDX 1XTKA 1KJWA 3EASA 5EP3A 3HJNA 4C0JA 3THYB 1CR1A 4QL3A 1TEXA 1JPJA 1XEXA 1RRGA 3GFOA 1Z07A 3UIEA 1P2VA 1R5OA 4FINA 4KXFB 4P4UA 4B3XA 4TQUS 1N6HA 4ZDIA 3JVVA 4LC1A 3K0SA 1J90A 3FOZA 1XEWY 4EAQA 1N25A 2GDJA 4M9SA 3KKNA 1SXJD 3I5XA 1IY0A 3BB1A 3GEIA 3UATA 4V0ME 5G40A 2RGEA 3KJEA 3I92A 3UG6A 4D2IA 4G0NA 5CIWA 3EZ7A 1EFTA 4JLNA 2EYUA 4M1TA 4MYUA 3VFDA 4AD8A 4R2IA 4HDOB 5L3RA 2QU8A 3I5YA 2BBOA 4R9UC 3LBIA 1PUJA 4LOAA 2WJIA 1E69A 4M1KA 2FOLA 2TMKA 4ZCLA 2P6RA 2WWYA 4KCGA 3PITA 3TQCA 4MQBA 3QE0A 1AA9A 4A0HA 3SFZA 3ONWA 5SZHB 4UXIA 4HLCA 2Q3HA 2KSQA 3C41J 3CWQA 4V03A 5AJZA 1CLUA 2ZAMA 2IS1A 1E94E 2W2VA 1FP6A 2XNSA 2YVUA 3BFKA 3OAAD 4CGZA 3CRMA 2OZEA 3C15C 2XB4A 3EARA 3IIJA 4OHXA 2C8VA 4Q19A 5CYOA 2QMEA 4RD6A 2XSZA 3R7WA 3RS4A 3ZQ6A 4EPVA 3AF0A 1GOTA 1P9WA 1XXHE 2QI9C 2VHCA 2YC4C 4QJ3A 2V6JA 1W36D 1KO1A 4TYYA 1FTSA 4PANA 1HY3A 1NBME 4IDPA 5C4GB 3EC1A 5FTMA 2BBSA 4NYIR 4ILEA 1NVVR 1F5NA 1SVOA 4DCNA 2CNWD 5EUQB 1J8YF 4TL6A 3HU2A 4CF7A 4BFYA 3OEED 1CF4A 3FFBA 3X1ZA 3PXGA 1ZUIA 1SULA 2WJGA 1NLFA 2QP3A 4XWKA 3GJ5A 4E03A 1XMJA 1VECA 2C99A 4BLRA 4Q4AA 4UXHA 4TYPA 4BFXA 4O0MA 2XTMA 2YWFA 1H8HA 4FD2A 4KHZA 3DZ8A 3CX6A 2QQEA 4U7DA 1W0JD 3T1TA 3AKDA 3GPLA 3K9NA 1KJZA 4MKGA 3M6AA 2A2ZA 3QY0A 1GRNA 4B76A 4NL4H 1DAKA 1Q1BA 2OV2A 3L8YA 1KMHB 1N6IA 1P73A 1ZMXA 2D62A 1WP9A 4OI1A 4JIMA 4AYWA 4LUCA 2FZ4A 2QROA 1Z0AA 1JAHA 2QT1A 5CM9C 1JEDA 121PA 4PAQA 2AWNA 3HU3A 2FH5B 1KO4A 3GCGA 1MRSA 5L3SB 5TY0A 1JQLB 2PBRA 4TMKA 2WWIA 4Q1FA 4TYWA 1G7SA 2WBLC 2GVDC 4JSYA 4AURA 2CEAA 2RGDA 2D74A 3THOA 2WMOB 3VAAA 4JKYA 5H68A 1X8LA 2ZJAA 1Q22A 3RS7A 3OIWA 3IO5A 3W9YA 3O47A 4KODA 5JRZA 5B2ZA 2ZJ2A 1W36B 2V7QA 1JECA 2ZYTX 4IDHA 2BJWA 3REGA 4EKDA 2NG1A 3GJXC 1UPTA 4Q02A 1QHSA 4HZIA 4OQXA 4C0QC 1MABB 3BRWD 2J0UB 3SS8A 1AN0A 2IS2A 4RSGA 2G0NA 2NOAA 4B32A 4I1SA 3TQFA 1YZNA 1XBTA 4ASUA 2C98A 1DAFA 2PJZA 2V9PA 2AX4A 2JA1A 3MWKA 2O8CB 2QQ0A 3FKQA 5JCPA 1IN7A 3SFVA 4GPTA 3SYKA 1W2GA 1OXVA 2I1VB 1SXJA 5FUVA 4Q4LA 4A1FA 4BLPA 2HF9A 4Q7JB 3VR6A 1ZD9A 1DE0A 2G1JA 3NBFA 4OBEA 2ZUDA 5DHFA 2NPIA 4RFSB 1R0WA 2E9SA 4KFSA 1XP8A 1F2UB 3AKEA 2OBLA 2R62A 2PMDA 4HZUB 4Q9KA 2GJAA 3IGFA 1PUIA 2XNDD 4JBYA 4NYJQ 1FTNA 5FPKA 4IXNA 3K9LA 2DFTA 4LBVA 2GXUA 2J5XA 4PO8A 1GRQA 2IYYA 4XD7D 1Z47A 3VX4A 2B8WA 2RHDA 3CZPA 4IW3B 1Z8FA 3NDPA 4JLBA 3BH7A 1N0UA 3BS4A 3ZGXA 2QGNA 3AVQA 3OAAA 2F3TA 2YYZA 4JLDA 4RY2A 3FGNA 4AG5A 2KE5A 4PC2A 3CRW1 4R98A 3U3RA 3VU9B 3GLFA 4AKGA 5CLQA 1X6VA 2GTPA 2OLKA 4PC1A 1XJ0A 2EWVA 5JSZB 3AVUA 4D0GA 2C9YA 4KLNA 1NKSA 4L4UA 3BORA 4A2PA 4C0AC 4DLSA 4V02A 1US8B 1VG1A 1TF7A 1NMZA 1MT0A 4ZKEA 5KPJA 3MSXA 5H1YA 3R20A 5E7JA 2KWIA 5KNDA 1UKZA 1MABA 2JLYA 3ADDA 2OAP1 3THXB 4QG7A 2J0UA 4CEJB 2CNWA 4QJ5A 1DVRA 4Q48A 3TUJC 1JBKA 5JZVA 1M1YE 1LY1A 1XD2B 1S3SA 3BERA 5KSOA 2PJRA 1P7CA 4HYYA 2ZROA 4IDQA 2KBFA 4C30A 1Q21A 1T3LA 3CNNA 5IF9A 3GEHA 3BBPA 2C04A 2PH1A 4DC9A 3QI2A 4OHZA 3A1WA 4HB4A 4M21A 3QPUA 1E2LA 5B64A 3FFAA 1UDWA 1FL9A 4Z8YA 1BKDR 1G1MA 1U99A 1E32A 2D4HA 3VTKA 3PEUA 2CLSA 4DLTA 1QZXA 1E0JA 2GBLC 4WOPA 4RZ2A 1W0JA 4QGAA 4D4JA 4BFVA 5JI3E 3F0TA 5HZKA 3QIAA 3SEAA 4RFSA 1M7GA 1T8TA 3K70D 2GJKA 1F2UA 3RSLA 5KNBA 1KY3A 1OSNA 4WW0A 1CJUC 2ATXA 4LJ8A 1R2QA 2BEJA 4DDVA 2ZE6A 1XXHB 3H84A 5KSPA 4QM6A 3AB3A 4P33A 1IXRC 4TLAA 4C0HA 4YMTA 2AD1A 2F9LA 1KO8A 2ZJ5A 5TDHA 4DSUA 1KNXA 4L15A 4OKSA 3SHFA 1BMFD 1DEKA 1G19A 1VTKA 5CB8A 1LS1A 3D8BA 1CU1A 3PVSA 1IN5A 4QJ4A 1CJKC 3AVYA 1OT3A 3KZ1E 4FXPA 3AH8A 2ZEJA 3NKVA 1JB1A 4RVCA 4F92B 4A8JC 4GNKA 4A2WA 2W6JD 2LWIA 2V1XA 4LJ7A 3MD0A 1VIYA 3GLHA 1OKKD 1E2KA 2JLZA 2ZIAA 4NH0A 2R2AA 4HUQB 5JSZA 3D7MA 3A1SA 2WPDD 2VBCA 3LAWA 1HE1C 4GFDA 4TMWA 1LB1B 1VCNA 2P6NA 1US8A 1HYQA 1L8QA 1VYVA 3KJHA 1A4RA 5CB6A 4RZXA 3WYGA 1T91A 1D8TA 4BWYA 4YLGA 1QHNA 3BK7A 3NEJA 3CIOA 1TQDA 3RS0A 3O8DA 4WZBE 2PLRA 4JL5A 4P4TA 4LJYA 4WZAE 1GWNA 1XD2A 1E98A 4PC3A 1AS2A 3HYTA 3PR1A 1W4BA 1G7RA 1Q44A 3AKCA 3J81k 3U6KA 4PX9A 3K53A 1AQYA 1CJTC 3CNOA 3L8ZA 4NYIQ 5TXGA 1NVVQ 4F91B 1AZTA 1G3RA 1UEIA 2BCGY 4QNRA 1Z08A 4IOMA 1E9AA 2FDCA 2ZI3A 2IEZA 1R0YA 1P2SA 5AJWA 3ZS8A 3AGPA 3K70B 4ABYA 2H16A 2RAPA 2ORIA 1ZD1A 1RYFA 1DELA 4B3FX 1NRJB 2JLUA 3U3MA 3ZH9B 3U61B 2XNDA 3TR5A 3FB4A 2OILA 2VSOA 3LW8A 3DPUA 2NO1A 3FTQA 1LFDB 4D25A 4B33A 4D82A 1P72A 3BFXA 2WWXA 4M9ZA 4JS0A 4XD7A 2EFGA 3ICQB 4LRWA 4A0GA 2GEDA 4DJTA 1E2DA 2P0EA 3F8TA 1BIFA 1IONA 4JLAA 1T0HB 1G64A 1OHHA 1KOFA 1E2HA 1YZGA 4DT1B 1EFHA 4B48A 2C96A 2G6BA 3ZLJA 4QC2A 3VKHA 4HUQA 2ZI5A 1FQKA 3VNVA 1XB2A 1Z83A 5KTYA 4TYQA 1E1RD 3GJ6A 4LYFA 4F4CA 5L8VA 1TQ4A 4RD3A 1EX7A 1NG1A 2IWHA 3RS2A 1CULC 2QNRA 1U94A 1G21E 4QNMA 1II8B 4UXJA 1Q20A 2A5FA 1UEJA 4ZDJA 5EZ6B 4G5QA 1QHIA 4I99A 5JI2E 4B3GA 4N0EA 1RW4A 5DSZA 2DFKB 5EE9A 4B2LA 4EJSC 2IYZA 5DN6D 1ZINA 3UXMA 1HA3A 1RFLA 1ZNWA 4YC7A 4ZIRB 2GJ9A 2QGZA 5IRCD 2ODNA 4OI2A 4P32A 3ASZA 3VR4A 1N6NA 2WIAA 3V4FA 1GNQA 3FMOB 1CS4C 2G77B 3FMIA 1K5DA 4LYHA 4NKRA 3TSOA 2GVZC 2ZRAA 5AWFC 5DYGA 5FBQB 2IYQA 5FPTA 4GMXA 1E4YA 4DB4A 2MMCA 2V54A 5FTKA 1CP2A 2ODWA 3BJIC 3IBGA 1ETUA 2O0HA 4UJ3A 2W6ID 2WM9B 2HDNB 1FQJA 5JJIA 1E9RA 1N6LA 2DHRA 3KTAB 2ZS8A 4RD1A 4BFWA 5CITA 1ZW6A 2UVQA 3KQUA 4F4IA 3T1OA 1BMFA 4PZZA 5AUOB 2QAGA 1M8PA 3N2IA 3D6TB 3SYNA 2FG5A 1FUUA 3C14C 4HAVA 4HAYA 3SBEA 2W6JA 4BQSA 2XZLA 5LPNA 1JEEA 3BXZA 3RS5A 3P4YA 1Z22A 3RRYA 3SJCA 3T5GA 1TMKA 4R7ZA 4LV5B 2WPDA 4G01B 4D80A 4EJSB 2JDIA 4Q00A 3GQBA 2IYRA 2ZRNA 4Q7MB 1RIFA 4P0TA 1G8GA 4JLMA 3TVTA 3U7HB 2ZJYA 4CEIB 2BMEA 1GZSA 1AS3A 2ONJA 1YQTA 4Z54A 2ZRFA 1M7HA 4FCTA 4LX0A 3KQNA 2YHSA 1ZM2A 3S1AB 1DAGA 4KJZA 1FW6A 2GA8A 4J0QA 4LHYA 3U5ZB 5SZJA 5BN5A 3SI7A 1P2UA 1KYIA 5G3ZA 1SKQA 2N46A 4Y0AA 4WBSA 1KGDA 4FW9A 4MKHA 1OYYA 1COWD 4F7WA 3X1YA 1KI8A 2O8EB 1GDDA 1Q3TA 2DR3A 4II7A 3NTUA 4MGKR 4B74A 4M0LA 3NDBB 2AL7A 1QHGA 2F9MA 1UKVY 2ZI9A 3B8HA 4TMZA 5J40A 3RSOA 3T1QA 2IF2A 2J59A 2VSXA 1RJ9B 2FSFA 4UJ5A 3KL4A 5TVKA 2OFWA 4R2HA 1G3MA 2GAAA 2VP2A 1KI1A 2JGNA 1A2KC 2JIZA 3KTAA 3QXCA 5FUXA 3Q5EA 2GILA 2R6GA 1AM4D 4URVR 2QE7D 2QSZA 1WCV1 2REXB 4HATA 4MGIR 5DI3B 2HT1A 3RC8A 1CR0A 1ZU4A 3H4MA 4LC0A 3TE6A 3AVXA 3EX7C 1GNPA 4LYJA 2W0SA 4DLYA 5K8UA 3TAHA 4DDTA 1WRBA 2B7BA 1GITA 3EPLA 1YRAA 2P65A 2ZRMA 3CX7A 2CLCX 1OE0A 1X3SA 2RB4A 2ZJOA 1E1RA 4QOSA 3QXJA 1N6KA 5EXXA 2CBZA 4LSGA 3QJYA 3AVPA 5EE3A 3NBZC 3NHAA 4BFZA 3SR0A 1LW7A 4GZMA 1S2MA 1KK0A 1RZ3A 4NHOA 5JWOA 2HT6A 3S1AA 3EIQA 3RABA 1SXJE 3RDPA 3U3KA 4A0FA 1NSFA 1TADA 1TNDA 1CR2A 2EFCB 5DN6A 1SVWA 2X2EA 2XITA 4A92A 2JLXA 1T4GA 1R5BA 2ZTSA 5HR5A 1AKEA 3LXXA 2V6IA 4BECA 4ZDWA 2ZE5A 4RD4A 4Q7KA 2D2EA 3WBJA 2O8EA 1T9HA 2BCJQ 4FMBB 3LBHA 1G5PA 2IUTA 2NZJA 2D3WA 1YR7A 3FHCB 2QRZA 4RCZA 2BMFA 1NJFA 1KKMA 4HLQB 4IDNA 3L0IB 4BEJA 1ZCAA 1FZQA 1M2OB 1E0SA 2CE2X 2WTUA 3FHTA 1RJ9A 2OUKA 1OFHA 4G5GA 1XPUA 5EE0A 4CT4B 5D3MA 1NVUQ 3K9HA 1KDPA 1ZIPA 3L0PA 3QBVA 2H7VA 1TUEA 1XEXB 2W6IA 4JBXA 5FTLA 3QF4A 2IWRA 4C0BA 5BN3A 2ZM5A 2IYWA 4GOJA 3GLFE 2I4IA 4DSNA 5DI3A 2ZRKA 2QBYB 2DBYA 4EPRA 2C03A 4CEHA 3IDQA 3NH9A 2QPAA 3C8UA 2WJYA 3OE7D 4BEBA 1UBCA 3T06B 1E9FA 3A1UA 4JLPA 5GJWC 621PA 1TPZA 2FWRA 4RD0A 2QENA 1ZC3A 5J4KA 4M1WA 3HPQA 1Q1EA 2O52A 1OB2A 2DWPA 2HF8A 4KSBA 1WF3A 2IC5A 4WXPA 5FBLB 5J4HA 4HDQB 2ZU0C 2DPXA 2IW3A 4DCVA 4X8OA 3IIKA 4PC6A 3WNCA 5K8IA 3ND9A 1IJEA 3CW2A 2GNOA 3UMRA 3B60A 2PMKA 4BFSA 3IKJA 4Q9LA 1IM2A 1YZTA 3A4LA 4TWZA 5DLQC 4ACAA 2Q6TA 1BH2A 4KAXA 4DDWA 1WE2A 4HLUA 5GJVC 1OH5A 1N6PA 2ZREA 3E70C 5GJBA 2NZ8A 2XTNA 4OHWA 3IPYA 2WKRA 5JMTA 1COWA 3U3JA 2H1LA 2VYFA 1EFRD 3LXRA 1LS6A 3GJ4A 4OHYA 2H8KA 2EU8A 1Z29A 4K46A 2EVWX 4LCBA 4EFNA 2OG2A 3ZYCA 1OW3B 2HXSA 2V4ZA 1KIMA 4E07A 5TMPA 4FMCB 4A4DA 2VHTA 2PCJA 1UBGA 1XTIA 3AKYA 1U9IC 3QKSB 2ZPTX 4A0RA 1Q3HA 3H1TA 2F6RA 2J9RA 2FMXA 2BKEA 4HAZA 1GKUB 4PFSA 1KSGA 4KFRA 2C9CA 2QMOA 5GVSA 2CL0X 2QE7A 5EJEA 3GLHE 1L7VC 2FPKA 5CIQA 4ZPXA 2QBYA 1UDXA 3CX8A 5EXPA 4B3DA 4NCIA 4Q4AB 3Q72A 1KY2A 1TF2A 3AVOA 3SQWA 4IJMA 2ZJ8A 1OXUA 1G16A 2ANBA 3F3YA 2FFBA 3EA0A 4ZKDA 3R9IA 1YRBA 2R9VA 4XH9B 2Z4RA 2VP6A 4EQ6B 2IK8A 1CIPA 3LQQA 1NIJA 4Y0VA 2LKCA 2CE7A 3HPRA 1GVNB 2YC2C 4PZLA 1G7CA 3IILA 3OEHD 3B9PA 3GEEA 1NN3A 1SXJC 2WMNB 4EFLA 2ZR0A 4BLTA 1E1QD 4D26A 4BFUA 4NZYA 1WXQA 2VQSA 1KZGB 3CRRA 3E1SA 4FMDF 1GTVA 1T3SA 3LVRE 1JJVA 3IEVA 3TJZA 2VHJA 1NNEA 2LCFA 1ZM9A 4XTCS 2GK6A 2DY1A 2UZ3A 3BIFA 2WHXA 2QTFA 4BE7B 4C3ZA 3GP8A 1FUKA 2J1LA 3C16C 5L3VA 3LFUA 4HB3A 1N6RA 4U02A 1NN1A 4DB2A 2IX3A 3V00A 3WYAA 1YHNA 3QKSA 3EG5A 4H1VA 4TN1A 4XWAA 2FU5C 4MH0R 1W49A 4BZXA 4CYMA 1XJQA 2FV8A 5CJPA 1KI7A 1UBFA 2PEYA 2O0KA 5D3QA 3ZVNA 4YXWD 4IHQA 4TL9A 2J0SA 3SN6A 1W36C 2HV8A 5J4YA 5FOTA 1OXSC 3OFND 1SXJB 3MAAC 3OE7A 2F43A 5EZ5A 3AF2A 2BWJA 1EG7A 4OJKA 3ZD7A 3W6OA 1EFUA 3EPJA 4Q4JB 3SHWA 1JALA 5FR1A 3RC3A 1E9SA 5A5GA 5TB5A 4XJXA 4XIGS 3W90A 3I8XA 2D7CA 4EQ6A 3H86A 1OH7A 2OAQ1 1YE8A 2Q9BA 4GRAA 4PHGA 3BOSA 2Q3MA 3TAUA 3P27A 4IDOA 1HURA 2CL6X 4NCHA 5UKDA 1KI3A 3KDSE 5BQ5A 3R9WA 2B7CA 1F2TB 2J46A 5LB4A 2Z43A 5EE5B 2ZI6A 2ZRHA 1JQJC 4KITB 1S1CA 5K8LA 1U9IA 1EWRA 4D6PA 4JLVA 5JEDA 3CPJB 2VRWA 4LGMA 5FOVA 3GLFB 4NYMR 1UADA 1EFRA 2Z83A 1K5GA 1EGAA 3TSWA 1M34E 5JRJA 3HR8A 4US1R 4F38A 1QRAA 1XCPA 3HWSA 4ZCMA 2IL1A 3KUDA 4O25A 1S1MA 4Q9IA 1IN6A 2RGXA 4TMXA 5AJXA 4MGZR 4TYNA 3ZS9A 3LA6A 2X2FA 5HKKD 2D7DA 4D0LB 3LW7A 2OXRA 1KK2A 1JXOA 5L3QB 3WBKA 2GWHA 3QPVA 1JI0A 1R5NA 2QT0A 2W58A 2AK2A 3A4NA 1DAHA 3QOFA 1QF9A 1AQUA 2A7QA 3B82A 2BBTA 3AP1A 1N6OA 1AGPA 4KU4A 3WRYC 1VCOA 1XMIA 3PUYA 1ZAKA 821PA 1ZYUA 5JLJA 4IEIA 1N5JA 4GZLA 2NGRA 4Q1CA 4RFVA 1TF5A 1Z06A 1H65A 1QHHB 4Q4JA 1C9KA 2MMGA 3ADKA 4KLZA 3W6NA 4AKIA 1XD8A 5EUMA 5JS7A 1E0AA 5IK2D 4Q18A 1U98A 3GLIA 1P6XA 2ECKA 4B47A 4NCKA 1OF1A 3CNLA 1Z0KA 4PZYA 1A2BA 1YR8A 2HJVA 2AK3A 1YKSA 2QA5A 4URWR 4LHXA 3OEHA 2Z5FA 5JBQA 3DDCA 2PT5A 2ZS9A 1E1QA 1XJCA 2IYTA 1F2TA 2FSGA 1UM8A 2IXEA 2F1JA 3N70A 4F4JA 3KKPA 4HLDA 3LDAA 1VKJA 4QGHA 4O2LA 3UMFA 1WMSA 3VKGA 3GLHB 4ZI2A 3U2QA 2HUPA 4BLSA 3QF7A 4A82A 1DS6A 3NVAA 3TRFA 1P2TA 4Z51A 4Q1EA 5KUTA 2GK7A 4H1UA 4V0KA 1VDZA 4DBLC 4X8HA 4B6EA 2A78A 4FMDB 4JVMA 1IXZA 4W5HA 3LO5A 1JR3D 3QKTA 2REBA 2AD5A 4S35A 3PQCA 4AKEA 4TQ9A 5LB2A 5KOYA 1GSIA 3OEEA 2A5GA 1KMQA 1DPFA 1QVAA 2W2XA 3ZVRA 5L3QA 2GCPA 1T5LA 3A8TA 4YXWA 1E9CA 2VPPA 4Q47A 4G1UC 1NN5A 1FP7A 2OM2A 1P4SA 4OQFA 2EQBA 2V1UA 2MSEB 3OFNA 3P4XA 1XCMA 1OIXA 3VR1A 4URXR 1GL6A 2GEVA 2YWEA 1QHHA 4QXAA 1HV8A 1G20E 2ZSEA 1D9XA 1Q57A 3LH5A 2OFOA 2Z4SA 2ORVA 1YZLA 4Q9JA 1GAJA 1Q0UA 4MYCA 4JLOA 4A6XA 1G291 1A7JA 5KDLA 3EWAA 1OH8A 1R7RA 2KBEA 1MO6A 3DMDA 4GT1A 4YMVA 5FBVB 4JJKA 2CJWB 4DSOA 3GD7A 1G3QA 5FUYA 5GJCA 4LJ6A 4BZPA 3IIMA 2H18A 3WP0A 3CBQA 2BIFA 1KZ7B 3K0AB 3T1VA 3K70C 2OCPA 1I4TD 3W8NA 1NVXQ 5FL3A 3R8CA 5DHAA 2P67A 3B1XA 2QN6A 3CUEF 3NH6A 1KTVA 2ERYA 5AJVB 3SOPA 4HAXA 1PZNA 1AKYA 2GKSA 3UWKA 4LPKA 3T34A 1OFIA 4JKIA 1DTSA 2BVNA 4NCJA 4NPHA 1P3JA 2I1QA 1GL7A 2QAGC 3CF6R 4MITA 1YR6A 2F1RA 2ZETA 3TUZC 1W48A 2CK3D 5J4LA 2YZ2A 1SQ5A 3AGQA 4OK6A 4UNSA 4FWIB 3X1XA 4PQRA 1ZBDA 5G3YA 4L9WA 5KPDA 3MG9A 4GMDA 3FHOA 3KX2A 3KXIA 4JYCA 1FX0A 4JVNA 1G7TA 5M04A 1ZP6A 1DARA 3GJ3A 2BKUA 3GFTA 4ACBA 2AHOA 4KFUA 4RZ3A 5FI0B 3SDZA 4M1SA 4US0R 3UMSA 4DCTA 3SJZA 3SNHA 1U8YA 3NC1C 3SE0A 4UQOA 4PR0A 3TBKA 4NONA 4I1OA 1U8ZA 2GJSA 5IK2A 1U81A 3MLEA 4RCYA 2ZUBA 4IFEA 5JCZA 2F55A 1NI3A 1W4CA 1YZUA 5KHOC 4LJ4A 2CHVA 2J0VA 3MCAA 4EPYA 4OI0A 5CYPA 2G1KA 1RRCA 4D0NA 2QUZA 4F93B 1XZQA 2CJWA 4BPBA 4OQLA 2UZIR 3AVVA 2BOVA 1KDTA 5SZIA 2WKQA 1KSFX 4TZ6A 4AKHA 3GLGB 1II0A 1S8FA 3K0AA 2OT3B 2QAGB 4PTLA 5KYKA 1CRPA 1L4UA 2IYLD 1KI6A 4L8GA 3WMFA 3Q8XB 5FFMA 3FYHA 4IXMA 1P9RA 3OESA 3REFA 1X1SA 2F3RA 1GKIA 4V0OA 1Z6YA 5GVRA 2GHIA 2J3EA 2OLJA 3EZ6A 3TLXA 3DKVA 5JJLA 1UKYA 5LDDC 2NPFA 4M1OA 3PIRA 3W5IA 3QPWA 4IOLA 4LPSA 2WSSD 2GXAA 4ESHA 1FNMA 2GZDA 3FMFA 5EXSA 3RRNA 1JR3A 4NYMQ 3WHKA 4KBFA 3MWLA 3OIUA 4JLJA 5JS8A 1KSHA 1Y63A 3KB2A 2VF7A 3JZMA 4IEEA 5A4JA 1R4AA 1ZC4A 4FWTA 1E2FA 1G5RA 2P5SA 1W5TA 3IBYA 3M4YA 1X1RA 1IY2A 4Q7LA 1XPRA 3C5CA 2WWGA 2IA5A 2WOOA 3QNUA 721PA 3OHMA 3ZQJA 4YQFA 2FSIA 3NEYA 3CM0A 3PUWA 1RPZA 2VP0A 4Q1DA 5CJ2A 3C7KA 4AC9A 2OSBA 3AUYA 1PLLA 1NY5A 2WOJA 4L16A 4N3NA 3U4QB 5BYJA 5LBIA 5J5CA
chains in the Genus database with same CATH superfamily
4M1ZA 4WLNA 4HNHA 2AFRA 3SZOA 3EXHA 2H4XA 3PHCA 1NI4A 4UNQA 4UOEA 5KC9A 5AW6A 1NHWA 1VBNA 3HXMA 3EH1A 1KHTA 1JZQA 2HSZA 3CRNA 4XEHA 2O1SA 3W05A 5JBNA 1OWPA 1A3CA 2YOFA 2EJUA 2VJMB 1FPQA 3UWMA 4XWWA 5KSZA 3QU4A 3T7CA 4UCFA 4DMRA 1W0KD 3FYUC 3I8SA 4M8NE 1O6FA 1H5NA 5KQSA 2FFRA 2O2IA 4QWWA 2Z6VA 4Q3BA 4P53A 4ND3A 1B0UA 2C5LA 4RX1A 4RTLA 1NVMB 2R6FA 3IOMA 3KD3A 4AL4A 5JHGB 1GCAA 1TU4A 3W78A 4BZZA 1WMEA 4UUMA 1K9SA 2CYAA 1XHEA 3UTDA 2Y8EA 1QHXA 3UJBA 1ZN8A 2OECA 2W93A 5HFJA 2HWXA 1YI1A 1U8XX 2AOXA 2R5FA 1RJFA 4HFJA 1RLJA 2PBFA 4GDFA 4GYWA 4WA8A 5IVDA 3STVA 3UJPA 4HWOA 1BVHA 2ETXA 3Q9SA 1Q1NA 1QAQA 2JCBA 1E3SA 2SCUA 3LGAA 2CK3A 3QWHA 5FORA 4CWAA 3FTNA 4IRUB 4Y6SA 5FUWA 2XGSA 1NVWQ 1QO7A 1YU6A 2FZKA 4OMCA 3IXLA 3UJ6A 2V8OA 3HVHA 4M37A 3V1NA 1X1QA 3GRZA 5LQMA 3WLTA 2I62A 3KFLA 3H9JA 1G8PA 2CLEB 4JSRA 4DMCA 2COEA 4G1VA 4EI2A 4YAUA 3A6DA 4ZDKA 1LSOA 1R16A 1ZNYA 4YONB 3NUQA 1BYUA 1P0CA 3TTYA 4XVQA 4ZICA 3P19A 3ZC3A 3RYHA 4OXKA 3N76A 3CO5A 2GRUA 1A5AB 2G67A 2I9PA 3A6FA 1C7IA 2PT7A 3FYUB 3JVUA 5DVZA 5F21A 1XAHA 3OZAA 1I2MA 1U6KA 1M0TA 5IBPA 1L7XA 2RFLA 5FBKA 4PQFA 4ZQFA 4MV1A 1D2MA 2ZYVX 4O1HA 4QSMA 3W0LB 3MTIA 3SWWA 2PS1A 2ZB7A 4H6PA 5HDBB 5EJ4A 3SJBA 3W1VA 2OM6A 3PRKE 2PMWB 1W2WB 3RFVA 1RYBA 3QF4B 2VJMA 3TTXA 1ZR2A 3QWIA 2BYTA 3R77A 1W1UA 3FUVA 1QFZA 2R47A 4IHAA 4IV5A 1L9XA 1VP9A 3VKWA 5AVTA 4LBWA 3WQHA 3L6BA 4NZNA 5LCXA 1H2ZA 4CEHB 4BAUA 3NHRA 1IPFA 3LGXA 3A0RB 5DDIP 3F6BX 2JFFA 5E1MA 3NHYA 3UJAA 2SHKA 4EUNA 3ETCA 5IVKA 3IBFA 2ZIEA 3G85A 1YTLA 3CE9A 1ZICA 4WY5A 2ZWPA 5AI9A 4US2R 2LNDA 4BC1A 1PF7E 3VNUA 4MWBA 1RQRA 3GJTA 2DWUA 1VLZA 1H0KA 2IZ6A 3ZDRA 4AK9A 4E5KA 5K01A 1G18A 2ADMA 4IFBA 4G41A 1LV7A 1QB7A 1IHPA 4MW9A 3U7IA 1T8UA 4BJ5A 5MF6A 3UHFA 1KGSA 8OHMA 3LY9A 2XYQA 3QSYA 1U11A 2PZEA 1Q0ZA 2NAFA 3B3GA 1UWVA 3V8NA 4OYLA 4Z4GA 1ARZA 1P61B 2CXRA 3PRHA 4JAVC 1H5QA 3NT2A 4QOGA 1J8FA 3VPSA 3E81A 4FEYA 5FLYA 4LNAA 3RANA 4PV7A 2XBLA 4PO3X 5JSHA 3FMPB 1Y1TA 3QPBA 1E0KA 5IKEA 2AZDA 1X8XA 2X7HA 5DCUA 3S6JA 1HE5A 5FBZA 1QQ5A 4JZKA 5T7BA 1KZ4A 1R8XA 3DHYA 3E1KA 2IDKA 3P0RA 1E89A 4ZCPA 2MU1A 4UMVA 3NM4A 3SNKA 4EG6A 5GJBA 1RRKA 3D8SA 4F5EA 2QZ4A 2EWWA 4ZVRA 1NR5A 1U1IA 2Z98A 3G9UA 2XZOA 3G2HA 4QU8A 4K81B 4N5MA 1E99A 4TLDA 4FN5A 4A1OA 1CS0B 4RM2A 1C0KA 2AI1A 3K9FC 4JT4A 5EIOA 3BRSA 4YASA 1VJDA 1J2JA 4MGEA 3NETA 4ZAYA 4DRXB 1R9MA 1AUOA 3KAJA 3MTBA 5KVVA 3T1NA 1NF2A 4IRMA 4HK4A 1ZGBA 5GV7A 2NUPB 4TTPA 4CFSA 1JG2A 2IBMA 2WYWA 3B9BA 5B1EA 1L5OA 1VHLA 1UFQA 4GKAA 5TQVA 3T35A 3ZWNA 1MD9A 1NATA 1Z4NA 4YMLA 1Z37A 1XZEA 5LQDA 1U8CB 3FJOA 1E79A 2AFIE 4BNYA 3PD0A 3LY5A 1B7GO 4MRSA 4P31A 4GBJA 4Y6OA 3VTZA 3WKDA 1JIVA 2I54A 2XRFA 2JFYA 5K51A 3E3NA 5HDQA 2NYRA 2V4MA 3I73A 3TM4A 4PFJA 3ZWKA 4YCSA 5HW0A 4K6FA 4KQGA 3ZK8A 2OO3A 4N0PA 2NTYC 4BZWA 4AZ0A 3GAFA 1D3AA 1TRHA 1X9HA 1U1CA 4LFCB 2RGCA 1PG5A 3H2YA 2BSXA 4LYAA 5AM5A 3QFTA 3QP9A 4O2AA 4BUZA 4MUBA 4M22A 2H1OA 2C97A 2ZRBA 4BFLA 4LRTB 4NBUA 3O91A 1TIPA 2QMHA 2BMAA 1Z2OX 2P9TA 4DPLA 1OPXA 2ZCUA 4ZODA 1TMGE 4GX2A 4UBKA 1XLVA 2W4MA 3R0IA 4CMIB 4NBNA 4UEKA 1J00A 2IHNA 3LUGA 2BHNA 1PL7A 1SG9A 4ZTUB 2O8FA 4P38A 2I91A 1L5MA 1VL0A 1A4IA 2YJ3A 2CGEA 2Y6VA 1RTTA 1IIBA 1EINA 2NU6B 1LPNA 2R6HA 4LEIA 4OYHA 2WG0A 3DLAA 4QUEA 3DO6A 2QTVB 2CFRA 2CYBA 3OKPA 1IH8A 4KQCA 4CCWA 3VRHA 3ZDQA 3N8IA 4DA0A 2A33A 2QZSA 4V39A 4JI2B 2ERXA 1N7JA 4JHXA 2GYYA 5KU1A 3EGWA 4DRXA 1TO6A 4PXAA 3GEGA 3HKEA 4DTCA 4ZYLA 2VI5A 3SVLA 3ZDXB 2PUDA 4NP6A 2NUPA 2EZUA 2EBFX 3JPWA 3NLLA 4A16A 1O95C 3VI4B 5JAMA 4LBYA 1C2TA 1IVSA 3BH6A 3QENA 2O0JA 3G88A 2HNKA 2OCYC 3ADBA 2G25A 5THQA 5IVPA 7AT1A 2L82A 1VMDA 4MQEB 1RWNA 1R88A 2FTKE 2RGUA 2ZPUA 4DLBA 1FRQA 1GG2A 1Z26A 1YS2X 1XTRA 2JJ1D 4QUDA 4BWFB 5DNEA 1E18A 2VPXA 1JJBA 4HC4A 3OZ7A 4MK4A 4ZPJA 4B8YA 3QUCA 4RVUA 3QX3A 1C3VA 2D1QA 1RPNA 2IEDA 4G1BA 1CKEA 3NU1A 4BUJA 1IBKB 4ZO9A 4KREA 5K0JA 4G0WA 5GZ3A 4JR0A 5BXQC 2L0XA 3BGWA 3FYCA 2R8OA 3NBUA 2NQ2C 4ME6A 4OQMA 3K8YA 3QOWA 4QGFA 4BGEA 1UAAA 3VDNB 4X54A 3ZNQA 4EECA 1EI9A 1DMRA 3M4NA 4Y6QA 5IC5A 1EFLA 5IJAA 1QHFA 5EKXA 3REQB 3WA6A 1E5DA 4HNRA 3OSUA 5EEHA 3FPBA 3VR2D 3K6SA 3ZVMA 2VP9A 1V41E 1P2GA 1YMVA 4BLQA 3WYBA 1WDKA 4CTNA 4BNFA 1M6HA 2GKOA 4FWBA 3T3HA 3RRZA 1CUVA 1YDGA 4WINA 5JLAA 2RGYA 1KJQA 3GGGA 2NU6A 3OURA 1L2TA 3L07A 4MPTA 2PM8A 1U3WA 3GW8A 2EIHA 4V0SA 3VAYA 4E5YA 1SU6A 4DUZB 3RNLA 1SKMA 4LFAB 4TT3D 2G63A 5CYGA 1VXRA 4HDNB 2QTVA 5A5FA 5F76A 4JXKA 4D4HA 4HNSA 4QTUB 4BASA 4RC9A 2W42A 3CEJA 2VTKA 3EODA 3HYCA 4DSTA 3GRPA 2Y05A 1DG9A 2VDLB 1P7YA 1QMGA 1Y42X 2XMPA 3N0VA 4XX1A 3S5UA 3TVDA 1P6QA 2VUIB 3GVPA 5ADUS 5LLTA 3TNJA 1SQ6A 5M3BA 1SQ0A 2JGDB 2PA0A 1W88B 3AUSA 3UK7A 1ODTC 4RSHA 1LLDA 1VGQA 2L17A 3JY6A 4I4TF 4ZCTA 5KO2A 4EO4A 1XELA 1XZPA 3G6WA 1O5OA 3BL6A 4IDDA 2ZSHA 2YJTD 2J9YB 5CDSA 1WEKA 2GTHA 1HE8B 4NV0A 1E66A 3I0ZA 2F3UA 3C1UA 4NATA 3RHSA 3VPXA 4MQEA 2Q5HA 4M0PA 1KMMA 2F8MA 3R9XA 1AIPA 3LNTA 4JZYA 3SQNA 4AY4A 1TAGA 1LTKA 2B35A 1EQUA 4PLGA 4XPIA 2OCKA 3HI6A 3UOGA 1GEEA 2I7DA 4FW8A 3LQRA 4BCBA 3G9TA 3THYA 5ALLA 2D0OB 2JJQA 2A9VA 3D7LA 2AXQA 3BHMA 3KYBA 3MCWA 2AMFA 1UP4A 4U1RA 3IP6A 1JR3E 4INOA 1IIRA 2PMFA 3DB1A 2TSYB 3HBFA 3LPDA 3B13B 2X76A 1TM5E 2QRJA 4B3FX 3AQIA 1NRIA 2DHCA 1MVOA 1MVLA 3DEJA 4ZK2A 4RTQA 4J6EA 4WJZA 2IW1A 2PLNA 4HUJA 4UCWA 4GL2A 3JQRA 1HI9A 1NKTA 4TM8A 3REQA 4AUKA 2QT9A 5HEKA 4W9MC 1FYWA 4IXDA 1MG5A 1I9GA 3M5CA 4NJOA 4UARA 4YJHB 3SC4A 2WYVA 2BZ0A 4LV8B 4HRAA 1J0DA 2FPMA 3IQDB 3WDKA 3STXA 4BHTA 3SKYA 3A58B 1N36B 1JH9A 1FTYA 4ID9A 1S3FA 5J2UB 4EMBA 1L4BA 1O7JA 5F98A 2P3SA 3UHJA 1LU9A 2P2LA 4QVIA 2O59A 3AM4A 1NDUA 4HDNA 2O57A 1P1HA 2GZ1A 2UUCB 1ESCA 5F2EA 2QQGA 3IAUA 1RKUA 3DOHA 4WY2A 1Q7CA 2OCIA 3OMWA 2H17A 3PUXA 2WIKA 3QJGA 3RWOA 1SUWA 1ZR4A 1V43A 1VE6A 2FSPA 4LECA 1KF0A 5EGSA 2D2FA 3SSOA 4IX1A 3KQYA 5HE8A 3E05A 1XZFA 3WK5A 4EGCB 1YRWA 2JGDA 4FC7A 2IIQA 3VV3A 1O87A 4EYQA 2GPWA 3PE4A 2AZ4A 1CT9A 2J33A 3D1LA 2QLJA 4OH7A 3QJ5A 1IAQA 5EP1A 4YRIA 5CD1A 2HRZA 3CR8A 2EERA 2X58A 2XMDA 4PO9A 2Q0HA 5T3YA 5JANA 3HK2A 3P26A 4DDHA 2O06A 2FW8A 3HBNA 3H0KA 5K5EA 2A9JA 3FI9A 4KV9A 1H3FA 3V8RA 3ZHZA 3VNAA 4YBZA 1FFWA 1MJGM 2Y1EA 5TJ9A 3JAWB 5I4CA 1UMBB 5BNFA 4RMHA 4EF6A 2PGDA 1AGRA 2B92A 5LZ7A 4RPHA 4ZVMA 2C5AA 1FP1D 2R6CA 5ALXA 3UKDA 1GTJ1 2PTHA 4BFCA 1B3RA 5ISMA 5TF4A 2HYDA 2PRKA 4JI7B 3UB4A 5IZCC 5EERA 5JMWA 1IDN1 3AR9A 1CY2A 1II9A 4HH0A 4FE7A 1E1CB 4WKPA 5T8KA 5HZGA 3DC7A 3I09A 4MRPA 2I3ZA 1W4RA 1ZN9A 1OB5A 4J7AA 3EJ6A 1N2IA 1QG2A 1A98A 3UK0A 7YASA 1O5IA 4HJXA 5C1IA 2EYQA 4Z53A 4OFZA 2FX3A 1QBKC 3EOAI 4YJHA 1E4VA 4MJLA 2P1RA 4QBFA 2Z8YA 3UKOA 2BEKA 3E53A 1P5JA 2C5SA 2BFCB 1EEHA 1YIAA 2FEXA 1FA9A 5DEOA 5ULLA 4HYEA 3VHXB 2VWPA 4IP0A 3ZCUA 1IHOA 2W43A 5J2UA 2B4YA 2D59A 4RPKA 4HQKA 2XH8A 4XJSA 5CW1A 3ZQ4A 4KXWA 1VPLA 3QA3E 4CI9A 5EHXA 3THWB 5A4DA 1NBMD 1Z5OA 3SIRA 4BNTA 4OBBA 3RS9A 3HJFA 3ZIAD 1ENOA 2C2HA 2CBXA 2XIQA 1RQGA 3EQ8A 1QFJA 1ZL2A 1WDMA 5D51S 1Y6RA 1AS0A 1VG9B 2B21A 2W8BA 3QMMA 1M1NB 2VR1A 2CDBA 1EH5A 1GQSA 4J1TA 4R83A 3SS9X 4MHOA 1XNRB 4LHZA 1DAIA 5DASA 1E2IA 1D5CA 5JWHA 4I36A 5FD8A 2I4TA 2CZQA 3BFVA 2YXPX 4KAAA 5JRDS 1XIVA 1Y5NA 1CV2A 1FX0B 2X0EA 4ALKA 3I32A 4YV1A 4J4HA 4ZYXA 1UJCA 4L74A 2P1DA 1QCCA 2ATIA 2PR7A 1CRQA 1J70A 2B0JA 3I3SR 3F6YA 5T67A 3D6MA 4IVNA 5A06A 4DLVA 2IXFA 1AMOA 3D64A 1FU4A 3KS9A 5HF5A 2RGBA 4LSMA 3OJOA 1HEIA 3JAWA 5HOQA 1IBSA 1UMBA 3ABQB 2JI4A 3AHEA 3DE7X 2OHJA 4RZSA 2OHVA 2D00A 2GETA 2KJQA 3SU8A 4DQXA 1NIPA 3FW1A 4AMBA 5I3CA 5FUXA 1ONPA 2GN2A 3L01A 5ALEA 2IP4A 2YYAA 1VJ1A 1ZU5A 3U44B 4WKOA 1I3NA 4MQLA 4PRKA 2CXHA 3LY7A 5DMHA 1L5LA 4BB6A 4D4GA 5CFMA 4HDKB 4KKXB 5IHPA 1U2TA 1CX9B 3GDWA 3QG1A 4MEBA 1AU9A 2WTNA 2IDZA 3CLUC 3V8BA 1P6UA 1ANKA 1QR2A 1SCDA 1WA5A 3A3OA 3TI9A 4WGGA 4C6RA 2DUNA 4W5TA 5KCZA 4EZEA 4W7HA 3OWHA 3MRSA 2OENG 4FDTA 4BWGA 4AIIA 1QGUB 5AVUA 2BFCA 3IO3A 4LJAA 2QTWB 5ICSA 1BA2A 3CZ9A 3D8NA 4M89A 1XWWA 4HOYA 3TL6A 4DIBA 4ZFNA 3VHXA 3KZVA 5CA1F 5K45A 1FSPA 1A9TA 2QP4A 3B3QA 3HDYA 1I4OA 2A86A 2IUSA 4HZUA 1APBA 4KQ2A 3WGVA 3BBLA 1U28A 3KKOA 2GO1A 2V7XA 4TTRA 5E3IA 4ENPA 2K2QB 1Z2PX 2ZS7A 4YDSA 3V4VB 5COQA 2VOEA 1P75A 4M53A 5EJAA 4BKOA 2GBCA 1XTPA 2WJZB 3F3MA 1SK9A 3NP9A 1JA0A 1A9ZA 1AHNA 1M1NA 1XRQA 2Y92A 2GZMA 2BGKA 1DGQA 4XUEA 1M74A 1G8FA 2JIDA 1ZNZA 4B0OA 4B31A 4DVGA 3BIOA 3L2OB 4GOXA 2JD2A 5I7FA 1XTZA 4TROA 5TARA 1YVEI 4G2TA 4KXYA 4MIKA 5CAEA 5JYBA 4IHKA 1Y1KE 5CLJA 2WWVD 4OY3A 2JDID 2H92A 4O08A 5F9FA 1EWTA 1JPNA 2CDCA 3HFSA 2EX0A 3GMSA 1NNSA 2B34A 5SY4A 1MQ9A 4ITRC 3UPDA 1RDFA 1VKZA 3TLKA 1U0NA 4QOJA 1MENA 3IEKA 3X1WA 1S9DA 4F9FA 1JG7A 5TE9A 2JG3A 1TKBA 4TXJA 1VJ5A 1GAEO 1LH0A 3M9XA 1TTTA 2CLKB 1PZEA 3Q1LA 3H18A 4PRZA 5B1DA 4BFTA 4L78A 3U44A 1SKUA 2PGNA 2JBAB 2R1VB 3RRMA 1KFJB 4DZTA 4AECA 1Y9ZA 1JXMA 2OESA 4FGSA 5AM2A 1G63A 1RYHA 2COUA 3Q7QA 4LDNA 1AV7A 2N1BA 2VAMA 5FL7D 4AS1A 3GH1A 1U8UA 4QPZA 3AJDA 2XQJA 4RVDA 5FOUA 3ILYA 5IULC 5EN4A 3DTTA 1Z88A 2A5YB 1GM5A 3UPTA 2V98A 1WL8A 4CMCA 2QTTA 1Y9EA 3V7FA 2I87A 4DF3A 3RYCB 1QGUA 1JFSA 2JK1A 1OFUX 2I0FA 3OLCX 4RKWA 3H1AA 2I2DA 1P2BA 4GMKA 4ESVA 1UPUA 1NYLA 4NEQA 4FR5A 3FFWA 4Y6LA 4B4UA 2JKZA 2DLDA 3HN6A 3OIVA 4Y2HA 4WAUA 5DYWA 1IXSB 2PX3A 3GO4A 3ZZ0A 4JODA 3OCYA 3ZGYA 1SY7A 4DR5B 4GL4A 5BUCA 3PQEA 1NONA 3DZKA 4Q21A 1VLVA 1E5QA 4MA5A 4NENB 1ZMTA 1J4AA 4WNIA 4B40A 4KPEC 3LPCA 4KX3A 4N1AA 4C14A 1WNTA 2NAPA 1KDRA 5JDIC 1ZS9A 1G5IA 4EUKA 4ZZ1A 2GCGA 1WZCA 1D4ZA 4GUDA 1TYAE 2AE2A 3RSCA 4M87A 3C6ZA 2C1ZA 3CT4A 3F6RA 5EHQA 5F7ZA 1H23A 4LKOA 4Z1MD 1NX9A 3BD9A 3TN7A 1E59A 1Z5ZA 3ZGOA 1WSBA 3ZD8A 2J3IA 3MIIA 3IT2A 3K2IA 3AILA 2JIPA 4OK5A 1Y7HA 3KHTA 2BHTA 3PF8A 1D04A 2NO9A 3DPSA 2OK7A 3RVLA 3TECE 3NHMA 1JHQA 3EIFA 4UHEA 4AYXA 2BV3A 5LQAA 2QVLA 3V2IA 5LUAA 4LJ5A 2O3SA 1X7ZB 3KEMA 3DE3X 4JNCA 3O7WA 4WKGA 4ECAA 2F4VB 3CNBA 1H42A 3WZMA 1QRTA 1PDWA 2CMHA 2GBLA 4OUDB 3WLMA 4CV2A 5CDFE 2XIJA 3ZI0A 2Y2UA 3H8SA 2C0CA 4ESOA 2JBAA 2R1VA 3EMKA 1YOVB 3QQ5A 3B1WA 1ISPA 1FU7A 4WXRA 4M1MA 1YK1A 1QDEA 3WLIA 5IG2A 3CISA 3F8SA 4XIIA 4AT1A 5HF8A 4P7FA 1D4FA 1PV4A 4X6YA 4WXEA 1YVDA 1FPMA 2Z1DA 2ZB3A 3I45A 3KT8A 5GWXA 3U7JA 4NMHA 3VR5H 4MS3B 5JJ5A 2DY0A 2G04A 4ETWA 1I30A 3TRHA 2WQZA 2NLOA 3TXAA 4CLRB 2EJVA 4L2IB 4OFBA 1RRPA 4U7GA 4JSTA 5IUKC 1MB9A 1NNLA 3JRWA 1J9ZA 1V5GA 4CUKA 4HH3C 3AI1A 1Z6TA 4OMDA 4BX9A 3GAAA 3PCRB 4HAUA 3AIOA 2QQFA 5EUBA 1J2TA 4E3ZA 3G5MA 2F48A 3I42A 4JBWA 3KV1A 5DNYB 3JRXA 4F0JA 5LN1A 4MYHA 1YT5A 2AJCA 4RJLA 1F5SA 2AH5A 4TMTA 1VC2A 2VNHA 4JC5A 4CQMD 3O0TA 4C76A 4KYTA 1Z28A 4OK3A 2IXGA 1GYPA 3I4CA 1ZOPA 4TTIA 3TL2A 3WLQA 5LVAA 4W8OA 3LQKA 3EXEB 1FMFA 1MKYA 1YQQA 1XX6A 3FDZB 1GTRA 2XE6A 2D7JA 3T0GA 4QGSA 2AG5A 2XOKD 3CWZA 3KAKA 1WPRA 5HIAA 3W2EA 3ZWYA 1JIQA 1IN8A 2B2NA 2PU7A 4D0RA 2I6FA 5J3JA 2JKVA 5AUNB 2W48A 2XJ4A 3FWNA 1B00A 1F8GA 3RIXA 2BY4A 5FNVB 4EELA 3V4PB 4BQOA 5JAPA 3DM9B 1X7ZA 2FSHA 3AOEC 1QO0A 5I01A 2B8TA 1KBZA 3CQ9A 2J4CA 5CK5A 4R8KA 3RSQA 2X41A 1RHRA 1XT6A 5FHRA 1N2JA 1RJGA 3PI6A 5A0FA 3KBBA 3C6KA 1E7WA 4R71A 3R3UA 5HQ3B 1YOVA 4PGHA 1NG9A 3ZDCA 2JH8A 4G0VA 2YINC 2VATA 3K5WA 4O2RA 2QPTA 1EXVA 3I6MA 1Z4KA 3PRJA 4FMCF 3K0FB 4RAOA 5IVHA 3CW9A 1PQPA 4B6SA 4FDVA 4FT2A 4HGOA 5GP1A 3DOEA 4ZIRA 4MS3A 1ZXLA 1Q0HA 3MILA 3P0FA 4MWDA 4E94A 1OYVA 5B57C 2XVAA 4CLRA 4BTLA 4L2IA 1VSVA 3WR5A 1U6IA 2X2PA 2YY5A 2ZRJA 4GOLD 5JDIA 3KT3A 3VC1A 1A82A 3I37X 1S4QA 2GM5A 2GUWA 4QHSA 1JSRA 4R8SA 5CPFA 5CXXA 4AYTA 2FP3A 2HSGA 1D03A 3FKSD 3A28A 3HBAA 3DV0A 3BGOS 1ISMA 4KLCA 3I6YA 2C95A 1UBSB 2DH5A 1J0CA 2ZITA 3G0HA 2B1QA 3E6AA 2OXCA 3QUQA 4KAJA 4KXXA 1NP6A 4OIMA 4PNHA 4CL2A 2C2YA 1J33A 5EJGA 3RI3A 4XWOA 3ZWBA 2XMCA 1UKEA 3HZZA 1XKLA 3NBKA 4JT2A 4KRFA 3EXEA 2DCUA 3TMKA 5CG2A 3WGQA 5ICFA 3FDZA 1T9ZA 1FX1A 2VQFB 3LWBA 5INTA 5JHHB 2IZZA 4GE0A 1XHFA 4TUYB 4QXQA 1C3LA 2WSMA 4NSNA 4EJMA 4LYEA 4HB0A 5IVIA 2Q7OE 5LYJB 3FR8A 1D2CA 2ZIZA 5IDVA 4HADA 4NOJA 2BR4A 2E85A 5FADA 5TC4A 5FNVA 4EJSA 1J9GA 1O94D 1NUUA 2Y0PA 4HH4A 1ST2A 1UC4B 4OF4A 1ADFA 1ZSYA 3L82B 2WQ7A 3V4LA 3ECSA 3OT5A 4NZ9A 1MV8A 2BGJA 2RCYA 4XTRA 2BUCA 2G7ZA 3H42B 2GSDA 5FTJA 2HA3A 3DMNA 2MR5A 4B4DA 3FGPA 3KJGA 2DT8A 2C78A 1Q7GA 4MP3A 4F6LA 5CA0B 1IN4A 1U2SA 1LDBA 4GC9A 3U4HA 2DFLA 5IMBA 2CC2A 3FKJA 1BS1A 3TIXB 2A9FA 5HQ3A 3ZNOA 1QGDA 2NZYA 2W2LA 3W5UA 5IJWA 4IR7A 3PP8A 2JI8A 1CD5A 4TRNA 1SWWA 2JKYA 4BUCA 2OBNA 3K0FA 3N7UA 1XR3A 1U7UA 2HQOA 3NTXA 5CXSA 5ELMA 2HMAA 2IT1A 3E2IA 4PHTA 1T5IA 3ED5A 3WBBA 4RACA 3ROMA 1O4VA 3PKIA 4L5BA 4YNBA 5AW0A 3ITNA 1ADYA 4L1KA 1RVDA 5HJEA 4I2VA 3T4EA 4C6TB 1LQUA 3NEAA 1IM5A 1TCBA 3GFPA 2BMJA 2ZIXB 5LXTB 4JLUA 3DKIA 3VDMA 4GHWA 1YUBA 2FFQA 1P0QA 2XUPA 2A9OA 3R6LA 4GBED 1JSCA 2RHMA 1H2AS 4Q03A 2XB2A 3C8HA 4P93A 3NATA 4Q3KA 3BE5A 1WUJS 2CXQA 4QRDA 1FDVA 2XHEA 3AZOA 1P80A 2F1IA 2RHGB 1WS6A 3NBQA 3ZWDA 1KPHA 4RXMA 2ALJA 3EPHA 1EM8A 2VZ0A 3TD6A 1B93A 3KT0A 1XZIA 2MSCB 1U9YA 4IVQA 1BW9B 1MJ5A 4OD0A 2DU8A 1XMSA 3KOZA 3W5HA 3CZQA 7REQB 4R4JA 1R0SA 4Z0TA 1USWA 4YUZA 1HNZB 2XGJA 2JFPA 1G0OA 1BZYA 1SUIA 1F6BA 1TB4A 1U3VA 4TUYA 3J7TA 2IYAA 5G1OA 1EBFA 1VCIA 5TT1A 3IRUA 2PYZA 5FOSA 3B1ZA 5LYJA 1JSXA 2QTCA 1YFLA 1BYIA 1R8JA 4GLBA 5AIBA 2QPOA 1EFVA 1SHZA 2NPOA 2ZZMA 2I7CA 3P0HA 1SXPA 2PBZA 2ZI4A 1OI3A 1Y5MA 1NMYA 5FULA 4PLWA 2R66A 3WY9A 1VZ3A 1HZZC 3LUAA 2EX4A 1QOZA 3PGLA 1ZJWA 5G41A 1SVNA 5CB4B 1P4RA 5CA0A 4TLBA 1E9EA 2CNNA 3WLRA 3VTAA 4D81A 2QVXX 1QQTA 3R7FA 2ERCA 1Z9BA 2O2EA 1C7EA 3RHFA 3D7KA 3AQ4A 3U62A 1EBUA 3RIHA 4EK9A 5EQJB 1EX9A 2RHOA 4CLDA 3EAQA 1PGOA 4YTEA 2ZSFA 1NFQA 2PAFA 3AINA 1ENPA 3B6KA 4KP7A 4RZQA 3AY3A 1GNRA 1IG0A 3F7TA 2HMUA 3F46A 1XU7A 3IODA 1SCAA 2H2AA 3AFHA 3SMVA 3SZRA 4C6TA 4D4LA 4DY4A 4EX7A 3N8DA 2XX3A 1SH7A 1F48A 4DPMA 4EEKA 2VWGA 2ZIXA 5LXTA 1DIBA 1HFWA 2D5AA 4IWYA 5A3VA 2Q5CA 2FMUA 4BLWA 4GDMA 4S2EA 1R4MB 1MH9A 2GZAA 2LKDA 2OGUA 3R3ZA 4W7SA 3EXG2 3M82A 4Y9TA 3K9BA 4OYYA 5KDOA 5EJIA 5EIBD 2DQ4A 3FIJA 3SXJA 2D0DA 1UDRA 3GWZA 1Z8HA 2X4IA 3HJNA 3GPBA 5BOSB 1SQGA 1IWBB 3G5LA 3HVKA 1CR1A 1GZHB 2UVDA 4Q24A 4C0JA 1GPLA 4CPDA 1JFRA 1TEXA 1JPJA 1XEXA 4MCHA 4Z0NA 3F5QA 3TQRA 1Z07A 4RZIA 3UIEA 4P4UA 1A8HA 2OVFA 3WVNA 4B3XA 10MHA 4TQUS 2ZBGA 3U13A 1BW9A 4B46A 3SX2A 3K0SA 5A3SA 1L4NA 1J90A 7REQA 3FOZA 1UAYA 4AP5A 1XEWY 2OV8A 1PGNA 3HO8A 4I8IA 1EUDB 4EAQA 4LF7B 4GF5A 1T2CA 1GZ6A 4M0KA 2J4FA 3GRUA 1JLKA 3NYWA 4G5FA 4BX0A 5ICGA 5LLDA 2RGEA 2H1FA 1DQSA 5CIWA 1I1OA 3LQ4A 3RBVA 1ZD3A 2R1ZA 1H2WA 3EZ7A 3P8ZA 2ZQZA 1SIWA 1M67A 2BKLA 2R8EA 3HDVA 2FKAA 3O26A 5CPBA 4NH4A 1F12A 5LQRA 1L3BA 2I78A 1OGJA 2FUCA 2BBOA 2Q0SA 3LBIA 1CQJB 2Q3EA 4MSUA 5CB4A 4G01B 2FOLA 1N92A 3B12A 3QFSA 4TKVB 3EDYA 1EK1A 3MUOA 3S2UA 1Z0ZA 3TQCA 3TQSA 4EHHA 2BFDB 3QE0A 3IMKA 1TYDE 3U9TA 5ADHA 1K97A 4NBVA 2CLHB 3S8YA 4JEUA 4N3AA 5L53A 5D7NA 4BVFA 5HRUA 4ROTA 4DIKA 5KYWA 2D5CA 3EUFA 5AUQA 1AVTA 4P7JA 1VBFA 3AUKA 4FJ1A 1YQEA 1AGNA 3CRMA 1BXRA 2HHCA 2OZEA 1OYOA 3EARA 2XB4A 3IIJA 3BUSA 3KYIB 4HBZA 3CFYA 4Q19A 4RD6A 4REMA 4UVGA 5CVUA 1UPBA 2AQKA 3CN9A 4YY3B 3L8FA 3BEDA 1P9WA 1XXHE 2VHCA 1R4MA 2C7GA 4XLLA 1FNSA 3D7NA 3TXYA 2C7QA 1JMVA 2V6JA 2X9LA 3KHKA 4TYYA 1FTSA 2XA2A 1NBME 1JNXX 1U2QA 3HSYA 3JWEA 5HILA 1AE1A 4NYIR 1D7OA 1NVVR 2J0EA 3MJFA 4M88A 3T94A 4MI6A 1A4XA 3IL2A 4RAQA 5EUQB 1PFYA 2Q4DA 3VISA 4DABA 3QU5A 1ZI6A 1CJBA 4IIXA 1GG5A 2C94A 3ML1A 3OEED 4M9UA 5F5NA 4A8PA 1CF4A 2WUVA 2XA1A 1VJGA 1EX1A 1PDVA 1AKUA 4RVSA 3BXPA 3NONA 2WTBA 3PXGA 2D0IA 2WJGA 4DCCA 1NLFA 1QX4A 2V6BA 3GA0A 4X24A 4E03A 1XMJA 1EUDA 3OCJA 5IN5A 5BSGA 1NE2A 2PZMA 2X9GA 1TJNA 2OWEA 1VFNA 3KEQA 3J81A 4O0MA 4V0QA 1PJAA 1H8HA 1DKQA 2AI2A 4FD2A 4KHZA 2XZTA 5AK3A 1IYZA 5KHAA 3FN4A 1HQKA 4U7DA 2C4HA 2YJ5A 3FCEA 1G4HA 3FYSA 4R8MA 4DSAA 2F8SA 1B8UA 1T29A 2G09A 2Y1KA 5ARCA 4DAEA 4XCQA 3QY0A 1YZ3A 1IVNA 2ASVA 2RJ3A 4B6QA 1KQ3A 2OV2A 1CQJA 2OXFA 1ZIXA 1KMHB 2WU4A 1N6IA 4CF7A 1JFTA 1Y5RA 2CJXA 3KZNA 3STHA 4FKBA 4DMGA 4TKVA 4BWVA 2DERA 2FZ4A 1ODLA 2BFDA 1Z0AA 1JAHA 2QROA 4H31A 4NBRA 5CM9C 3GRCA 5K20A 3F2IA 3INYA 4PAQA 3T54A 1IUPA 1UANA 2FLKA 4RNDB 4RA6A 1BXGA 3CLSD 3GGDA 4TWBA 1WY7A 4J90A 2C2MA 4NU5A 3QVLA 5TY0A 1M8JA 2BT4A 2PBRA 3P96A 3QWFA 2WWIA 3TINA 1G7SA 2PUAA 2GVDC 3MGKA 1W9MA 2QK4A 4UE3S 2YCBA 2VT7A 5H68A 1H93A 2BMWA 1Q22A 2I6GA 2WIFA 2CN1A 3HB9A 4DQUA 2JJMA 1VDMA 3C4QA 1ZDMA 3I2IA 5DNCA 4E70A 2V7QA 1JECA 4HRXA 5KYYB 2WT9A 4UU1A 2I29A 2JGFA 3T99A 2BJWA 1S2IA 3REGA 4EKDA 1ODJA 2HUNA 4Q02A 3FTCA 4QQFA 3WC4A 4AM8A 2HI0A 5C8DA 4RTKA 5IZ4A 5IEJA 4JOQA 1AKRA 5T4BA 4C7BA 3OY7A 3H5AA 1SHTX 4YMHA 1FYVA 1HYBA 3SS8A 4HGYA 1MVNA 4LHSA 3QX9A 1AHIA 1C9JA 1V8OA 1YZNA 1XBTA 2G7MC 2N0SA 3BYZA 2IYPA 16PKA 4WK2B 3NI2A 1HLFA 2DQKA 2FK8A 2IYNA 2JA1A 4NG4A 4UZFA 2O8CB 1GRVA 3WB9A 2VP3A 2QRQA 1IN7A 4ZRNA 3SYKA 5IN4A 3GUVA 4ND6A 3GCZA 4Y9DA 1GZDA 1AUXA 1OXVA 4P7KA 1P31A 3DZBA 3LOQA 5SICE 1DHTA 1SXJA 1W75A 4Z0HO 4HVCA 4ARCA 5FUVA 1ML4A 3HKBB 1VLHA 2AJ8A 3NAZA 4LY0A 4Q7JB 1ZGAA 1Q16A 3WKBA 1QIEA 2Z95A 1LV8A 1V6AA 5IM5A 4AB1A 1NVFA 3Q6IA 2HGSA 5EZQA 4OBEA 2CJPA 5DHFA 1RM5A 4LCEA 4CETA 5DT9A 3A6JA 3EEQA 3M2PA 2R62A 5HVNA 3GRFA 5L4SA 2A9QA 2PMDA 1BJRE 4P3PA 1ID1A 2DPYA 5DTJA 1T35A 1I6MA 3UWDA 1T2UA 4LF9B 2LTAA 2P3LA 3HL4A 4QDXA 4ZYUA 4IXNA 2R6R1 4LBVA 2GXUA 3ONNA 4NZMA 4TSRA 1RMTA 4O02B 1JEOA 4U5QA 1LC3A 3GOQA 1RKQA 4JJGA 2B8WA 2RHDA 3N07A 4IW3B 4BO0A 1BX1A 3NDPA 3BH7A 2XT6A 4B7AA 1WLYA 4UPVA 3ZGXA 1R6DA 3OQBA 1YRQA 2A3NA 3U9LA 2O0LA 3BWBA 2F3TA 1VRVA 4AG5A 3JYNA 5FPQA 5F23A 2PYDA 3CRW1 4R98A 4MINA 3GLFA 5C81A 5CLQA 3E7FA 2QF7A 2ZBVA 1XJ0A 2EWVA 5T64A 1UINA 2M9MA 4D0GA 2B8EA 2FMFA 2FQ1A 4G84A 4J91A 4H1WA 1FFSA 1NKSA 3BORA 1PJQA 3RWBA 4WSOA 4C0AC 1US8B 1W59A 4IV8A 5KYYA 1MOQA 2FPSA 4F2WA 1I7LA 3BHIA 3VH4A 5LM3A 5MFPA 3HHEA 3F8WA 3EQ6A 3G2KA 1YASA 3R5JA 3EQZA 1WVIA 4CEJB 4QYXA 5LQSA 3L6UA 3SHVA 3ADDA 1XJ5A 1P1RA 1XVVA 2O3JA 1DVRA 4WCVA 3TUJC 5KSOA 4UBJA 3AUAA 3BJZA 4OHFA 3TBHA 2Q27A 3UFBA 4BO1A 5BV8A 4CM9D 3GEHA