1KDRA

Cytidine monophosphate kinase from e.coli in complex with ara-cytidine monophosphate
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
221
structure length
221
Chain Sequence
AIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKGFSVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYARQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTIDYLATE KINASE
publication title Sugar specificity of bacterial CMP kinases as revealed by crystal structures and mutagenesis of Escherichia coli enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 62
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 2001-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kdrA00
1IY0A 1GDDA 1LS1A 3GJ7A 3EPHA 2ODWA 3QEJA 1DARA 3QXJA 2VSOA 4JL5A 4GFDA 3VR4A 1OE0A 3CH5A 3K1JA 4OK5A 5LD2B 4M2LA 1FX0A 2P6UA 2WIBA 3F8TA 3TNFA 2NQ2C 1G8HA 2YWHA 1SXJD 1YZKA 1NBMA 221PA 2BCGY 2JLQA 1Q1ZA 2WMOB 4DLTA 5L3VA 3O8DA 3VR5A 2ZJAA 4Y0VA 5LB4A 4TYWA 5FOUA 1X1SA 5HE9A 2IF0A 4FW9A 3TLXA 4BFWA 5JFGA 2ZM5A 1GTVA 2JJ2D 4ACAA 2ZI7A 2IHBA 3AM1A 3CKLA 4D0LB 1SHZA 1CR4A 4TQAA 1E2NA 2IHYA 2O0HA 1KGDA 3K0AA 5FUYA 1Q3TA 1XEWY 4KV9A 2QTHA 3S1AA 2WOOA 4A2PA 4HYYA 1IN4A 3ZZTA 4A0FA 5EXTA 2VA8A 1SKQA 2V54A 1Q22A 3CPEA 3I3SR 3JVUA 1R5OA 2IUUA 2KSQA 2G3YA 4DDWA 4TLCA 4EUNA 4PPGA 3RWMB 1EFTA 2BHRA 4Z1MA 4WZ6A 3T12A 3AUYA 2OE2A 2Q0HA 4V03A 3FKSA 4L15A 5F98A 4PANA 3VR1A 2XITA 5CLQA 2B7BA 1KK2A 1L4UA 1UDWA 1VIYA 3W5IA 1D8TA 1TPZA 1KI6A 2QN6A 2W2XA 4KFTA 5JI3E 1XNJA 2NZJA 5JWRA 4MQBA 4B76A 1S0UA 3R7WA 2W00A 4ZKEA 4H1VA 1BMFA 1QHGA 1W0JD 4RVCA 4UXIA 4JJZA 4CF7A 1DTSA 3DM5A 2GK7A 2GZDA 2AFHE 3DVLA 3B2EA 4UXHA 4A15A 2O0KA 2Z4RA 1UF9A 4BLSA 3RRZA 2RAPA 2O8EB 1U8AA 2GXUA 2MSCB 1CULC 4WZBE 3MWYW 3ZQJA 1YR7A 1E1QA 4FINA 5JJLA 3C8UA 1WB9A 1CJVC 2QRNA 4G5SA 1ELOA 3GJ6A 3H0KA 1I2MA 1XTSA 3N2IA 1CTQA 4HATA 5J40A 4YMUA 1EFRA 3C14C 2YJTD 2FSGA 4IOLA 2DCUA 5CM8B 3CRMA 4K81B 3NWJA 4LRWA 2NZ8A 2ZJZA 2PT5A 1R7RA 3A1VA 1JQLB 2O52A 1FP6A 2FG5A 3BFVA 3B1WA 4CDGA 2V7QD 3BH7A 4DSTA 1VG1A 1TL7C 1K6MA 4UXJA 4CEHA 3X1YA 4KFSA 1Z6YA 1W36C 2R9VA 5FL7A 3QKRA 3T5DA 4C3ZA 4LBYA 3IEVA 4F93B 4BRWA 3EAQA 2Q9CA 4LYJA 2JATA 3WRXC 1G20E 4B3DA 4A36A 4A1FA 3SBEA 2R65A 5HR5A 3TUZC 1QHHA 3Q5DA 5A4JA 4EJSA 4HAZA 2CL7X 2P2LA 4LHXA 4DC9A 1Z29A 2P65A 3AVUA 1GL7A 4C0SA 1BKDR 5EUQB 2IYLD 3CF0A 2VHQA 1D5CA 5FTJA 1YU9A 1TF5A 1JXOA 4LHWA 1NMYA 2ZRAA 1NY5A 3PIRA 3KQKA 1SVIA 5ELXA 2QA5A 1ZUHA 5JJKA 1P9NA 1QHYA 1CJUC 3ZIAD 4TSFA 2F1HA 1JEDA 4OHWA 4FWTA 4OQNA 1L7VC 1LF5A 2PH1A 3CR8A 4XTCS 1KMQA 1JI0A 4DVGA 1DG1G 2XJ9A 3U6BA 1UBEA 2J87A 1NG9A 2HEIA 1XPUA 4WA7A 1KZ7B 1JNYA 2QRZA 3FVQA 4PSAA 4E5UA 3SN6A 1COWA 2KI5A 1CRPA 3OE7D 3GJXC 2WPDA 1P4SA 3W6NA 1Z63A 1WQ1R 3R20A 5KU1A 1C1YA 1YR9A 2WTUA 2WOJA 1GOTA 2JEOA 3W3AA 4LJ5A 2NO6A 3AKCA 1KKMA 4PO8A 3W8RA 4O2LA 2WM9B 3BE4A 5CDFA 1W4BA 4DUGD 1IXZA 1PLKA 3KFVA 2OFWA 4JT4A 1WMSA 2ZS9A 4F91B 1EWQA 4LJ7A 1J99A 2DFTA 4FD2A 4HZUA 5J5CA 3BB3A 2QPOA 3IIKA 1OHHD 2ODBA 1N6NA 2FSFA 2CE2X 3MCAA 3RYTC 2Q3HA 1E2PA 4Q19A 3LBIA 5LD2C 1CR1A 1N6OA 1T8TA 4II7A 1HY3A 4MRRA 4TT3A 2QU8A 4XOIA 5H70A 4DEYA 2Q21A 2XXAA 2YC4C 1HV8A 5FUXA 1W44A 3OFNA 4Y0AA 4P4SA 4IDPA 1QF9A 1QG2A 2ERXA 1O3YA 2ZR9A 4JL8A 4Q00A 1Q20A 4B44A 4PQRA 5CYOA 3UMSA 3NIBA 5JI2E 1E0AA 1R8QA 1ZM2A 2HYDA 4RZXA 5SZHB 3THYA 4G1UC 1ZP6A 3QOFA 2EWWA 3LRPA 4PHGA 5D3QA 3RSOA 1TUIA 2QGZA 4ZDJA 1WRBA 3KUDA 4FMDB 4IVRA 4LK2A 2WMNB 4FMBB 3DO6A 3M0EA 2YHSA 2F6RA 4R2IA 3EA0A 1M7GA 3UG6A 1UAAA 4HEJA 1N5JA 2PCJA 4LJ8A 2FNAA 4A6XA 4RD3A 1G8GA 4QKQA 3A1UA 2QE7D 4URXR 1G3RA 1HQCA 4D4MA 1FQKA 1FW6A 1HTWA 3BD9A 3Q9LA 2RMKA 4PC2A 5FPKA 4OI4A 4HUTA 3KKNA 4JLBA 4N0DA 2C78A 4Q9JA 2IYWA 4HDOB 3MMPA 2QAJA 1ZNYA 3N5CA 1HH4A 3A1WA 3LWNA 3T15A 4MKFA 4PQFA 4X8OA 4Q03A 3LFUA 3EWSA 1D2EA 5IDVA 4I1VA 3BJIC 3IO3A 5SZJA 3RNLA 1F3OA 4F4IA 3ND9A 3OIVA 3MFYA 2BEKA 4DLVA 4ZIRB 5HE8A 1G5TA 1C9KA 2O8FA 3CO5A 2Q3FA 3K53A 3VMFA 2REBA 4UJ5A 4B3XA 5JMTA 1ZNZA 3QPUA 3FYHA 1U99A 4DDTA 3WMEA 4KI0A 3U4QB 2YOFA 1E79A 2XOKA 3QVVA 5DE3A 3I5YA 4KBGA 4URVR 1W36D 3GFOA 3ZD7A 3R8CA 1ZD8A 1W49A 2FSIA 4WXRA 1JJVA 1TAGA 3X1DA 3AGPA 5B2ZA 1OH8A 1GITA 1NSTA 2BVNA 5AR1A 3AKDA 2O5VA 3W8NA 1HURA 5FR2A 3OHMA 3SYLA 4A92A 4PAOA 3GJ5A 2MSEB 2PZEA 2CDNA 5FBQB 1GKYA 4OI0A 3FFAA 3Q7PA 1S9HA 2VP6A 1P2TA 3W5JA 1KY2A 1S9DA 2CE7A 2HXSA 2BOVA 5GJWC 3ECCA 4M1WA 2JIZD 5JS8A 1NG1A 2H1LA 3GLGE 2QM7A 2I3BA 1D2NA 4RFSB 2FZ4A 4BQSA 2C04A 1RW4A 2V8OA 3I4LA 4JLAA 1ZVQA 4PO1A 4V0ME 2OFXA 4DCSA 3RANA 5J4HA 3KTAA 4KO8A 4IVQA 1OSNA 1OW3B 5EP1A 5CIWA 1AKYA 2CL0X 3PEUA 6Q21A 4Q1FA 3CPJB 3U3KA 2W6JD 3B60A 2OFOA 1CRQA 3GJ8A 2AL7A 2CK3A 3SHFA 4JLDA 1MO4A 5IK2A 1MABA 2QNRA 2UVQA 1XTIA 3VKHA 3V00A 1RJ9A 3OZXA 4BECA 1D9XA 4Q01A 3AVVA 4XWOA 3THWA 4HAVA 2OCPA 2G0NA 2IS4A 1R4AA 4DLRA 2B21A 1KNXA 3IBYA 1QHNA 3IQXA 3B9PA 3E5HA 2D7DA 1ONBA 2Z83A 1NN3A 4ZCMA 3GJ0A 1OH7A 4TYQA 4OYHA 3WY9A 2ORWA 4NYIQ 2A5FA 1KSFX 1KO5A 1NN1A 1G19A 1XU4A 3UKDA 1P75A 2PCLA 2ZE8A 1ZUNB 2GAAA 2ZSDA 1ZC3A 2GBLC 2PMDA 3ZYCA 4ASUD 3W6OA 4DCTA 4BZPA 4P32A 1YKSA 4TL9A 2WZQA 2V9PA 3GLHE 2EYQA 2BCJQ 4B47A 4V0MA 1FUKA 4FXPA 1OXSC 3FTQA 3T35A 3WHLA 2AHOA 2RHMA 4Q21A 4X8LA 1Z6TA 2OCBA 1J8YF 2YOGA 3K0EA 3I61A 1D2MA 4DLWA 3CRRA 3Q72A 2PX3A 1E2JA 1XTQA 3V4FA 2CJWA 2BBOA 2JJ2A 2W83A 1E2MA 4IXNA 1M7BA 1N3BA 3REFA 2JLYA 1SHKA 3QXHA 3RS7A 1JB1A 2JASA 3GLIA 3H4MA 2R44A 1GRQA 5TY0A 3A4MA 2ZVQX 3TMKA 2SHKA 1XEWX 3U61B 1R0YA 1SVSA 1N0WA 2YV5A 3BC1A 3BH6A 1A82A 3U2QA 3L2OB 5GADl 1ESNA 4C0LA 1RRCA 4HLCA 2RGCA 3RSLA 1E94E 1KHTA 4B73A 1ZMXA 1CJKC 1DEKA 1OXVA 1GFIA 2QAGA 1Z83A 1UEJA 4Q1EA 1W4AA 3O8CA 1W1WA 2ZQ5A 4BFTA 1Y63A 3FPAA 4L9WA 4AD8A 2O8BA 2VF7A 1G8YA 1G5PA 2NO0A 4QL3A 3GLFB 1JAIA 2DHRA 4Q18A 2BMFA 1CLUA 3PR1A 2J7PD 2ZJBA 4JBWA 1Z0KA 1ZUIA 1UKYA 4RZ3A 1IN7A 3GLHA 1JQJC 1XMVA 3FGNA 2H16A 1X3SA 3VU9B 2A9KA 4LV6A 2R6AA 1SVKA 1KI7A 2ZI5A 1W0JA 2FH5B 5TDHA 4AC9A 5FTMA 1T3LA 2V1XA 2NO1A 2ZE6A 3HU2A 2GNOA 5B57C 4NPHA 1XD2A 4ABYA 2J0UB 4JKYA 3ASZA 5CYPA 2O0JA 4FCWA 1US8A 3ZS8A 1P7CA 2IS1A 1XX6A 3SDZA 4QG7A 2EYUA 4MH0R 2QQ0A 3EZ2A 4RCZA 4UNNA 2JGNA 3RAPR 3RRMA 5KDDA 4CT5A 3B1YA 3BBPA 1R5NA 2JJ8A 2GDJA 3PXGA 4P4TA 5DH9A 3VR3A 4M1TA 1JR6A 3SZRA 4OQFA 2A78A 2LWIA 4A8JA 1GRNA 1XMSA 1Z0JA 4ON9A 2A5YB 4XJXA 2VL7A 1FNNA 4KVGA 1KMHA 5HCIA 4NBSA 1D6JA 2AKYA 1E2EA 5HTKA 1C4OA 3N70A 1NN5A 3C5HA 4MRPA 2WSSD 4XWAA 4YONB 5FOVA 5JEDA 4DB4A 3RS5A 2AD1A 4ZDIA 4IEIA 5DI3A 1LVGA 3C7KA 2AFIE 4NCKA 5TVKA 4DLSA 2GJAA 3IHWA 4URYR 2HXYA 3BWDD 5DO9A 4BPBA 2C5LA 3UWOA 1IHUA 2QEQA 2A5GA 5G3ZA 5JCZA 2H7VA 2OEPA 4PR0A 4AYXA 4HLUA 1Q57A 3H1TA 1PUIA 3CX6A 3DOFA 4M9ZA 1AZTA 2J0SA 2JDID 2Z5FA 3FHTA 4QC2A 2CNWD 1XZQA 3QSYA 2PJRA 1K5DA 3Q3JB 4MYCA 3WXMA 1N0VC 1E2GA 5JWOA 4Q7JB 1OFHA 4S2EA 1VCNA 4PPFA 4Q47A 2CHVA 3F5FA 621PA 2QT0A 2NO7A 2ZI9A 3MWJA 4TMVA 2XB2A 2RGXA 3DM9B 4EPXA 5C2JB 1NP6A 4IOJA 1N6IA 1DO2A 1KI2A 1S1CA 2LKCA 4D81A 3BB1A 3J81k 3NBXX 5FTKA 1WXQA 5KNBA 2D3WA 3K0FA 5DYIA 1N25A 3KB2A 4Q4AB 3QPWA 4OJQA 2P0EA 1NIPA 5EE0A 1SVMA 3P26A 3WBKA 5L3QA 3G5UA 5AUOB 3UK6A 1RKBA 3PV0A 3NEJA 2R6CA 4CT4B 5H1YA 4LJ6A 4NYIR 2NPIA 4W5WA 2IYRA 3DL0A 5FPSA 1XPRA 1T6NA 5AJVB 5LDDC 2QI9C 3I62A 1IN6A 2WICA 5BN4A 2YINC 4FMCF 4TTQA 2OO7A 4L5BA 2DBYA 4JKIA 3EC1A 5G53C 4EPVA 1EK0A 3KXKA 4Q1DA 3MJHA 4NH0A 3D3QA 1KDTA 1LW7A 4NU0A 3HP1A 4KXFB 3TRFA 5FL3A 3BAFA 3KJEA 2OAP1 1IY2A 2G6BA 2RKOA 4LOAA 3QBVA 3HPQA 4GBMA 1XXHB 2OZEA 3BK7A 3PG5A 1QHXA 1P2UA 1G291 2MMCA 2MSDB 3CX8A 3EC2A 5DLQC 1F2TA 2HJVA 3ZZUA 1E0SA 4C30A 1JPJA 4AYWA 2ZITA 4AKHA 3THXA 4ARZB 1W47A 2A2ZA 3EPKA 4PC1A 3KQNA 2VHJA 3L0SA 2VEDA 1NBME 2ZAOA 1Q1BA 3B8HA 4PSKA 4GP6A 1KK1A 2IWRA 2IYQA 1G4AE 1NLFA 1KJWA 2Y8EA 1E96A 1R2QA 1V43A 2ZROA 1S96A 2FF7A 3T5GA 3BH0A 1FNMA 4M8NE 3EX7C 3VX3A 5JHHB 4IHQA 2J7KA 2B92A 5E3HA 1ZIPA 4HZIA 3U44B 3MLEA 2OM2A 2ZRDA 4JVSB 4C0BA 5JSZA 2ANCA 2KBFA 2IK8A 1GKUB 4BLPA 3UG7A 2ZJ2A 1PZNA 1RPZA 4H9GA 2PL3A 4EQ6B 1SVWA 3K9HA 2ZETA 4Q9IA 3PFIA 5EP3A 4MUBA 4CEIA 3MD0A 1G7SA 1TMKA 1ZYUA 3MRSA 3RC3A 4QGFA 1RRGA 3OEHD 4Q4JA 2ZVPX 4PC7A 4BZXA 1YRAA 2GRJA 2ZRHA 5FOXA 1K5GA 3LDAA 3IDQA 2HUPA 2QL6A 2ZYTX 3AP1A 2BC9A 2XNDA 4FIDA 5AJWA 2OV2A 3R9WA 3W9YA 4O25A 2XB4A 3MSXA 1F2UB 4PSVA 4KBFA 3K8YA 4QHTA 4DIEA 3BOSA 4EPRA 1CXZA 4V02A 3R7WB 1N6PA 5FBWB 1XDBA 2GJ9A 1A5TA 3TSZA 3WP1B 3IHLA 3WBJA 2W2TA 1XTJA 2VQSA 3UWKA 4M1YA 1UJ2A 1OH6A 4HDQB 4YLGA 1MO3A 4DB2A 5F9HA 2WJJA 4NE2A 2QBYA 2G77B 3TAUA 1NLZA 3U3MA 3VHLB 1KK0A 2JLWA 5FR1A 1I4DD 5HCNA 5H8WA 4CIDA 4DCUA 4DHEA 2R2AA 4WAUA 1E69A 3SJAA 3VAAA 2GXSA 1FFHA 4IEEA 3A6PC 3ZD6A 2FGJA 4XWKA 1GNRA 3LA6A 4KLZA 4CEHB 2BV3A 2RGAA 3NTUA 4LPKA 4RD6A 2D74A 3LXXA 2ORVA 3QKSB 1H65A 1MH1A 5D3MB 2QQEA 4IOMA 1XEFA 1E1RA 5FPTA 4NYJQ 3H84A 2W58A 3TGPA 4C0QC 1MO6A 1QHHB 5AJYA 1HA3A 1HE8B 5B64A 1KNQA 2ZIAA 4PZLA 4TMKA 3L82B 1IXSB 2OBLA 4M1SA 2F43A 3QY0A 1Z3IX 4AI6A 1Z08A 3C5CA 2ZUBA 5AUPB 1YR8A 2Q9BA 5CK5A 1V5WA 2GILA 4DT1A 1J70A 3K09C 2VHUA 2YKGA 3TVDA 4HAWA 4Q7LA 5KSYA 1OT3A 3AP3A 3EARA 4V0LA 1PJRA 2WIAA 1AN0A 2ZAMA 4ZV4A 4TL7A 2WWFA 1W7AA 2DWQA 3BFKA 3EA5A 1CBUA 2F9LA 1PLLA 2QSYA 3CNLA 2OCAA 3GFPA 1X8KA 2ZXUA 3AF4A 2IL1A 3AUXA 4FCVA 4MKGA 1FZQA 3CNOA 3AF1A 2HF8A 2BM1A 1YQTA 1NY6A 2ZUCA 4G3XA 3FDIA 3PQCA 2ODNA 2QROA 4Q7KA 1OPXA 3EIHA 2AWNA 4HB4A 3RWOA 2J1LA 3U7GA 4LHYA 1X1RA 1AGPA 3L0IB 4NP6A 1U0LA 3SNHA 3B1XA 3B78A 2F1JA 1Z0IA 3VFDA 1VYUA 1XD8A 1NVXQ 3E1SA 4PTLA 3WRYC 4D26A 1LV7A 2CCKA 4Q1AA 3AGQA 2HCJB 3SJCA 4IXMA 5CDFE 4MGKR 5H68A 1UDXA 1TU3A 3P27A 4BEBA 1OB2A 1K8RA 1EXMA 4GRAA 2XTNA 2GEUA 4XD7D 1P5ZB 1GL9B 2WSMA 4OQLA 1KYIA 5FOSA 5GVSA 1GRRA 1DAFA 3UMRA 2YVUA 2AN9A 4LBZA 3LO5A 4YXWA 1YZGA 4DDUA 2ZJOA 4BFYA 4CEJA 3SFZA 3U7EB 2QP9X 4MA4A 4R2HA 4B6EA 2C9OA 1G41A 5JEEA 5E7JA 4OQMA 3O8RA 1P61B 5CM9C 1JJ7A 2IYSA 5EE9A 5EXPA 2JJ1D 2R6DA 3IQWA 1VYVA 2REOA 3P4XA 3OEEA 2GCOB 4URWR 1Z8FA 1SVLA 1ZIOA 1E0JA 3K0CA 4I99A 3T1QA 2GXQA 1N5IA 1SULA 2VO1A 3AVXA 4AIIA 2ONJA 2OBMA 1Z22A 2O8EA 1RYHA 4D25A 2ECKA 5FBLB 1G4UR 2HLDD 2QTVB 4KFRA 3REGA 3X2SA 3HR7A 3ZVRA 4G0NA 5KYKA 1RRPA 5KO2A 2VLIA 3SYNA 3W90A 3GEIA 2IUTA 2BIFA 2J45A 2BMJA 4NONA 3SE0A 2QORA 2H18A 2PLFA 1R10A 3WHKA 1F5NA 1LS6A 3TBKA 1DOAA 1PUJA 1Z5ZA 3ZS9A 1O87A 3PEVA 4B34A 1OF1A 4LPSA 4D2IA 2ANBA 3FHCB 1ZCBA 4QHSA 1E6CA 4D6PA 5L8VA 4OQXA 4XSHA 5E4FA 2F1IA 3AQ4A 4IDQA 2FPLA 3U7FB 2AKAB 3U6KA 3SBDA 1BYUA 1F6BA 2QP4A 1CS4C 4KAXA 4BUJA 5JS7A 2O8FB 4R9UC 1SKYE 2VHTA 3RS0A 5TV2A 3QPVA 5BWMA 3TKLA 3PEYA 5HPYB 3FMFA 4DXAA 4X8HA 4PC6A 1XD9A 3IUYA 1AJEA 1B0UA 5HKKD 4RZ2A 5KSZA 1WA5A 1RFLA 2GJKA 5G40A 3ZVLA 4D82A 3HPRA 2CNWA 2CEAA 2OESA 2BEJA 1N6RA 5G41A 4F7WA 5JECA 1JECA 1DAEA 4ZDWA 5CITA 2WKQA 2R62A 3SS8A 3AF2A 1XJCA 1AS0A 4RSGA 4A0GA 4OK6A 5C4GB 3FKQA 3RDPA 4GMDA 2GTPA 3LAWA 4YMTA 4K46A 2Z4SA 1R0ZA 4M9SA 4ZPXA 4ESHA 3LX5A 3LV8A 5AUQA 3G82C 3I92A 2DFNA 3P4YA 4FMDF 4LY6A 3QE0A 1G16A 1LY1A 2FOLA 3O47A 4NYJR 1II8B 1FTNA 1G21E 1KO1A 2H17A 4IRUB 4LYAA 5A0FA 1ZNXA 1UBCA 1JR3E 4HLDA 1XZPA 3CB4A 4TMWA 3EXAA 4Q7MB 3G0HA 3QF7A 2DPXA 2XX3A 2GBLA 1OKKD 3C41J 121PA 3A1TA 1E2DA 1IONA 1Z0AA 3GFTA 4LCBA 1R5BA 1U0HC 4DLXA 4FWIB 4A9AA 4Q4LA 4D4LA 3R9XA 2FU5C 2GAOA 3A8TA 4HDCA 4RD0A 2LKDA 3TSWA 4P4UA 3LLUA 3MJRA 4WXPA 3OF5A 1T5IA 3ND8A 1CR0A 2G88A 3E70C 2GWHA 4LGMA 4GOXA 1KDPA 5G3YA 3C4JA 4OBEA 4B33A 5E7IA 3KQUA 1RJ9B 3KFXA 2WJGA 1E9SA 4RY2A 3KJIA 3QG5A 4A6PA 3THWB 1KKLA 3IO5A 2J41A 1N0UA 3U3JA 4B3FX 2GVZC 3GJ4A 1OYWA 4DCVA 4M22A 5DNYB 2ZRJA 2AX4A 4GT1A 1RZ3A 2QUZA 2W6ID 1AK2A 1VIAA 3NKVA 4D0GA 2TMKA 5KDLA 1MV5A 1N5LA 1NJFA 2FDCA 3GLGB 3GQBA 2OT3B 2D2FA 1JR3A 2XSZA 2CCJA 4HSEA 1H8HA 3WMFA 1GG2A 3QEOA 4M9XA 1IM2A 1QG4A 1G7CA 2ATXA 2ZRCA 5LBIA 3DPUA 2IC5A 1SXJE 3OAAA 4Q1CA 5F9FA 1YR6A 2OXRA 2O8DB 1XEXB 3QI2A 4KJZA 4L16A 4NYMQ 2RGNC 3ETLA 4DZZA 1TQ2A 1Z07A 4GSYA 3U3RA 1ZM7A 3A4NA 5TB5A 1XMJA 1U8ZA 3FOZA 4ESVA 4JLKA 4KYIB 3LW8A 2NGRA 1JBKA 4C2TA 1NF3A 3I8SA 4DSUA 1TQDA 3CR7A 4HAYA 5CJ2A 3GLIE 1DS6A 4EPYA 4C7OB 5EXXA 3BIFA 1H8EA 4ZIRA 2D2EA 3PUYA 3X1WA 4WOPA 4P3YA 3CF6R 2EQBA 3MAAC 5EXSA 4BFZA 1Q0UA 5LPNA 1E2QA 1JXMA 1IBRA 4Z1MD 2ZU0C 2WJYA 3GMTA 1KO8A 3LVQE 3FKSD 1LTQA 1G6OA 1M2OB 4P31A 4ERNA 1ZRHA 2IA5A 1J7KA 2E9SA 3FHOA 5DHAA 3K0SA 1AA9A 2RGEA 2UZIR 3RS3A 2BMEA 4Z51A 4AURA 1E2LA 4Z54A 2FMXA 2VTKA 5EP2A 3ZJYA 1SXJA 1G64A 3TR0A 4CW7A 1NJGA 3CW2A 4B2PA 2OLKA 4B2IA 4QBHA 1DVRA 1JALA 2ZRNA 3HJNA 3TQFA 1US8B 3W6PA 1KAGA 1E1QD 1SQ5A 3I73A 3FMIA 3UIEA 5C18A 3OIYA 3WNBA 1KIMA 3LBNA 4RD2A 3SEAA 5KPDA 3BB4A 3D8BA 1G7TA 3MUFA 4BRUA 2PZGA 4RFSA 3EZ7A 3EPLA 4Q4HB 4YMSA 3Q5EA 4NCJA 3U5ZB 3JZAA 1W4CA 4AK9A 1P9RA 2F3TA 5FL7D 4JYBA 1QDEA 1X6VA 2ZU6A 3DMNA 5KNCA 3CIOA 1M7HA 3PENA 2GZHA 1X8JA 2RHDA 1GUAA 3EIEA 1ETUA 2ZJ5A 1CU1A 3ZQ6A 2HYIC 3CM0A 3CZPA 3T06B 1S4QA 2J46A 4NCHA 2A7QA 2OAQ1 4GOJA 4LX0A 5AJXA 5J47A 2R8RA 4EFMA 4EPWA 4QGAA 3NH6A 1G3IA 1I4LD 4AG5A 4AKGA 1R0XA 721PA 2E1RA 1NL3A 4OJKA 5E7MA 3SHWA 5HZKA 3PUZA 1VHLA 3MG9A 4C0AC 2JA1A 4GI7A 5FUVA 2N1BA 3EPJA 4KHZA 1UM8A 4V0NA 1A2BA 2V4ZA 3D31A 3LQRA 4TSFD 2VP0A 3TUIC 3GLFE 3GCGA 3HU3A 2X8AA 1OIWA 2ZRIA 4PHTA 4DDVA 2HCBA 1KI8A 2C03A 1P3JA 1LF0A 3W3ZB 3A4LA 5FUWA 4IVPA 3A1SA 2KE5A 1E9BA 2IEYA 4TTPA 3FFBA 4ZKDA 5M04A 3ZLJA 1P2VA 4HB3A 4EKDA 2ONKA 2WPDD 1XJ0A 5BN5A 2V7QA 4N3NA 1WF3A 5SZIA 2GA8A 2IF2A 1YZQA 2QG6A 1XCGB 4DJTA 2GCNA 5IT5A 3EZ9A 1L4YA 3TVTA 4B6FA 5KTYA 3CBQA 5C46F 1KSGA 2W0SA 5L3QB 3OIWA 3AV0B 3ADBA 4EDHA 2NOAA 4PC3A 3BORA 3TK1A 5FH9A 2WWHA 2C98A 3QF4B 4EFLA 4QNMA 1JPNA 3PUWA 1Z2CA 4Q9LA 1KY3A 3EIQA 4GPTA 2C95A 3ADCA 2P5TB 2G9NA 1KOFA 2NTYC 2AD5A 4FCTA 1CJMA 1LFDB 1Q21A 2IYXA 5ANRB 1DG3A 2J5XA 4JBXA 3TW4A 5L3SB 3GLFA 1G1MA 3CRQA 3NC0C 3ZIAA 4EIWA 2ZRKA 4DEXA 4PAMA 3MGCA 2JLRA 1DO0A 3OFND 5KPJA 2QPAA 2WWXA 4JMPA 5AJZA 4C0JA 1TTTA 1X86B 4NYMR 3RHFA 3VU9A 1GZSA 2PZFA 1OJLA 2FFBA 2YYZA 4LHVA 5BW8A 4LYHA 1CIPA 2RGGA 4JLOA 3NDBB 3AF3A 3OE7A 3L8YA 4WW0A 2J0UA 2QENA 4CGZA 1UPTA 3TIFA 3IPXA 5CLLA 2H8KA 5FOWA 4A2WA 2OILA 2X2EA 4ZCIA 3U3OA 3ZDQA 4NCIA 3CPHA 1OV4A 2IT1A 1XP8A 2GJSA 2QM8A 3GEEA 2FA9A 4I4LA 3T34A 3PITA 1TQ6A 2R6FA 3SJZA 4D4JA 4LHZA 1VCMA 4DUGA 2GEDA 3K9NA 2N46A 4NL4H 3I32A 2D62A 2WVJA 4HB0A 1G17A 2V1UA 2KJQA 3DEFA 3ADDA 3F3YA 2B7CA 4LJ9A 2ZRPA 4R7ZA 3H86A 4KLNA 3B1VA 2KBEA 3SYKA 1VYTA 5KDOA 4A2QA 4M4SA 3LQQA 4JT2A 5F2EA 2WWYA 1OHHA 1NVVR 4X8MA 2JLXA 3PJRA 3VTKA 5A5GA 2GF0A 3DZDA 3U7HB 2NPFA 3AVWA 4US2R 4S35A 1AM4D 3TR5A 2HT1A 3HR8A 1BH2A 3SQWA 3R8FA 2WV9A 5LB2A 2E87A 3BXZA 4HUQB 1DAHA 4IFEA 3MWKA 4NCNA 1IAQA 4LJAA 1G8PA 4XIGS 3CF2A 3N2EA 2YC2C 3ADKA 3O8BA 1XJQA 2R6GA 4Q4JB 5EQTA 1F60A 2AK2A 2FSHA 1OH5A 1Q3HA 1VPLA 1TF7A 3I1FA 2XOKD 3TAHA 3K9LA 3MWLA 1OIXA 2GJ8A 2EFEB 2FEOA 1T0JB 3CRW1 3RS4A 4E22A 4IFBA 1TUEA 1P9WA 1ZINA 2F7SA 3CONA 4US1R 2IXFA 4OHZA 3OESA 2ZTSA 1FX0B 2CXXA 2QMHA 1W0KD 1UKZA 1SZPA 3LX8A 4JVNA 2IX3A 1G18A 1UADA 1PVOA 2YNMA 2QE7A 1KAOA 4HAUA 5IF9A 5DHFA 4F4JA 5KUTA 3QJYA 4BFXA 1XMIA 521PA 1E2FA 1KK3A 2D7CA 5FBVB 5K8IA 1XXHE 3E2IA 3T1VA 1ZM9A 1R8SA 3K09A 1WP9A 3V9PA 4JVMA 1J2JA 3CWZA 4BLQA 5C1BA 3NBZC 4BLTA 3NEYA 1MRNA 2A3RA 5FI0B 3KKPA 2VP2A 3ZZ0A 1HYQA 3K0AB 1S8FA 4DLUA 1MOZA 4XVRA 3S1AB 3ONWA 1E2KA 4D4KA 4AY2A 1E9AA 1PLJA 4ZCLA 1ANKA 1GP2A 4IDHA 4Q9HA 2PJZA 4P0TA 1II0A 3QUSA 2BJWA 2XTZA 1GVNB 4KU4A 1QBKC 2G1KA 3AP2A 3DMDA 4V0OA 2OUKA 5FBRB 4DSNA 2DWOA 2YWGA 1A1VA 2CVFA 5IK2D 4Z8YA 1ZD9A 1HUQA 4RKEA 1G9XA 4QOSA 5J4YA 5KHOC 3LLMA 4AYTA 1KI6B 2YWFA 3QXXA 3V4RA 4Q1BA 1J90A 3BGWA 1Z47A 2NIPA 1FMLA 4JLMA 2XGJA 2Q9AA 2NMVA 4HB2A 4ZI2A 4TL8A 2ZI3A 4TTRA 1KDOA 3AKYA 1AIPA 3QVUA 4JZKA 4L8GA 1AQUA 4U00A 1QHSA 4BFSA 1XXHA 2HDNB 421PA 1KO4A 2GF9A 3ASYA 3PUVA 1GWNA 4A0HA 1TF2A 4H1UA 2WAXA 1Z0FA 2IBMA 3OIUA 5DSZA 2P67A 3SI7A 2JIZA 3TH5A 2F1RA 1A4RA 4Q66C 4ARZA 2XAUA 1RC8A 5EE3A 5TARA 3A58B 2DR3A 5J4VA 2XJ4A 1RYFA 1M34E 1NRJB 1ODFA 1Z6GA 3BS4A 3JZMA 2FV8A 1MO5A 2Z0MA 2CLCX 2V55B 3JVVA 2I4IA 4RD4A 2Z6VA 5B58C 1VTKA 4V0KA 1XCMA 1ZM4A 5TXGA 2IS6A 4NZYA 4MKHA 1S2MA 3FMPB 4KSCA 3KDSE 1FUUA 2W6JA 2EFDB 2VP4A 4I1SA 4Q5IA 2VHCA 5FPHA 4BEJA 3QKRB 1OB5A 5EUMA 2LCFA 4QJ4A 1UBGA 4WIAA 3AKEA 1YHNA 1CJTC 3U44A 2WJIA 5FI1B 4MGYR 5JBQA 1L8QA 4MRSA 2W0MA 3Q7QA 3L0PA 4TLDA 2OXCA 4BFVA 3HU1A 3LH5A 5CB6A 4TN1A 3GD7A 4CYMA 4E07A 2VYFA 3C15C 4EQ6A 5DN6D 4EJSB 4FI3C 4QGHA 2C8VA 1E0KA 2C9YA 1IQPA 1KJYA 4TMZA 4MYHA 2P6RA 2ZPTX 2EWVA 5GJCA 3RRYA 4OHYA 2O8CA 2HJGA 4QBGB 2I1VB 4CEJB 5KSPA 1Z6XA 1N6HA 1T5LA 2ZSAA 5C4MA 1R0WA 1DE0A 3GPLA 2ZR7A 2PX0A 3IKJA 2YZ2A 5FTLA 2NO9A 2VF8A 4ASUA 3RVBA 1F2UA 2ZJ8A 3TUJC 4Q9KA 5CB8A 4B32A 4RZUA 3AVYA 1GIAA 2EU8A 1KTVA 2X19A 4TMXA 1G8FA 3R9IA 1CF4A 1S1MA 5DIFA 1XRJA 4F92B 4KITB 3IILA 1E4YA 4LBVA 2W2VA 4PHFA 2CCGA 2I1QA 4B35A 4LJYA 4M21A 2RGBA 2FGKA 4ZO4A 5HZHA 1IY1A 1E32A 3VNVA 3K9GA 4XH9B 4CZ2A 2CL6X 1U9IC 1HEIA 3NVAA 3TE6A 2ZUDA 1M6NA 2H92A 1XBTA 4ITRC 3IIMA 3LXRA 4ZI3A 4MDEA 2CMKA 1EX6A 4LZZA 5K8LA 1T3SA 2IYYA 4QGGA 3I72A 4Q48A 3WP0A 1T91A 2VSFA 2P3SA 3D7MA 3KXIA 1RVDA 1D9ZA 2REXB 4MGIR 3FE2A 4CVNA 4GMXA 1ZU4A 4HZUB 5J4KA 3SC3A 3EASA 2X77A 4IDNA 3SFVA 2J3EA 4KVAA 4M9QA 4NDZA 3BERA 5DGXA 2XNSA 3CLVA 1W48A 3QKSA 5D3MA 3B7GA 2VSXA 1EFCA 1ESMA 5EE1A 2PLRA 2ZSBA 3QG1A 4KSBA 2XXAB 2IXGA 2J7PA 2C96A 4JS0A 4M53A 4RFVA 1E9EA 2BBTA 1I4TD 5AK0A 4P4SB 4U7DA 3QKUA 2EFCB 4LJ4A 2PT7A 1BOFA 2IEZA 3LBHA 3TQCA 2B8WA 2IWHA 4I81A 1ZNWA 3THYB 4EAQA 3DOEA 3RC8A 2QMEA 3UMFA 1VG8A 1KDRA 1VG0B 2DY1A 4B3BA 2QTFA 1SGWA 1E3MA 4ILEA 1GILA 2GESA 4CRWB 2HF9A 3WNDA 3IGFA 1MR3F 3B82A 1OFIA 4W5HA 5AWFC 1ZM3A 4PPNA 1WE2A 2BDTA 2GHIA 2PEZA 3NC1C 3AVOA 3L0OA 1FP7A 4IKEA 3W34A 4MUAA 2AWOA 4QXAA 4GDFA 4I1OA 4E09A 1HE1C 3T1OA 3SU8A 4YQFA 2BBSA 2IUSA 3UATA 1N6KA 3KKQA 4B71A 2PEYA 4RKFA 1FL9A 2FX3A 2JLSA 4B48A 1TEVA 2ZSFA 1OFTA 2QZ4A 4B3GA 4LYFA 4C0KA 2WSSA 4DWJA 3BFXA 4K8OA 1ZC4A 1P60A 2GXAA 2EFGA 4OI1A 4BASA 1AQYA 1KSJA 4G5QA 1SKYB 2DYKA 2UZ3A 4QHYA 2ZRBA 4N0EA 1U81A 4B75A 4TMTA 3ICEA 1YJ5A 2FWRA 3IPYA 2FPMA 5EZ5A 2FZLA 2IS2A 2VRWA 2Q3MA 1TU4A 2RGNA 3CRVA 1L2TA 2RH5A 4PZYA 1Q1EA 4PX9A 4NTZA 1P6XA 2JDIA 1GNQA 3AEZA 4QNRA 1FOEB 2RB4A 3AF0A 2GCPA 1VHTA 2H57A 4XVQA 1Q1QA 4TLEA 4TQUS 1WBDA 3NDPA 2VP9A 3NXSA 4P33A 3T1TA 2ZANA 4UKDA 3KQLA 1Y3AA 3NG1A 2GCOA 5B30A 2CBZA 5FTNA 1YZTA 2BWJA 1XTKA 1M8PA 1GSIA 1E4VA 4IOKA 3PCRB 2FFHA 4QM6A 3GEHA 5JWHA 1N2CE 4QJ5A 2ZI6A 4G01B 1NMXA 4KYUA 1DBSA 1RIFA 1WCV1 4URUR 4DIDA 4M0LA 3QXSA 2ZYWX 5DYGA 4PZZA 4JBYA 3EW9A 2Q6TA 3L43A 2RGDA 2PBRA 4EJSC 2VPPA 3F0TA 2WJVA 2BMDA 5JRZA 5TMPA 2KB0A 2L0XA 4UJ3A 5EJEA 4YC7A 1TADA 4AKIA 3KTAB 2GZAA 4PQYA 1NSFA 3VQTA 2C9CA 4QBIA 5CJPA 2Z43A 4LC0A 4US0R 5DI9A 1E9CA 2V6IA 1KO7A 4TYYA 3M4YA 1DPFA 1YE8A 2VH5R 3TJZA 2YWEA 4B3CA 1VG9B 4C9BA 2G83A 2QMOA 3PUXA 1MABB 3KUCA 1NMZA 4W7SA 1IXRC 2X1VA 4YDHB 1NVUQ 4UNRA 3RABA 2ZRGA 4Z8XA 4N1AA 1ZD1A 4LUCA 3K0CC 1VMAA 2G1JA 1Q44A 2AR7A 2IYTA 3P20A 3CZQA 3FB4A 1ZJ6A 4UQOA 3K70B 4R98A 3C16C 4TZ0A 1E99A 3DKVA 3EZ6A 1IN8A 4JLPA 3M6AA 4GZMA 2WHXA 2WWWA 4IJMA 4IDOA 4TZ6A 4YMVA 1FPMA 3NH9A 2XNDD 2VP5A 3B5JA 2YOHA 4LBWA 2A30A 3HWSA 2ZI4A 3KQHA 1CKEA 3QQ5A 3VKWA 1MKYA 1X8LA 1NBMD 1NIJA 1W0KA 1SXJB 2OBNA 2J0QA 4XVUA 2OCYC 3SQXA 3AH8A 2EFHB 4OI2A 4ACBA 4GZLA 1NLYA 4NHOA 5GJVC 5BYKA 1KI9A 2GETA 2QY9A 1G5RA 3KJGA 3SR0A 3KKMA 2CJWB 4TL6A 2RCNA 4G5RA 4JYCA 1U2RA 1RE0A 1XWIA 2ZJYA 3KJHA 4U02A 3NHBA 4DLZA 1II8A 3P1JA 4RCYA 2DFLA 2IYUA 3D6TB 3VKGA 3GLIB 5FOTA 2BBWA 2IYZA 2ATVA 1OXUA 4MRVA 1AKEA 3UANA 3ZVMA 4EFNA 4QM7A 1HT2E 3B1ZA 2ERYA 2CHGA 1M1YE 3HYTA 2F55A 4WVFA 3TW8B 1QVRA 1NVWQ 4XSGA 2HV8A 4M1MA 5GVRA 1XB2A 2QAGB 4E03A 5JHGB 1I2DA 1JAHA 1B23P 1CEEA 2F9MA 3OEHA 3FWYA 4B74A 4YMWA 3U4QA 2QSZA 4JSTA 3VNUA 2O8BB 2QPTA 4BLOA 3WYFA 1E1RD 1Z28A 3I5XA 2D4HA 4I1UA 4MYTA 4DSOA 1VDZA 2BM0A 4JSYA 4DCNA 2WWGA 2ZRMA 1SVOA 4JLVA 1NVVQ 1W5SA 3GLHB 4JIMA 3T61A 3THOA 1BIFA 2WKRA 4AG6A 3QXCA 1BMFD 3NBYC 2WKPA 2XZLA 1G6HA 1EGAA 1UEIA 1DADA 1IN5A 3ZGXA 2GEVA 3WMGA 4D80A 3KL4A 1BO6A 1XD2B 4MKIA 1UBFA 1KI1A 2QT1A 5BN3A 2B6HA 2CHQA 4TYNA 3Q8XB 5BXQC 2ASEA 1YVDA 1CR2A 3GLGA 2UKDA 5UKDA 2F3RA 4TLAA 1J8MF 1Z0DA 1QHIA 2OHFA 1EFRD 1AS3A 1UKVY 1OLOA 3LW7A 4KODA 4A0RA 2AXNA 3WNCA 3Q85A 3SJBA 1KJZA 1NKTA 3VX4A 2V6JA 1XEXA 4QFMA 5BYJA 4A8JB 4AWXA 2P5SA 2O8DA 4JVLA 4G5GA 4JLNA 2XEXA 3U60B 1KMHB 4ZDKA 2NG1A 2OSBA 5CIQA 2XZOA 2DB3A 4BFUA 1CP2A 4PPQA 1A7JA 1E9FA 1PV4A 4LDJA 4PO9A 2MMGA 3KXLA 2OLJA 3B9QA 4BE7B 1U8YA 2ZR0A 1QRAA 4C7OA 5DI3B 3LNCA 3CUEF 2IYVA 5DN6A 3M1IA 1VECA 1EFHA 5P21A 4TYPA 2DWPA 2GKSA 1OXXK 1DAMA 1EX7A 1ZW6A 4QRHA 5IRCD 1S3SA 4J0QA 2BKEA 4YXWD 2K5UA 1NN0A 2VBCA 2X2FA 3DHWC 3HYRA 1IJEA 2AK3A 1G3QA 3H2YA 3RLFA 1TEXA 2PMKA 4B2LA 2D06A 1N6LA 2ZS8A 2ZE5A 3OEED 4BWYA 1HT1E 3EZFA 8OHMA 1KZGB 4QBFA 1IOZA 4TLBA 2FN4A 3CH4B 1EWRA 4URZR 5CK4A 1BYIA 2WWIA 2EW1A 1E2HA 1COWD 1HQYE 4JL6A 3VR2A 3VR6A 4RJLA 2JCSA 4HI0E 2V3CC 2J9RA 2BKUA 1KI4A 4DLYA 5IHPA 1KI3A 1U98A 3K0FB 4GOKA 4HAXA 2H5EA 2WJHA 3ZH9B 1Z2AA 3RS2A 4EPTA 1E9RA 2QMUA 4UNSA 4MRNA 3VHXA 2JAQA 1P2SA 2QP3A 3HDTA 2A5JA 4OL0A 5E95A 3K70C 4GNKA 1E2IA 4PFSA 1MRSA 1W2GA 4Q4HA 4MYUA 1EESA 1JEEA 2IXEA 4B43A 4KCGA 1ZU5A 1RRFA 3AVQA 3QENA 4L4UA 4XD7A 5FPYA 3NHAA 5FFMA 2A5DA 2CLSA 3AVPA 2JLZA 3KB1A 1GKIA 5BQ5A 1NNEA 3KX2A 2N42A 4DRZA 4TT3D 3FMOB 1FQJA 1OXTA 1II9A 1IJFA 1SXJC 2ZS7A 2P6NA 3PVSA 3DDCA 2JJ1A 2ZREA 1T3HA 1XPOA 1VCOA 4WBSA 4NMMA 1DAIA 1S3GA 2JLVA 4D0NA 1NI3A 4KFUA 3CX7A 1T8UA 1P62B 1T9HA 3WYAA 2XZPA 3X1ZA 3ZVNA 4JJKA 1WBBA 3BRWD 2FEMA 4UNQA 3B85A 4PHHA 1Z06A 2GK6A 1P73A 2VIIA 5DISB 1W4RA 1G3UA 1FTSA 2J59A 4LSGA 1LB1B 2HLDA 3GJ3A 4YDSA 3WYGA 1F2TB 5K8UA 1F48A 1QZXA 4GP7A 4F38A 3THXB 4W5JA 4R71A 2CLDX 2BJVA 821PA 4BZQA 4FN5A 1M74A 4A82A 1E9DA 1XTRA 3EWAA 1BS1A 5K8TA 1DELA 4POAA 2QAGC 1DAGA 2CVHA 3DKPA 1XF9A 3DZ8A 1XFAA 2WAYA 4MGZR 2FE4A 4XTRA 2FPKA 1OYYA 5JZVA 1DAKA 5SZKB 1KSHA 4BLRA 1QVAA 1W46A 4O3MA 4OKSA 2FJUA 3AVTA 2J0VA 5JSZB 4QJ3A 4FMCB 3LVRE 3LY5A 1XCPA 3IIJA 4TWZA 4A4DA 4LWZA 3PEWA 3UXMA 1Z6AA 3KZ1E 4Q02A 2C99A 4TQ9A 1TX4B 2OG2A 1GAJA 3QF4A 4G5OA 4O0MA 4CEIB 4DBLC 1ZCAA 1T4GA 1G7RA 5HKKA 4C4PA 4LV5B 4WZAE 1E79D 3A36A 1WDTA 4PAQA 1TQ4A 1YRBA 1U90A 1ZAKA 1OFUX 3AB3A 1W36B 5L3SA 4HLQB 2C2HA 4OK3A 1Q12A 4MITA 3X1XA 4L9SA 2ZEJA 1N5KA 1U94A 4A8JC 3GP8A 3I8XA 4LI0A 4M1OA 4M1KA 5EE5B 4MDFA 4NKRA 1UKEA 1EFUA 3IBGA 3UPUA 2QGNA 1YZUA 3CWQA 4C2UA 1W5TA 4C0HA 2QBYB 5GJBA 5JRJA 2ZYVX 1JR3D 1U0JA 2IW3A 2XSZD 3L8ZA 2ZRFA 3EG5A 1T0HB 4Q4AA 1H8HD 5KSOA 2ORIA 2C77A 4IW3B 4UNPA 1OKKA 2DFKB 3OAAD 1GM5A 3B13B 5KOYA 1GNPA 4HLUC 3NBFA 1TNDA 1AGRA 1R6BX 2KWIA 1NKSA 2AXPA 2ZE7A 5JJIA 1AS2A 1FMJA 5JLJA 4PXAA 5L3RA 5KNDA 1AZSC 3B6EA 3CNNA 1VCIA 4OHVA 3RRNA 2G0TA 5EP4A 2EVWX 5AUNB 5EZ6B 2JLUA 5F3WB 2FFAA 3IEUA 4U5XA 3QKTA 2CK3D 4LC1A 4OHXA 4RD1A 3TSOA 2GVDC 2ODEA 5J4LA 1GL6A 3A37A 5JCPA 4DKXA 1A2KC 1G3MA 1UFQA 1YZLA 1MT0A 1H8ED 2WBLC 4LV8B 3LD9A 1EG7A 1U9IA 2ZYUX 3QBTA 4GL2A 4W9MC 2XTMA 3QIAA 4F4CA 3KKOA 2ZSEA 3P32A 1P72A 2F43B 4HUQA 2FFQA 3K70D 4O2RA 2O8CB 2HT6A 3ICQB 4DT1B 3SOPA 2ZRLA 2B8TA 4JLJA 1YZNA 1VKJA 1W2HA 1OIVA 1ZBDA 3QNUA 4AKEA 4BGDA 2W6IA 1LNZA 1E98A
chains in the Genus database with same CATH superfamily
1IY0A 1LS1A 1SN7A 1MQSA 5KVCA 4KBYA 4YRAA 1ODLA 3QEJA 1MAHA 1GU7A 3OX4A 3SBOA 4JL5A 4E88A 2W98A 5B55A 2C00A 2OOSA 3REQA 1FX0A 1YK1A 3F8TA 1A9TA 4MRMB 3IQHX 3QBDA 1I2AA 2YWHA 4I6JA 4OAQA 1YZKA 4UZEA 4EY5A 2PLWA 5DHSA 4DLTA 3O8DA 4L9RA 4TX1A 2P5YA 2DMRA 2R8ZA 4A92A 1RLTA 1EUCB 1TCAA 3K2EA 3TN7A 3H1FA 4CLXA 1UBJS 3BULA 4TYWA 1M2FA 4IQ8A 2WHPB 1X1SA 2VYND 4WBXC 5HE9A 4K6OA 1MP0A 4ZGBA 4FW9A 1K92A 2IEDA 2H7XA 2JJ2D 1PS9A 3O82A 2I8LA 4OXIA 3NHLA 4RS3A 5A9RA 3FLMA 4HX9A 4EI7A 2QJRA 1CY8A 1NPYA 1SHZA 3F4LA 4YMHA 2WUWE 3HEMA 4GEGA 3KYBA 5DM4A 3VOTA 1KGDA 4FFNA 3ZW7A 4AF7A 5JT1A 1T8SA 3HNRA 3JQ8A 3OQIB 2HIMA 3O9ZA 2QTHA 3S1AA 4A2PA 4BLTA 4L5IA 1UOEA 3GA7A 3F96A 4RDIA 4R69A 2IXTA 4TYMA 2HJ9A 3T9BA 2PH5A 4DUGD 3CPEA 3K20A 3CZ9A 3JVUA 3N86A 2I2CA 2IUUA 4GKAA 1EBBA 4ETMA 1F8XA 1NFFA 4PGFA 3GFVA 4U2BA 5A6SB 4Z1MA 3GFRA 4S04A 1EUQA 2OE2A 1SCUA 1U8FO 4X20A 1ZSNA 3K1ZA 5ALKA 4LMAA 1X87A 3OTHA 2L18A 2D59A 1UDWA 2VDLB 4KPUB 5NULA 3I9NA 5IC4A 2BGIA 2XDQB 1LA2A 1VPWA 3F1LA 4WFQA 4B76A 1S0UA 4K9DA 2UAGA 5BMVB 2C8LA 1K97A 1QFXA 2PUTA 4QU9A 3TEJA 4AROA 4CKEB 4RVCA 1NFQA 5FI5A 4L72A 3MGKA 4IJUA 5CD9A 3U19A 3B2EA 1CVIA 2Z4RA 1UF9A 2O8EB 3CUKA 4UOQA 1WPGA 1U8AA 1XKQA 3MGGA 4QDUA 4WZBE 2IELA 1EP9A 1YR7A 1QGZA 4FOOA 5JJLA 5EKUA 4CETA 3RCBA 4QUKA 4G8JA 3L7MA 2H85A 4OP2A 4YMUA 1CTQA 4HATA 2YJTD 2DCUA 1A2OA 2C5GA 3CRMA 3T0IA 1RI4A 1K2VN 2XKBA 4K81B 4X66B 1FX1A 1IQRA 1BQ4A 3MWGA 4J7XA 4JLWA 5JMPA 3ZDZB 3P5BA 4ZYUA 1JQLB 3BFVA 2FG5A 4IIGA 2CUNA 3RKSA 1MHPA 1CWUA 4CL2A 1NXWA 2CF5A 3BH7A 1IUOA 1YS1X 1AG9A 1VG1A 3VGJA 4UXJA 4HXFB 4U7GA 4A10A 5DX1A 3OY2A 5FL7A 3QKRA 3UJNA 2C2OA 1SVUA 2WUFA 5JCOA 4C3ZA 3ONDA 3QLUA 2R8PA 4F93B 3OOHA 3D5QA 3JZFA 1A8HA 5B3JA 4XM0A 3L93A 4KX5A 1T5OA 4GS5A 3M6WA 5E7QA 8ABPA 3TUZC 3GFFA 3Q5DA 5ESXA 1BD3A 4JI3B 1TUBA 2W2MA 4HAZA 4RDCA 3FWHA 1FYWA 4LHXA 1UQTA 5JOQA 2P65A 1DZIA 1GL7A 2H9IA 3BGOS 2QTWB 3LO8A 4N5LA 4DMUB 3CF0A 5IM4A 1ZUWA 5A4MS 1YHZA 1E1MA 1PNOA 1JXOA 2IRWA 4EHLA 3KQKA 3CLKA 2PL9A 4UAJA 3STUA 1GZ6A 1P2FA 1WVMA 3KZCA 5I9MA 5TGTA 5AKZA 5KC9A 3JASA 4MS3A 2NAFA 1JEDA 2HPHA 2ZYGA 1EWVA 1L7VC 1L5QA 1VJRA 1JT9A 4JCOA 2GYYA 3RKUA 3I53A 3RTDA 1PK7A 4TUYF 1JI0A 1OWPA 3R3VA 2B1QA 1MV8A 4Q7QA 1DG1G 2J87A 3RVQA 3EEIA 4IV8A 3P0EA 3S1SA 1D8AA 1ONOA 1WU8A 3FVQA 4QTZA 4BO2A 4D3DA 3G8YA 4BO7A 2JNWA 2WG1A 1H9CA 1R9MA 1Z63A 2AQHA 4C03A 1WQ1R 3JX9A 1CUUA 3DTVA 1QR6A 2Z6UA 1C1YA 1YR9A 1NVFA 1VLHA 3E0XA 3CZ5A 1KZ6A 1QGOA 1X92A 3AKCA 1HE3A 2EZTA 4PO8A 3IVGA 2ZSIA 4UE2A 4BNWA 2OY0A 2QLMA 5ALXA 2WM9B 2Q5EA 3BE4A 3FFTA 3QJ5A 1T5BA 5PNTA 2RHJA 4P86A 2OYSA 5C7OO 4NENB 1PLKA 4WL0A 1E6KA 2OFWA 3JQGB 4BNLA 1NMEA 1KJ9A 3KYDB 1Z88A 2NXCA 4LXIA 4KXVA 2VJMA 4ZVNA 4ZOQI 1XLUA 2ZS9A 3I01A 4MV7A 5AKGA 4F91B 2YJ4A 1SA0A 2Q6IA 4RACA 4A5OA 4HUJA 5J5CA 1IDN1 1GR1A 1IQ0A 2W22A 2COKA 3OC6A 5CBKA 2ODBA 3KL2A 4YWJA 4UPDA 2XKKA 2FSFA 2QM0A 2CE2X 4KVFA 5TT0A 3ER8A 4I3HA 4Q19A 1E2PA 1H23A 3LBIA 2OGZA 4IDEA 1CR1A 1T8TA 4II7A 2WFZA 1HY3A 1NI4B 1IG3A 4MR9A 4TT3A 2YIDA 3W7BA 4BWFB 3MJTA 1L1FA 4RABA 1WTCA 2YC4C 2IHVA 1W44A 5L51A 4P4SA 1QG2A 4AO8A 1I01A 1ABEA 1NYQA 4PQRA 1Y9EA 1WUYA 3TNYA 2ZXFA 5AXBA 2GN0A 3QVGB 3ZG6A 1ZM2A 4L95C 1KQPA 2HYDA 3QEBZ 1GG5A 2KPOA 1Z0ZA 3OU7A 4K9PA 2HJRA 3CLUD 2VF2A 4PHGA 5IVIA 3C8ZA 3RSOA 4TL9A 3NU1A 4E5VA 1WRBA 5JFTA 2QYSA 1G21B 2HB6A 2HM7A 3GQBB 1MGPA 3OQPA 2JZOA 3EA0A 2G5PA 1WKCA 3I2YX 3HS3A 4HEJA 1NR7A 4L5YA 3IUQA 1VI2A 1CUSA 4RD3A 3I6YA 1WMBA 3UCXA 2QQ5A 5HX7A 1WTAA 3HVJA 1G3RA 3TTYA 1XC7A 3FJOA 3JR3A 2EATA 3SY8A 4AZ3A 1FW6A 1TLLA 4C4XA 2VYQA 3G8BA 3HNPA 4OI4A 3OLVA 3WA7A 4FGLA 4QUBA 4OHYA 2FZEA 4HUTA 4Z1OA 4HDOB 1ISJA 5ETJA 3N5CA 1YDWA 3A1WA 3N05A 3T15A 3G5TA 4MKFA 4PQFA 3CVUA 4TLLB 3EQ9A 3ZKAA 1B6GA 4HD8A 4Q03A 5AI9A 5ADVA 5F7ZA 5IDVA 4F5YA 4I1VA 3BJIC 3IO3A 5SZJA 5DPMA 4ZMSA 3RNLA 1U65A 1DBQA 3DFMA 3F6BX 1GGVA 4ZIRB 1TVMA 2BEKA 4C7JA 4FYYA 1RR6A 2VP3A 3L8GA 4RY8A 5LP6F 4MB2A 2C5BA 4BO8A 2HK9A 4NOJA 1JHPA 4UOEA 3UMCA 1T9ZA 2REBA 1FDIA 3IS3A 1TZCA 3A14A 1HZJA 1KEEB 5IYZB 1Q1NA 3QPUA 4R1TA 4DDTA 3MPOA 4MAFA 3D7SA 2RARA 3QLEA 2YOFA 1VIDA 5THQA 3WGNA 2XOKA 3QVVA 5DE3A 2CF6A 4L73A 5JIBA 1FSPA 3AB7A 3DEAA 4KYVA 2HQ1A 5ARDA 3U3XA 3GFOA 3PE6A 3QPAA 4WECA 3GDFA 1ZD8A 2FSIA 2XCOA 4J1TA 2I4TA 2VYVA 1F9EA 1JJVA 4XYMA 4EKEA 3H5AA 3AGPA 2HA0A 2WJAA 2P69A 1KYQA 1RQ2A 2FDRA 3DBHA 2IU6A 4KQKA 2HHLA 3LP8A 4Y2JA 5BW6B 4C4ZA 3M6UA 2YVAA 4F3NA 3T5BA 1YU6A 1HURA 2EBFX 4JJ4A 4HCJA 2G7MC 5FR2A 1PQ4A 2DPHA 2ZIWB 3SYLA 3D81A 1T15A 1XZKA 2E89A 2D1QA 2G06A 4M76B 1D2RA 3QUTA 4ZICA 5CA0B 4DNXA 3FFAA 1RPJA 4FOPA 2O2GA 1N0HA 5BY2A 3IB3A 4E1BA 1P2TA 4WCVA 4BN5A 3VTFA 3BRQA 3D5TA 2BOVA 3ECCA 5SYMA 4M1WA 3MQFA 2PS3A 1ZI8A 4I9HA 1TJ4A 2YVKA 3EXEB 4M36A 3T54A 1QZZA 4Y18A 5NLLA 1L7OA 2HMUA 4YQZA 2PZBA 3CZMA 4LZPA 1P0IA 1BVRA 1D2NA 1Z39A 4FT2A 4RFSB 4EW6A 3BKXA 4BQSA 1VFNA 5I45A 4DCSA 4KWIA 4QQKA 1T6ZA 3HGQA 4IVQA 3FZGA 1OW3B 1BW9B 5CIWA 2CL0X 1V96A 2C42A 3PEUA 1H2YA 4Q1FA 3U3KA 3T5AA 1ZD3A 3QE9Y 1P3Y1 3DVAA 2ADOA 1U2DA 5I9LA 3O1HB 2DU8A 1CRQA 1FPQA 1N9GA 3KU1A 3X2EA 2GX6A 3CVXA 1HQKA 2AL7A 1T43A 1T25A 3C3XA 3UOWA 1GN9A 4JLDA 4LNAA 4BNKA 4M1QA 4RS4A 5C7LO 4UBNA 1U2ZA 1ST3A 2QNRA 4QULA 3SKYA 3WBFA 3VKHA 5BRNA 3V7UA 4MVJH 4RENA 3IUPA 3ZZNA 4YN3A 2SKCA 2C9MA 1IIBA 2GEJA 2J6CA 5I4IA 4GF5A 3TG8A 4PM4A 3THWA 1R4AA 1JMKC 1AXGA 3WKAA 1XDDA 2V5VA 1KNXA 3IBYA 4KL8S 2VT7A 4MS4A 4IMRA 4P81A 4UTNA 4Q3DA 1VL5A 1WUJS 4YASA 3U7JA 2Z83A 4PR3A 1USKA 1SD1A 3P9YA 4KO4S 4LRTB 4IIEA 3I76A 1OH7A 1Y7PA 3O4GA 1RAIA 2CXRA 2HPAA 1K6EA 1RE1A 2A5FA 2XT6A 1TK9A 3BSFA 1ZJ4A 2JJYA 3T4PA 1KO5A 2OGUA 4OP1A 1XU4A 4ZO6A 5FQOA 3V2UA 1VCHA 4RF2A 1JZSA 5LZ4A 1S3IA 2GAAA 4L5JA 3JD1A 2ZSDA 2GBLC 4LI3X 1T6BY 1UBHS 2WB4A 3ZYCA 3W6OA 3ERCA 3UH1A 1D6SA 1Y1TA 4RV9A 3E9EA 5BR4A 4YJ3F 2AZXA 1GR0A 3VC7A 4L8LA 4WOJA 3PI6A 2BW0A 2FPIB 2ZPUA 3HYNA 4B47A 4DTIA 2CDCA 1SMKA 1FE8A 3QK7A 3IOBA 5BSKA 5HJEA 2HNKA 2WYHA 3VR0A 4Z9AA 2AHOA 4GX1A 3I61A 2YOGA 2OKGA 3K0EA 4AMGA 1GQFA 2PDAA 1OLUB 1D2MA 2HPZA 3LP6A 5BN5B 5KX5B 1O96A 4AJOA 5BWBA 4O33A 3IPRA 1E3DA 1XLVA 4IUDS 4CJXA 3DEIA 2CV2A 4X41A 3KDAA 2GBFA 4QFBA 1JB1A 3RVMA 3RS7A 4EECA 1H0RA 4ER0A 4OOEA 3H4MA 2MDTA 3ZBPA 4IYRA 2FMTA 4ZVSA 4ZD6A 4YJ2A 3U61B 5CYGA 3QEMA 2FPRA 3LWDA 4EI9A 3BC1A 4P0PB 2HFJA 3BH6A 1AUOA 3IOYA 5HW0A 4PCVA 3WB9A 1G0OA 3U2QA 3AUJB 3BD6A 4C0LA 4HLCA 1T1SA 4ADSG 2BM8A 1KHTA 1ZMXA 2OLEA 3FA2A 1SUEA 1Z83A 4Q1EA 3JD0A 1TA9A 4BFTA 2PRKA 1IHPA 1IOVA 1U3CA 2VF5X 3GFBA 3MTIA 5CVEA 4QL3A 1BE8A 3E61A 4HDSA 1W88B 3QOWA 3PR1A 2JVIA 1GTZA 2ZJBA 2VKQA 3ID6C 4RSRA 1LI7A 1NW9B 1Z0KA 2XIQA 4GL4A 1IN7A 4GM1A 3U1VA 1XMVA 4L4ZA 5HIIA 4EVIA 5IKEA 2H16A 3TTTA 1X3SA 1BWRA 3DOJA 1RM5A 2J3IA 3GR6A 3LKVA 2ISQA 4YPVA 2FUEA 1RKQA 4GBJA 1C8VB 2PUVA 4W1QA 2RDMA 4D3YA 3RYFA 5DGIA 1T4BA 4B3JA 4NPHA 3MZ0A 2GLXA 2FRDC 2J0UB 1SUDA 2V9ZA 3ZJ5A 4WKNA 4FCWA 1Z12A 2DUMA 2VQEB 2V98A 1S5PA 2IS1A 3TJRA 1XX6A 2H59A 4V39A 4RZQA 1KEWA 3KB6A 3KRTA 3QWBA 3RRMA 1IPEA 1H05A 1L4MA 3OWHA 2H1OA 3BBPA 2JJ8A 1LC3A 2CB0A 3LQKA 3CZ4A 5DH9A 3GRKA 4MUKA 3PPYA 3CLSC 4MB0A 1Z73A 3L6UA 3BMOA 2K2QB 1GRNA 2IV7A 1Z0JA 5REQA 1W9HA 4ON9A 4D46A 5D51S 2A5YB 2VL7A 4IL5A 5B6IA 1Z7EA 5HCIA 2IIPA 4KQHA 1D6JA 2D00A 4KV7A 2P9ZA 1L5GB 1DKRA 3B3QA 3MIZA 1PL0A 3N70A 3C5HA 4EB6B 2QN8A 1O9HA 2QR2A 3RS5A 2B2CA 2AD1A 4LQCA 4DYVA 1GTG1 1PEYA 1TO6A 2Y1GA 3C48A 4L27A 4NY1A 1AO3A 1Q6ZA 3BWDD 2HD4A 4BPBA 3GVXA 1ODSA 2AMLA 3M4NA 5C5CA 2QEQA 4MIKA 2A5GA 2FRVA 1KEPA 3DG9A 3C8DA 3SPXA 2OEPA 5DBEX 4AYXA 4HLUA 2GYWA 1IBSA 2V0NA 3OU2A 1EVQA 5ILQA 4RHUA 3KLNA 4AICA 4BQNA 2J0SA 1Z16A 4KC0A 3EEFA 3MTEA 16PKA 2DHEA 2X58A 5K0TA 2PJRA 2X5KO 1R4MA 4JQZA 1QTNA 3DE4X 3HB5X 4U0KA 5AJUA 1A9PA 1E2GA 4Y6QA 5ALPA 2HK6A 3HCCA 3KQTA 4Q47A 1CY6A 4J0KA 1RQLA 1KFEB 1WVIA 2CHVA 3U39A 5CNKA 4R84A 2PT9A 2YY7A 2NO7A 3VSAA 4AXBA 2Z6QA 5LDHA 1DBRA 4D97A 2FWBA 3DZHA 3V33A 4CFSA 3T8YA 3PHJA 3TB6A 1NP6A 1J09A 4S24A 1AY0A 2TYSB 2X15A 1YR1A 3PICA 4IOJA 1JFLA 2FN8A 1LPMA 5ES4B 2GHTA 4RHYA 3PXAA 3T3PB 4D81A 4F1KA 2V7EA 1W30A 2O7QA 3J81k 4E7OA 2WMYA 2G8NA 2FP4B 4L3WA 4LGCA 1RZVA 3MS7A 4ZZ0A 3C3PA 3RARA 2RCYA 2OV6A 4WKPA 2P0EA 1Q15A 3ELBA 5BSRA 2VHYA 2C3UA 3DE3X 4CDRA 1GNSA 3S7TA 3GU3A 1M6HA 3H5NA 3G5UA 4AO6A 1G9SA 2Q5CA 1W76A 1RKBA 3RS8A 4AJLA 3D6AA 4CT4B 3AF5A 4EG1A 2FQXA 4L28A 4NYIR 3P9IA 2NPIA 4ER3A 1AUVA 2IYRA 3E84A 1U6JA 1XPRA 3NZEA 4QOFA 2UYYA 1LSUA 4OBWA 3I62A 3FUWA 2QRPA 2LR0A 2WF9A 5L4NA 2NV2B 3EGDB 2GGSA 4TS1A 2QB5A 4H60A 4WK6A 2Q62A 3TE7A 2PWAA 2AG0A 2RGUA 4P58A 4U2CA 1J2RA 2FSVC 2YINC 3WZMA 4FMCF 4MLZA 4E30A 2CXUA 2B5OA 3UV7A 4DMKA 3B6JA 1C1DB 1CQIA 3RTAA 1WCWA 1EK0A 3PUIA 1R74A 1YXMA 1Z37A 4Q3LA 3F3MA 3SICE 1WEKA 3GB9A 1QTQA 2DPLA 1ZL0A 1N2OA 2I2DA 3LYLA 3TRFA 1YQGA 4UMVA 5FL3A 4BRSA 4N41A 3NP9A 1O0SA 2G6BA 4FHFA 4TKUB 4N5DA 1WW8A 1SZDA 3SF0A 4CM5A 2V7UA 3QBVA 4GBMA 3M3PA 1T4DA 1DFIA 2NNLD 3BK7A 4J9UE 3A05A 1EJBA 2B25A 3T5PA 2XYHA 3QY9A 5GIOE 3HM9A 5DSTA 2RH4A 3EFEA 4UCQA 1ZOSA 3ESZA 3ZZUA 4MQLA 4AYWA 3SLKA 5EXDA 4MWDA 4ARZB 2FPSA 5FWXB 3GDHA 3VSDA 1JZTA 5CU7A 3EPKA 3H2ZA 3H4VA 4B3IA 2HSGA 4ZCSA 5K4HA 1ZK2A 1DOHA 4JB2A 2BP7A 4TTSA 4U8GA 2G80A 3D3EA 4JELA 4HWGA 5EMNA 2IWRA 3WJ2A 4F3CA 1Z2PX 5KVSA 2XF2A 4NBKA 1G4AE 1NLFA 1KJWA 2X6QA 2Y8EA 1E96A 1EM8A 3PFFA 2HUNA 4LE0A 4AMBA 1B16A 4LVCA 3E05A 5HMLA 3CRNA 3V8EA 4CT0A 3TM5A 1UK9A 2J7KA 2TMGA 2CVZA 3PC2A 2LIVA 3QW2A 5JSZA 2F3UA 3PGXA 2C4VA 5FJIA 5KKNB 3UG7A 3PSHA 4Y1RA 3EXHB 4E3ZA 3KM0A 4KE6A 9MHTA 2IHNA 2PXHA 2DPGA 1LPPA 4XLLA 3B38A 4YCAA 1LVUA 3KTOA 3C85A 4F2DA 5EP3A 4FFVA 1K98A 2H4HA 1TIPA 4QGFA 4HH4A 1YBHA 3HEAA 4BZXA 4PC7A 4HL6A 4KX3A 2VPTA 2BFPA 2BFEA 1HNWB 1V7QA 4F11A 4K0RA 5KYYA 3C24A 1DX9A 1K5GA 2GN4A 4QDKA 4RYLA 1MDFA 5G0TA 3ZWAA 2ZYTX 4FBLA 5AJWA 2OV2A 1VPTA 3W9YA 1E6LA 3Q9NA 1IYZA 1NNUA 4O25A 2MCFA 4BBJA 2W2QA 4EB0A 5JMOA 2Y0PA 1ZESA 3E35A 1JJBA 5ED0A 3AXSA 2I3AA 4J94A 3BEDA 5AW3A 1M34B 3RREA 3WRXA 4DIEA 5K05A 1U0RA 5K8JB 5ABPA 1D09A 1CXZA 4G37A 2BFDB 3DULA 3EOAI 4XOUA 4F6RB 5IDWA 3U80A 4YRTA 1XDBA 3WP1B 2P9CA 3IHLA 2V6FA 2XWQA 3FGZA 2W2TA 4O4LA 1XTJA 3AONB 5TPWB 1NVEA 3A6EA 4QUEA 3QIVA 1S2GA 3E2PA 2ES4A 5DTIA 5LOVB 1A8SA 1U1CA 3B6MA 4YLGA 2XMBA 4DB2A 1O08A 1OWMA 2BDEA 4ZQIA 2W8BA 2YRWA 3TAUA 3P2YA 3W7AA 3PVCA 3W8EA 1FUEA 2WYIA 3E18A 4NEQA 1N1EA 2P1RA 2RJOA 3N74A 4BNMA 5H8WA 2LRHA 3OZFA 4DHEA 1VGRA 3U09A 3DDUA 3SJAA 4DQUA 2X8BA 3DDNA 4MA0A 4DOMA 2GXSA 1CY1A 4IEEA 4QXPA 3ZWWA 1DCKA 1WU7A 3JQAD 3KQWA 5K1ZA 1N92A 2GPWA 4OQDA 4COKA 4RU1A 4XWKA 3LA6A 3CLUC 4JY7A 4FFRA 1KY5A 1N5RA 1TA4A 1FU4A 4CEHB 1UPBA 5EJ5A 4P53A 3C98A 3LXXA 4WN9B 3M6MD 1MX3A 3PE3A 4GYJA 4OF4A 4XRRA 1C7QA 4YRPA 4BNJA 5B6PA 3MHPA 1XEFA 5G4KB 1X9IA 4M83A 5K0LA 1AZWA 3ESYA 3QVOA 3H84A 2W58A 3UNXA 2FG7C 1Z2DA 2WG2A 4U39A 3V5NA 1MO6A 1QHHB 5AJYA 1HE8B 3DF9A 4K3UA 4PZLA 1KEZA 2X3YA 4MO9A 3PA6A 2P90A 3PWZA 3Q98A 1Z08A 3IOCA 3K6KA 5AUPB 5JRDS 2KYRA 3OG9A 5BV0A 1J70A 2OOKA 5CX4A 2OZLA 2YWXA 2ZT8A 3TVDA 4I19A 4FYPA 4HAWA 1MXFA 2TSYB 1D2HA 3AP3A 1PJRA 2WIAA 2PLNA 5CB4B 3K32A 3KTFA 4H3VA 1KAQA 4AN0A 5BVHB 2DQ4A 1XCJA 5B7QA 1PLLA 4B81A 3SG0A 5GINE 4JNCA 2IL1A 3AUXA 1FZQA 1XP5A 2J5QA 4G81A 2ZUCA 3IH5A 1YQTA 4JROA 4U7PB 3RR2A 3W6ZA 2IY8A 1Q95A 3FDIA 3PQCA 1SRRA 4NXNB 2QROA 1OPXA 1XVUA 2PZAA 3A6DA 1MOPA 2QW8A 2VDJA 3TKAA 3O7WA 4K6MA 3U4CA 2CHFA 3MB8A 1AGPA 3SNHA 4NP6A 3B78A 3VUEA 4D8UA 1QB8A 1XD8A 1NVXQ 5HZMA 2LTAA 2P35A 3E1SA 4PWYA 2UYOA 1UPAA 4PSCA 5E3IA 3CS3A 3ELYA 3DZFA 3SQMA 4WUVA 2HCJB 2R00C 3O9MA 3JYHA 1HNNA 2QTNA 1OMOA 1RI5A 2PUEA 5KJ6A 1NMQA 2Y9PB 1OB2A 3NBFA 2XTNA 1ORIA 3B1KA 3B3AA 1P5ZB 4AO7A 1NF2A 3LPDA 4OQLA 3VR4H 2Q5FA 3P0JA 1AXEA 3ESCA 5CEEA 1C50A 4DTCA 1M6WA 5KJ1A 2WVAA 1CYEA 4OHCA 3U7EB 1PR3A 5JROA 3D7RA 4MA4A 4UTXA 4PLVA 3ZK9A 4B6EA 4RTJA 3TZHA 1MNQA 4OQMA 4HT3B 2PR7A 1P61B 5CM9C 3LVFO 1C4XA 4RIIA 5FA6A 2IYSA 1Y1QA 3IP5A 5EXPA 4BX0A 4HVAA 3VUFA 2R6DA 3KTDA 2NU6B 5IAJA 2IZ6A 2FEPA 3ZCRA 1M1NA 3PR3A 3K31A 3TXXA 4D9CA 4Z4HA 2GCOB 2NTJA 4OH1A 1SVLA 4GLFA 2XE7A 2B61A 2ZWVA 3K0CA 4U2EA 5LL6P 3KDPA 1YMUA 4W9NC 5DK6A 4OHFA 2ZDGA 4RKYA 1N5IA 2VO1A 1V9SA 4AIIA 2OBMA 3MT8A 2Z3ZA 1YKFA 4NBVA 4UREA 5AJHA 4DL9A 1APBA 3ABSB 3U4DA 5JJCA 4MP8A 5FBLB 2R6JA 3DWEX 2QTVB 2YMPA 3ZXSA 2D0IA 2I5PO 4K2HA 3N0WA 2HI0A 3OTQA 3L84A 4IXWA 1BAPA 1KVQA 4B80A 3SYNA 1PR4A 1DRUA 5EJ4A 2VJNA 2BIFA 3DMTC 3V4PB 5AW7A 1UMCB 2J33A 1W0CA 3OF3A 4HFNA 4UDXX 5T41A 2YFQA 2H18A 2PLFA 4RGBA 3KJQA 4Y6PA 3OFSA 1VE7A 4IHJA 1LS6A 1PUJA 4CLDA 3MIIA 4JQYA 4WX2B 3CCFA 3P2MA 3CEAA 5IHXA 3P9QA 2FLWA 4CTMA 1U0BB 3HKDB 4HRVA 5CX1B 4POOA 4Q15A 3K4HA 3O21A 1SG0A 1TJNA 3CYFA 1SIBE 2A3NA 3DCJA 3TLGA 3BQMB 4IDQA 2GASA 4ECAA 1ZK1A 4MULA 5H4GA 3U7FB 2ZSKA 3DA8A 1BYUA 3SBDA 4KAXA 1BGWA 2ISCA 4BUJA 1BOOA 3MWFA 4R9VA 1TECE 4HRXA 3RD5A 3WNQA 5TV2A 1VMKA 1LBHA 2DJ5A 3FMFA 1V41E 2CNOA 4G2NA 4EUFA 3PEYA 1B0UA 4RZ2A 3U17A 1N2CB 3FPLA 4CDMA 5LBUA 1YRQA 3ZE1B 1C29B 2WUEA 1RFLA 1CHDA 2C3MA 5AI4A 3ZVLA 2BFCB 3QTLA 3HPRA 4U7WA 2CNWA 1TOAA 2FLKA 3ZV6A 1N6RA 3EQ6A 5G41A 4F7WA 3RVOA 2ZGVA 3ZR4B 3U5TA 2WKQA 1GCGA 4I4IA 2B7LA 3GA0A 4GYWA 2XUDA 3AKZA 4RSGA 4N18A 2VWQA 4P6VF 5G0VA 5AW1A 2YNMD 2VXOA 1SU7A 3LAWA 2GZ3A 1YA6A 2OHVA 4OB6A 5K0GA 3HO6A 4BKOA 2GBIA 3L9WA 2AE2A 3LX5A 1T1RA 1T9CA 4ND8A 5AUQA 1T2EA 1Y8QB 2HSDA 1OI7A 1TGYA 3FOBA 4J91A 3WLHA 3LPCA 1JMYA 3S1LA 4KQ2A 2B9EA 4FMDF 5JCOC 3IUSA 3NJ8A 1TC1A 3EZGA 1R0BA 4M8SA 1Q2XA 4ND1A 4HNGA 4LYAA 1WVGA 4W9RA 5A0FA 1XZMA 3GJYA 2BFOA 13PKA 3JZIA 1NXOA 3ICOA 1RCTE 1SQGA 5JDIC 4WJKB 1I0LA 1XZPA 5GWXA 3UBMA 3BT7A 4RIEA 3TLYA 3EXAA 4Q7MB 3EQ2A 2IPLA 3X43A 1IZYA 2IYEA 1E20A 2XX3A 1OKKD 2HXGA 6CHYA 2EX4A 3A1TA 1Z0AA 2O3RA 3GFTA 4Z0TA 1ZMRA 1R5BA 1U0HC 5I9IA 4YUWA 1C0LA 4FWIB 4BMCA 2VDWB 1BEEA 2XVYA 1Z5UA 3QU5A 4PWZA 4FB4A 5KNDD 3A06A 4ZAVA 2GAIA 5JXHA 2R47A 1SCNE 4HDCA 4Z2YA 4TS4A 2DFPA 4P4UA 3JYQA 1BS2A 2WQ7A 3PCTA 1T5IA 3ND8A 1CR0A 2G88A 3OT5A 4YROA 5AD1A 1N8TA 4ATNA 2GWHA 4LGMA 3WDLA 4B84A 2P2SA 5G3YA 1WL8A 4OBEA 3RJ9A 1UJMA 5JLAA 1RJ9B 3OCYA 1DC7A 2ST1A 2OL4A 4RY2A 1U1IA 2P62A 4IHKA 1O2DA 3OKFA 4WLVA 2X8WA 2J41A 4FX5A 4PEVA 3DLCA 3AU9A 3U3JA 4D56A 4D9NA 1JP7A 4P2BA 4TT8A 4B3FX 5IARA 4C88A 3GZ4A 3DQPA 2X0NA 1GSHA 5E6UA 4NAUA 3H97A 4C6HA 3STHA 4DCVA 3OBIA 2XUOA 4OGLA 1I1OA 3HMKA 4K6HA 2KHZA 2ADMA 3I12A 4D0GA 1VIAA 3L7LA 1R0CA 4AXXA 2TMKA 3NEPX 1NJFA 4XUGB 1NOKA 5HDBB 1OZHA 4JUCA 2HWWA 4DRXA 1PR5A 1GCAA 2XSZA 3A6ZA 2ZB7A 4K03A 2VT2A 2GN6A 3D3NA 3G88A 4H6XA 1GG2A 3PQFA 1REQB 2BHNA 1P0FA 1SD5A 2ZRCA 5LBIA 3VR5D 2A94A 2X4GA 3OAAA 2PMCA 4IIDA 1YR6A 4Q1CA 4R0NA 4QUAA 5EMHA 5CDTA 1QLHA 4FGJA 2RGNC 1SD2A 1Q3KA 4LYYA 4GSYA 3Q7SA 5SYNA 2BRUA 3V7NA 3DBRA 2Q1UA 1HDCA 8LDHA 2EHDA 1PFGA 5F2NA 4C2TA 1NF3A 3I8SA 4DBZA 4UHHA 4J9VA 2W6QA 1I32A 4BJ6A 2W2KB 2O7RA 4WNCA 3TPZA 2HA7A 5D1NA 3IE1A 4TXHA 1DS6A 3BSYA 1CUAA 1WWKA 3ANXA 2RHTA 4EPYA 4C7OB 2AB0A 1D07A 3BIFA 5G1OA 5TMBA 2I71A 2R7KA 3D59A 3MINB 3MJEA 1RD4A 1XQ9A 1DIGA 4I50B 4WOPA 4D9JA 1EJ6A 4YAIA 1FDRA 3CF6R 1ZLYA 4N12A 5LFAA 4Y9UA 1PFKA 1FFSA 1YL6A 3OOJA 5AHKA 1ZS9A 1BDIA 2YZKA 3MAAC 2W6MA 5KWIA 3GRYA 2JLCA 4PLPA 3BGSA 1KZYC 1Q0UA 4RLFA 4U5QA 2EIXA 2Q4DA 5EXSA 2VC2B 5ARCA 4YCLA 1E2QA 2B5WA 1JXMA 3UUWA 5JQWA 4UCWA 2I7DA 1JDPA 3NTRA 4BAUA 3EXFB 1G6OA 1M2OB 5GIPE 3QJGA 2ZDQA 3MOSA 3EULA 4OD0A 1OBFO 4I1RA 4DGSA 5DHAA 1RMTA 4QT4A 3ON5A 4YCBA 5D85A 2BMEA 4HLNA 1O6CA 2WTNA 2VTKA 1LUAA 4O1IA 4DZTA 3E9ZA 3FF4A 1M8GA 2A9VA 1M6VA 1NJGA 2NO4A 3CW2A 3OICA 4UDNA 4L4RA 3OIDA 5EHQA 1K7FB 4BO9A 5C8YB 3USCS 3PD1A 3UM9A 2ZTLA 3HJNA 3PGMA 4NJOA 4W8GA 5ILOA 2FUCA 3W6PA 2YVQA 4PNEA 3MFQA 1SQ5A 3KQPA 4KQWA 5C18A 4MX8A 3O8QA 3OIYA 3H9BA 4YHBA 1JS1X 2C20A 2I4RA 2XY4A 3E5RA 4WUTA 3DV2A 1KIMA 3SEAA 2DGDA 1UPXA 1OA1A 2Q7XA 3PTAA 3EN0A 2D5LA 2YICA 4HG2A 2WLTA 4BRUA 3TDKA 4HGYA 2DH5A 3EZ7A 3EPLA 3B3JA 4MUXA 1C9YA 1YZ3A 3ISTA 4YIKA 3WGQA 2O5EA 4QVKA 4AK9A 1MEOA 2F3TA 1H6DA 3ECSA 3HWWA 4H35A 5DN9A 4CM4A 3CIOA 1M7HA 4JH0A 3PWSA 4G5FA 1U0SY 4UEWA 5FFNA 2VK1A 1VQ1A 1ETUA 1RWPA 2HN9A 5FLEX 4ARAA 1XHLA 4MQ6A 2K6GA 2PYIA 5CG1A 1ISGA 4RHCA 4RF5A 4CE6A 3SC2B 2Y68A 4FNGA 5AJXA 4ZQGA 2DOKA 1B3RA 3L6BA 2FW1A 3FIJA 3JQ6A 2QS9A 1E3SA 4KR3A 4EPWA 1ENOA 1V48A 3NYWA 3AEQA 2JCYA 4OOFA 3NH6A 4N0MA 4R1OA 1PWZA 4V0RA 1I4LD 3UJ7A 3JYNA 4AG5A 1R0XA 2QJOA 2IITA 3KUKA 1NL3A 4QEZA 4O2BB 4OJKA 3SHWA 3AR8A 4C0AC 1J22A 2OGWA 3NV7A 4KIUA 2JA1A 4GI7A 1MH9A 2I4NA 1RPAA 2IODA 2QRKA 1UM8A 2ZB8A 5DGDA 3VZCA 5ED4A 4ZHQF 4MUJA 3R8XA 3LQRA 3TUIC 3JD2A 1XG5A 2RFLA 4LZJA 2JFOA 3WWDA 4KIWA 1DOZA 3H2IA 2V6BA 3LZ6A 1DX4A 1L3IA 1NNSA 5U4XA 4PE5B 1P3JA 1H2EA 1MVOA 2IHZA 4OIMA 4UZFA 3R2JA 2KE5A 4N3AA 4TWIA 4EY8A 3F9IA 1MW9X 1E9BA 5F21A 1GUZA 5H59A 1JG2A 5CJJA 3PJGA 4X84A 3THSA 4CL0A 1FJXA 3GGJA 2PJDA 5I9TA 4GLLA 4DPLA 3ZLJA 3WB0A 1JN0A 3SR4A 1AKQA 1KH1A 2GJ4A 2WPDD 1I5EA 1XJ0A 2V7QA 3P0FA 1WF3A 4BHTA 3TMYA 5C8ZA 5AESA 2VHVA 2O6HA 1VE5A 1WUKS 4ARSA 2P4HX 2GCNA 1UODA 4RE6A 3V8NA 3W3AD 4DJTA 5IT5A 1D1TA 5BPFA 4CG1A 4G0QA 1I6WA 3W8FA 3AR5A 5L3QB 3OIWA 3OZRA 3ADBA 4F0JA 3VPCA 4Q9DA 5FH9A 3TK1A 2WWHA 1UXJA 3ABQB 4JNKA 5J2TF 4IRXA 1H93A 3PJEA 4UUPA 4WD3A 1VJ1A 1Q0LA 2A0UA 2P8JA 3PUWA 4GNRA 3D3WA 1Z2CA 4W1PA 5LZ8A 4GPTA 3CZCA 2V5AA 3EIQA 1Z36A 3ZIUA 4XDGA 1KOFA 2NTYC 2AD5A 3H65A 4JI2B 3RBVA 2HIAA 1CJMA 4WLNA 1LFDB 1Q21A 4LDNA 3T3HA 1C3OA 4WCFB 5ANRB 1DG3A 2J5XA 3BN3A 4JBXA 1BDHA 1P0QA 4CQJA 3LYHA 1LZKA 1XKLA 3BDVA 3CRQA 1SC4A 5TQ0B 1V16B 2DCMA 1GVHA 4KDRA 4CODB 5KPJA 2JLRA 1DO0A 3I9V1 4ZXFA 2FZKA 4UBOA 1FDSA 1PF7E 1OC4A 2JAXA 2WWXA 4NYMR 3VO1A 3VV2A 3FPFA 5DNDA 3TQOA 3RHFA 1CERA 3VU9A 1N2IA 1YSCA 1TM1E 1V6SA 2AEMA 2RHOA 2O5RA 4NESA 4E94A 2INGX 4G41A 5BW8A 2RGGA 3FJYA 1ZWLA 2UYQA 2OQIA 2PO5A 4JX8A 1M2GA 4O6VA 3G85A 3L8YA 3VOSA 2SECE 3TIFA 3WAKA 4DS3A 5HUQA 5ICEA 4A2WA 3H4TA 3KSRA 3LY7A 2APJA 4P3OA 4CTKA 3ZVKA 5ER9A 3DV0B 3KJXA