1KEAA

Structure of a thermostable thymine-dna glycosylase
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
217
structure length
217
Chain Sequence
DATNKKRKVFVSTILTFWNTDRRDFPWRHTRDPYVILITEILLRRTTAGHVKKIYDKFFVKYKCFEDILKTPKSEIAKDIKEIGLSNQRAEQLKELARVVINDYGGRVPRNRKAILDLPGVGKYTCAAVMCLAFGKKAAMVDANFVRVINRYFGGSYENLNYNHKALWELAETLVPGGKCRDFNLGLMDFSAIICAPRKPKCEKCGMSKLCSYYEKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Possible G-T mismatches repair enzyme
publication title Structure and activity of a thermostable thymine-DNA glycosylase: evidence for base twisting to remove mismatched normal DNA bases.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Hydrolase
total genus 78
structure length 217
sequence length 217
ec nomenclature ec 3.2.2.-:
pdb deposition date 2001-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 1keaA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 1keaA01
2XHIA 2OFKA 1KEAA 5KN8A 1MUYA 3N0UA 4E9FA 4EW0A 4EA5A 2NOHA 2NOFA 1N39A 1LWWA 1MPGA 1YQLA 1EBMA 2H56A 1DIZA 1KG2A 2YG8A 1MUNA 1M3HA 1RRSA 3KTUA 1YQKA 3CWSA 1VRLA 1KG7A 1PU6A 4YPRA 1P7MA 4UOBA 3D4VA 1KG3A 1XQOA 3F0ZA 2OFIA 3OH6A 1XQPA 4EW4A 1WEGA 1KO9A 1WEIA 1M3QA 1XG7A 4OFEA 3FSPA 4E9HA 2NOEA 3I0XA 2NOZA 5CHZA 2ABKA 1LWVA 3IHOA 3I0WA 2JHJA 5DPKA 4EJZA 1PU7A 3FHGA 3CVTA 2YG9A 3CWUA 3OH9A 2I5WA 5AN4A 4OFHA 1YQRA 2JG6A 1KG6A 3IH7A 1YQMA 3CWAA 4B22A 3N5NX 1NKUA 1KG5A 4PIIA 1LWYA 4EA4A 2JHNA 1PVSA 4YOQA 4EJYA 4B24A 1RRQA 4AI5A 2NOBA 2NOLA 1MUDA 4AIAA 3S6IA 3CW7A 1P59A 1ORNA 3F10A 1ORPA 3CWTA 1N3AA 4OFAA 5KN9A 1KQJA 3KNTA 1HU0A 4YPHA 3G0QA 1N3CA 4HSBA 3CVSA 1FN7A 4DK9A 1KG4A 3FHFA 1WEFA 1PU8A 4UNFA 1NGNA 4AI4A 3OGDA 4B23A 4EVVA 4E9EA 4E9GA 2NOIA 1LMZA 4B21A
chains in the Genus database with same CATH superfamily
2XHIA 2OFKA 1KEAA 5KN8A 1MUYA 3N0UA 4E9FA 4EW0A 3OYHA 3OYMA 4EA5A 2NOHA 2NOFA 3OYIA 1N39A 3VW4A 2W04A 3OYAA 1LWWA 1MPGA 1YQLA 4E7IA 1EBMA 3S3NA 2H56A 1DIZA 1KG2A 4IKFA 2YG8A 2NOIA 1MUNA 3OYEA 3OYKA 1M3HA 1RRSA 3KTUA 3OY9A 4E7JA 1YQKA 3CWSA 4E7LA 1VRLA 1KG7A 5FRNA 1PU6A 4YPRA 1U84A 1P7MA 4UOBA 3D4VA 4E7HA 4BE2A 5FROA 3OYGA 1KG3A 1XQOA 3F0ZA 2OFIA 4BACA 3OH6A 3L2QA 3R2XC 3L2UA 3LCNA 1XQPA 4EW4A 1WEGA 1KO9A 1WEIA 1M3QA 4ZTFA 1XG7A 4OFEA 3FSPA 4E9HA 2NOEA 3I0XA 2NOZA 5CHZA 2ABKA 1LWVA 3IHOA 3I0WA 2JHJA 5DPKA 4EJZA 1PU7A 3FHGA 3CVTA 4BDYA 2YG9A 3CWUA 3OS2A 2V75A 3OYBA 3OYJA 3OH9A 2I5WA 5AN4A 4OFHA 1YQRA 2JG6A 3L2WA 1KG6A 3IH7A 1YQMA 3CWAA 3OS0A 4B22A 3N5NX 3OS1A 1NKUA 1KG5A 4PIIA 4BE1A 1LWYA 4EA4A 2JHNA 3L2VA 4ZTJA 4NZGA 1PVSA 3OYNA 4YOQA 4EJYA 2JPSA 4BDZA 4B24A 1RRQA 4AI5A 2NOBA 2NOLA 1MUDA 3S3MA 4AIAA 3S6IA 4BE0A 3CW7A 1P59A 1ORNA 3NNQA 3F10A 1ORPA 3CWTA 1N3AA 4OFAA 5KN9A 1KQJA 3KNTA 1HU0A 3S3OA 5FRMA 4YPHA 3L2RA 3G0QA 1N3CA 4HSBA 3CVSA 2W03A 1FN7A 4DK9A 1KG4A 3FHFA 1WEFA 3OYDA 3OYLA 1PU8A 4UNFA 1NGNA 4AI4A 3OYCA 3OYFA 3OGDA 4E9EA 4B23A 4E9GA 4E7KA 4EVVA 1LMZA 4B21A
chains in the Genus database with same CATH topology
2XHIA 2OFKA 1KEAA 5KN8A 1MUYA 3N0UA 4E9FA 4EW0A 4EA5A 2NOHA 2NOFA 1N39A 1LWWA 1MPGA 1YQLA 1EBMA 2H56A 1DIZA 1KG2A 2YG8A 1MUNA 1M3HA 1RRSA 3KTUA 1YQKA 3CWSA 1VRLA 1KG7A 1PU6A 4YPRA 1P7MA 4UOBA 3D4VA 1KG3A 1XQOA 3F0ZA 2OFIA 3OH6A 1XQPA 4EW4A 1WEGA 1KO9A 1WEIA 1M3QA 1XG7A 4OFEA 3FSPA 4E9HA 2NOEA 3I0XA 2NOZA 5CHZA 2ABKA 1LWVA 3IHOA 3I0WA 2JHJA 5DPKA 4EJZA 1PU7A 3FHGA 3CVTA 2YG9A 3CWUA 3OH9A 2I5WA 5AN4A 4OFHA 1YQRA 2JG6A 1KG6A 3IH7A 1YQMA 3CWAA 4B22A 3N5NX 1NKUA 1KG5A 4PIIA 1LWYA 4EA4A 2JHNA 1PVSA 4YOQA 4EJYA 4B24A 1RRQA 4AI5A 2NOBA 2NOLA 1MUDA 4AIAA 3S6IA 3CW7A 1P59A 1ORNA 3F10A 1ORPA 3CWTA 1N3AA 4OFAA 5KN9A 1KQJA 3KNTA 1HU0A 4YPHA 3G0QA 1N3CA 4HSBA 3CVSA 1FN7A 4DK9A 1KG4A 3FHFA 1WEFA 1PU8A 4UNFA 1NGNA 4AI4A 3OGDA 4B23A 4EVVA 4E9EA 4E9GA 2NOIA 1LMZA 4B21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XHI A;  2OFK A;  1KEA A;  5KN8 A;  1MUY A;  3N0U A;  4E9F A;  4EW0 A;  4EA5 A;  2NOH A;  2NOF A;  1N39 A;  1LWW A;  1MPG A;  1YQL A;  1EBM A;  2H56 A;  1DIZ A;  1KG2 A;  2YG8 A;  1MUN A;  1M3H A;  1RRS A;  3KTU A;  1YQK A;  3CWS A;  1VRL A;  1KG7 A;  1PU6 A;  4YPR A;  1P7M A;  4UOB A;  3D4V A;  1KG3 A;  1XQO A;  3F0Z A;  2OFI A;  3OH6 A;  1XQP A;  4EW4 A;  1WEG A;  1KO9 A;  1WEI A;  1M3Q A;  1XG7 A;  4OFE A;  3FSP A;  4E9H A;  2NOE A;  3I0X A;  2NOZ A;  5CHZ A;  2ABK A;  1LWV A;  3IHO A;  3I0W A;  2JHJ A;  5DPK A;  4EJZ A;  1PU7 A;  3FHG A;  3CVT A;  2YG9 A;  3CWU A;  3OH9 A;  2I5W A;  5AN4 A;  4OFH A;  1YQR A;  2JG6 A;  1KG6 A;  3IH7 A;  1YQM A;  3CWA A;  4B22 A;  3N5N X;  1NKU A;  1KG5 A;  4PII A;  1LWY A;  4EA4 A;  2JHN A;  1PVS A;  4YOQ A;  4EJY A;  4B24 A;  1RRQ A;  4AI5 A;  2NOB A;  2NOL A;  1MUD A;  4AIA A;  3S6I A;  3CW7 A;  1P59 A;  1ORN A;  3F10 A;  1ORP A;  3CWT A;  1N3A A;  4OFA A;  5KN9 A;  1KQJ A;  3KNT A;  1HU0 A;  4YPH A;  3G0Q A;  1N3C A;  4HSB A;  3CVS A;  1FN7 A;  4DK9 A;  1KG4 A;  3FHF A;  1WEF A;  1PU8 A;  4UNF A;  1NGN A;  4AI4 A;  3OGD A;  4B23 A;  4EVV A;  4E9E A;  4E9G A;  2NOI A;  1LMZ A;  4B21 A; 
#chains in the Genus database with same CATH topology
 2XHI A;  2OFK A;  1KEA A;  5KN8 A;  1MUY A;  3N0U A;  4E9F A;  4EW0 A;  3OYH A;  3OYM A;  4EA5 A;  2NOH A;  2NOF A;  3OYI A;  1N39 A;  3VW4 A;  2W04 A;  3OYA A;  1LWW A;  1MPG A;  1YQL A;  4E7I A;  1EBM A;  3S3N A;  2H56 A;  1DIZ A;  1KG2 A;  4IKF A;  2YG8 A;  2NOI A;  1MUN A;  3OYE A;  3OYK A;  1M3H A;  1RRS A;  3KTU A;  3OY9 A;  4E7J A;  1YQK A;  3CWS A;  4E7L A;  1VRL A;  1KG7 A;  5FRN A;  1PU6 A;  4YPR A;  1U84 A;  1P7M A;  4UOB A;  3D4V A;  4E7H A;  4BE2 A;  5FRO A;  3OYG A;  1KG3 A;  1XQO A;  3F0Z A;  2OFI A;  4BAC A;  3OH6 A;  3L2Q A;  3R2X C;  3L2U A;  3LCN A;  1XQP A;  4EW4 A;  1WEG A;  1KO9 A;  1WEI A;  1M3Q A;  4ZTF A;  1XG7 A;  4OFE A;  3FSP A;  4E9H A;  2NOE A;  3I0X A;  2NOZ A;  5CHZ A;  2ABK A;  1LWV A;  3IHO A;  3I0W A;  2JHJ A;  5DPK A;  4EJZ A;  1PU7 A;  3FHG A;  3CVT A;  4BDY A;  2YG9 A;  3CWU A;  3OS2 A;  2V75 A;  3OYB A;  3OYJ A;  3OH9 A;  2I5W A;  5AN4 A;  4OFH A;  1YQR A;  2JG6 A;  3L2W A;  1KG6 A;  3IH7 A;  1YQM A;  3CWA A;  3OS0 A;  4B22 A;  3N5N X;  3OS1 A;  1NKU A;  1KG5 A;  4PII A;  4BE1 A;  1LWY A;  4EA4 A;  2JHN A;  3L2V A;  4ZTJ A;  4NZG A;  1PVS A;  3OYN A;  4YOQ A;  4EJY A;  2JPS A;  4BDZ A;  4B24 A;  1RRQ A;  4AI5 A;  2NOB A;  2NOL A;  1MUD A;  3S3M A;  4AIA A;  3S6I A;  4BE0 A;  3CW7 A;  1P59 A;  1ORN A;  3NNQ A;  3F10 A;  1ORP A;  3CWT A;  1N3A A;  4OFA A;  5KN9 A;  1KQJ A;  3KNT A;  1HU0 A;  3S3O A;  5FRM A;  4YPH A;  3L2R A;  3G0Q A;  1N3C A;  4HSB A;  3CVS A;  2W03 A;  1FN7 A;  4DK9 A;  1KG4 A;  3FHF A;  1WEF A;  3OYD A;  3OYL A;  1PU8 A;  4UNF A;  1NGN A;  4AI4 A;  3OYC A;  3OYF A;  3OGD A;  4E9E A;  4B23 A;  4E9G A;  4E7K A;  4EVV A;  1LMZ A;  4B21 A; 
#chains in the Genus database with same CATH homology
 2XHI A;  2OFK A;  1KEA A;  5KN8 A;  1MUY A;  3N0U A;  4E9F A;  4EW0 A;  4EA5 A;  2NOH A;  2NOF A;  1N39 A;  1LWW A;  1MPG A;  1YQL A;  1EBM A;  2H56 A;  1DIZ A;  1KG2 A;  2YG8 A;  1MUN A;  1M3H A;  1RRS A;  3KTU A;  1YQK A;  3CWS A;  1VRL A;  1KG7 A;  1PU6 A;  4YPR A;  1P7M A;  4UOB A;  3D4V A;  1KG3 A;  1XQO A;  3F0Z A;  2OFI A;  3OH6 A;  1XQP A;  4EW4 A;  1WEG A;  1KO9 A;  1WEI A;  1M3Q A;  1XG7 A;  4OFE A;  3FSP A;  4E9H A;  2NOE A;  3I0X A;  2NOZ A;  5CHZ A;  2ABK A;  1LWV A;  3IHO A;  3I0W A;  2JHJ A;  5DPK A;  4EJZ A;  1PU7 A;  3FHG A;  3CVT A;  2YG9 A;  3CWU A;  3OH9 A;  2I5W A;  5AN4 A;  4OFH A;  1YQR A;  2JG6 A;  1KG6 A;  3IH7 A;  1YQM A;  3CWA A;  4B22 A;  3N5N X;  1NKU A;  1KG5 A;  4PII A;  1LWY A;  4EA4 A;  2JHN A;  1PVS A;  4YOQ A;  4EJY A;  4B24 A;  1RRQ A;  4AI5 A;  2NOB A;  2NOL A;  1MUD A;  4AIA A;  3S6I A;  3CW7 A;  1P59 A;  1ORN A;  3F10 A;  1ORP A;  3CWT A;  1N3A A;  4OFA A;  5KN9 A;  1KQJ A;  3KNT A;  1HU0 A;  4YPH A;  3G0Q A;  1N3C A;  4HSB A;  3CVS A;  1FN7 A;  4DK9 A;  1KG4 A;  3FHF A;  1WEF A;  1PU8 A;  4UNF A;  1NGN A;  4AI4 A;  3OGD A;  4B23 A;  4EVV A;  4E9E A;  4E9G A;  2NOI A;  1LMZ A;  4B21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...