1KEAA

Structure of a thermostable thymine-dna glycosylase
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
217
structure length
217
Chain Sequence
DATNKKRKVFVSTILTFWNTDRRDFPWRHTRDPYVILITEILLRRTTAGHVKKIYDKFFVKYKCFEDILKTPKSEIAKDIKEIGLSNQRAEQLKELARVVINDYGGRVPRNRKAILDLPGVGKYTCAAVMCLAFGKKAAMVDANFVRVINRYFGGSYENLNYNHKALWELAETLVPGGKCRDFNLGLMDFSAIICAPRKPKCEKCGMSKLCSYYEKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Possible G-T mismatches repair enzyme
publication title Structure and activity of a thermostable thymine-DNA glycosylase: evidence for base twisting to remove mismatched normal DNA bases.
pubmed doi rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Hydrolase
total genus 78
structure length 217
sequence length 217
ec nomenclature ec 3.2.2.-:
pdb deposition date 2001-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 1keaA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 1keaA01
1N3AA 2YG9A 2I5WA 1LMZA 2NOIA 3FSPA 3CVSA 1XQOA 1KO9A 2OFIA 4AI4A 5CHZA 4EA5A 5DPKA 4B21A 2H56A 3FHGA 4YPHA 1RRQA 1KG7A 2NOBA 2XHIA 2JHJA 1LWVA 1KG3A 3OGDA 3IHOA 1NGNA 3CWUA 1KEAA 2JHNA 4E9FA 2OFKA 1N39A 4EJZA 2JG6A 4E9HA 4EJYA 4UNFA 1KG4A 1MUYA 4PIIA 3F0ZA 1N3CA 1XQPA 3F10A 3CWTA 4AIAA 3OH6A 1FN7A 1LWWA 4EW4A 5KN9A 2NOZA 4EW0A 4E9EA 4B24A 4YOQA 3IH7A 3D4VA 1DIZA 1WEFA 1YQLA 3S6IA 1PU6A 5AN4A 3FHFA 1P7MA 4B23A 4UOBA 2YG8A 1ORNA 1EBMA 1HU0A 1PU7A 2ABKA 1ORPA 2NOFA 3G0QA 1NKUA 1RRSA 1KG5A 5KN8A 1KG6A 3N5NX 4OFHA 1WEIA 1KQJA 3KTUA 1PVSA 3I0WA 4EVVA 2NOEA 1MPGA 4OFAA 3CWSA 1XG7A 3CVTA 1MUNA 1P59A 4E9GA 3CW7A 3KNTA 4HSBA 3OH9A 1YQKA 2NOHA 1M3QA 1WEGA 1KG2A 4B22A 4EA4A 1LWYA 2NOLA 3N0UA 1PU8A 1M3HA 4YPRA 1YQMA 1VRLA 3CWAA 1MUDA 4OFEA 4DK9A 1YQRA 4AI5A 3I0XA
chains in the Genus database with same CATH superfamily
1N3AA 2YG9A 2I5WA 4BDZA 1LMZA 2NOIA 3FSPA 3CVSA 1XQOA 1KO9A 3S3MA 2OFIA 4AI4A 4E7HA 5CHZA 4EA5A 5DPKA 4BDYA 4B21A 3OYKA 4E7KA 2H56A 3FHGA 4YPHA 4ZTFA 1RRQA 1KG7A 3OYNA 2NOBA 2XHIA 2JHJA 3OYLA 1LWVA 4IKFA 1KG3A 3L2WA 3OGDA 3IHOA 1NGNA 3S3OA 3CWUA 3OS0A 1KEAA 2JHNA 3L2UA 4E9FA 2OFKA 1N39A 4EJZA 2JG6A 5FRMA 4E9HA 4EJYA 4ZTJA 4UNFA 1KG4A 1MUYA 4PIIA 2JPSA 3F0ZA 1N3CA 1XQPA 3F10A 3S3NA 4AIAA 3CWTA 3OH6A 1FN7A 1LWWA 4EW4A 5KN9A 2NOZA 4EW0A 4E9EA 5FROA 4B24A 4YOQA 3OY9A 3IH7A 3D4VA 1DIZA 3OYFA 1WEFA 1YQLA 3OYIA 3L2QA 4BACA 3S6IA 3R2XC 1PU6A 3OYBA 5AN4A 4BE0A 3FHFA 1P7MA 3OYHA 4B23A 4UOBA 2YG8A 1ORNA 3OYJA 3OYEA 4E7IA 1EBMA 1HU0A 1PU7A 2ABKA 1ORPA 2NOFA 3G0QA 1NKUA 1RRSA 1KG5A 5KN8A 3LCNA 4BE2A 3OYAA 1KG6A 3N5NX 4OFHA 1WEIA 1KQJA 3KTUA 1PVSA 3I0WA 4EVVA 2NOEA 1MPGA 4BE1A 4OFAA 2V75A 3CWSA 1XG7A 3CVTA 1MUNA 3OYCA 1P59A 4E9GA 3CW7A 3KNTA 2W04A 3OYDA 3VW4A 3NNQA 4HSBA 3L2VA 3OH9A 4NZGA 1YQKA 2NOHA 1M3QA 3OS2A 1WEGA 1KG2A 3OYMA 2W03A 4B22A 4EA4A 4E7JA 3N0UA 4E7LA 1LWYA 2NOLA 1U84A 3OYGA 1PU8A 1M3HA 4YPRA 1YQMA 1VRLA 3CWAA 1MUDA 4OFEA 4DK9A 3L2RA 1YQRA 5FRNA 4AI5A 3OS1A 3I0XA
chains in the Genus database with same CATH topology
1N3AA 2YG9A 2I5WA 1LMZA 2NOIA 3FSPA 3CVSA 1XQOA 1KO9A 2OFIA 4AI4A 5CHZA 4EA5A 5DPKA 4B21A 2H56A 3FHGA 4YPHA 1RRQA 1KG7A 2NOBA 2XHIA 2JHJA 1LWVA 1KG3A 3OGDA 3IHOA 1NGNA 3CWUA 1KEAA 2JHNA 4E9FA 2OFKA 1N39A 4EJZA 2JG6A 4E9HA 4EJYA 4UNFA 1KG4A 1MUYA 4PIIA 3F0ZA 1N3CA 1XQPA 3F10A 3CWTA 4AIAA 3OH6A 1FN7A 1LWWA 4EW4A 5KN9A 2NOZA 4EW0A 4E9EA 4B24A 4YOQA 3IH7A 3D4VA 1DIZA 1WEFA 1YQLA 3S6IA 1PU6A 5AN4A 3FHFA 1P7MA 4B23A 4UOBA 2YG8A 1ORNA 1EBMA 1HU0A 1PU7A 2ABKA 1ORPA 2NOFA 3G0QA 1NKUA 1RRSA 1KG5A 5KN8A 1KG6A 3N5NX 4OFHA 1WEIA 1KQJA 3KTUA 1PVSA 3I0WA 4EVVA 2NOEA 1MPGA 4OFAA 3CWSA 1XG7A 3CVTA 1MUNA 1P59A 4E9GA 3CW7A 3KNTA 4HSBA 3OH9A 1YQKA 2NOHA 1M3QA 1WEGA 1KG2A 4B22A 4EA4A 1LWYA 2NOLA 3N0UA 1PU8A 1M3HA 4YPRA 1YQMA 1VRLA 3CWAA 1MUDA 4OFEA 4DK9A 1YQRA 4AI5A 3I0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N3A A;  2YG9 A;  2I5W A;  1LMZ A;  2NOI A;  3FSP A;  3CVS A;  1XQO A;  1KO9 A;  2OFI A;  4AI4 A;  5CHZ A;  4EA5 A;  5DPK A;  4B21 A;  2H56 A;  3FHG A;  4YPH A;  1RRQ A;  1KG7 A;  2NOB A;  2XHI A;  2JHJ A;  1LWV A;  1KG3 A;  3OGD A;  3IHO A;  1NGN A;  3CWU A;  1KEA A;  2JHN A;  4E9F A;  2OFK A;  1N39 A;  4EJZ A;  2JG6 A;  4E9H A;  4EJY A;  4UNF A;  1KG4 A;  1MUY A;  4PII A;  3F0Z A;  1N3C A;  1XQP A;  3F10 A;  3CWT A;  4AIA A;  3OH6 A;  1FN7 A;  1LWW A;  4EW4 A;  5KN9 A;  2NOZ A;  4EW0 A;  4E9E A;  4B24 A;  4YOQ A;  3IH7 A;  3D4V A;  1DIZ A;  1WEF A;  1YQL A;  3S6I A;  1PU6 A;  5AN4 A;  3FHF A;  1P7M A;  4B23 A;  4UOB A;  2YG8 A;  1ORN A;  1EBM A;  1HU0 A;  1PU7 A;  2ABK A;  1ORP A;  2NOF A;  3G0Q A;  1NKU A;  1RRS A;  1KG5 A;  5KN8 A;  1KG6 A;  3N5N X;  4OFH A;  1WEI A;  1KQJ A;  3KTU A;  1PVS A;  3I0W A;  4EVV A;  2NOE A;  1MPG A;  4OFA A;  3CWS A;  1XG7 A;  3CVT A;  1MUN A;  1P59 A;  4E9G A;  3CW7 A;  3KNT A;  4HSB A;  3OH9 A;  1YQK A;  2NOH A;  1M3Q A;  1WEG A;  1KG2 A;  4B22 A;  4EA4 A;  1LWY A;  2NOL A;  3N0U A;  1PU8 A;  1M3H A;  4YPR A;  1YQM A;  1VRL A;  3CWA A;  1MUD A;  4OFE A;  4DK9 A;  1YQR A;  4AI5 A;  3I0X A; 
#chains in the Genus database with same CATH topology
 1N3A A;  2YG9 A;  2I5W A;  4BDZ A;  1LMZ A;  2NOI A;  3FSP A;  3CVS A;  1XQO A;  1KO9 A;  3S3M A;  2OFI A;  4AI4 A;  4E7H A;  5CHZ A;  4EA5 A;  5DPK A;  4BDY A;  4B21 A;  3OYK A;  4E7K A;  2H56 A;  3FHG A;  4YPH A;  4ZTF A;  1RRQ A;  1KG7 A;  3OYN A;  2NOB A;  2XHI A;  2JHJ A;  3OYL A;  1LWV A;  4IKF A;  1KG3 A;  3L2W A;  3OGD A;  3IHO A;  1NGN A;  3S3O A;  3CWU A;  3OS0 A;  1KEA A;  2JHN A;  3L2U A;  4E9F A;  2OFK A;  1N39 A;  4EJZ A;  2JG6 A;  5FRM A;  4E9H A;  4EJY A;  4ZTJ A;  4UNF A;  1KG4 A;  1MUY A;  4PII A;  2JPS A;  3F0Z A;  1N3C A;  1XQP A;  3F10 A;  3S3N A;  4AIA A;  3CWT A;  3OH6 A;  1FN7 A;  1LWW A;  4EW4 A;  5KN9 A;  2NOZ A;  4EW0 A;  4E9E A;  5FRO A;  4B24 A;  4YOQ A;  3OY9 A;  3IH7 A;  3D4V A;  1DIZ A;  3OYF A;  1WEF A;  1YQL A;  3OYI A;  3L2Q A;  4BAC A;  3S6I A;  3R2X C;  1PU6 A;  3OYB A;  5AN4 A;  4BE0 A;  3FHF A;  1P7M A;  3OYH A;  4B23 A;  4UOB A;  2YG8 A;  1ORN A;  3OYJ A;  3OYE A;  4E7I A;  1EBM A;  1HU0 A;  1PU7 A;  2ABK A;  1ORP A;  2NOF A;  3G0Q A;  1NKU A;  1RRS A;  1KG5 A;  5KN8 A;  3LCN A;  4BE2 A;  3OYA A;  1KG6 A;  3N5N X;  4OFH A;  1WEI A;  1KQJ A;  3KTU A;  1PVS A;  3I0W A;  4EVV A;  2NOE A;  1MPG A;  4BE1 A;  4OFA A;  2V75 A;  3CWS A;  1XG7 A;  3CVT A;  1MUN A;  3OYC A;  1P59 A;  4E9G A;  3CW7 A;  3KNT A;  2W04 A;  3OYD A;  3VW4 A;  3NNQ A;  4HSB A;  3L2V A;  3OH9 A;  4NZG A;  1YQK A;  2NOH A;  1M3Q A;  3OS2 A;  1WEG A;  1KG2 A;  3OYM A;  2W03 A;  4B22 A;  4EA4 A;  4E7J A;  3N0U A;  4E7L A;  1LWY A;  2NOL A;  1U84 A;  3OYG A;  1PU8 A;  1M3H A;  4YPR A;  1YQM A;  1VRL A;  3CWA A;  1MUD A;  4OFE A;  4DK9 A;  3L2R A;  1YQR A;  5FRN A;  4AI5 A;  3OS1 A;  3I0X A; 
#chains in the Genus database with same CATH homology
 1N3A A;  2YG9 A;  2I5W A;  1LMZ A;  2NOI A;  3FSP A;  3CVS A;  1XQO A;  1KO9 A;  2OFI A;  4AI4 A;  5CHZ A;  4EA5 A;  5DPK A;  4B21 A;  2H56 A;  3FHG A;  4YPH A;  1RRQ A;  1KG7 A;  2NOB A;  2XHI A;  2JHJ A;  1LWV A;  1KG3 A;  3OGD A;  3IHO A;  1NGN A;  3CWU A;  1KEA A;  2JHN A;  4E9F A;  2OFK A;  1N39 A;  4EJZ A;  2JG6 A;  4E9H A;  4EJY A;  4UNF A;  1KG4 A;  1MUY A;  4PII A;  3F0Z A;  1N3C A;  1XQP A;  3F10 A;  3CWT A;  4AIA A;  3OH6 A;  1FN7 A;  1LWW A;  4EW4 A;  5KN9 A;  2NOZ A;  4EW0 A;  4E9E A;  4B24 A;  4YOQ A;  3IH7 A;  3D4V A;  1DIZ A;  1WEF A;  1YQL A;  3S6I A;  1PU6 A;  5AN4 A;  3FHF A;  1P7M A;  4B23 A;  4UOB A;  2YG8 A;  1ORN A;  1EBM A;  1HU0 A;  1PU7 A;  2ABK A;  1ORP A;  2NOF A;  3G0Q A;  1NKU A;  1RRS A;  1KG5 A;  5KN8 A;  1KG6 A;  3N5N X;  4OFH A;  1WEI A;  1KQJ A;  3KTU A;  1PVS A;  3I0W A;  4EVV A;  2NOE A;  1MPG A;  4OFA A;  3CWS A;  1XG7 A;  3CVT A;  1MUN A;  1P59 A;  4E9G A;  3CW7 A;  3KNT A;  4HSB A;  3OH9 A;  1YQK A;  2NOH A;  1M3Q A;  1WEG A;  1KG2 A;  4B22 A;  4EA4 A;  1LWY A;  2NOL A;  3N0U A;  1PU8 A;  1M3H A;  4YPR A;  1YQM A;  1VRL A;  3CWA A;  1MUD A;  4OFE A;  4DK9 A;  1YQR A;  4AI5 A;  3I0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...