1KEPA

The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-xylose bound
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
346
structure length
346
Chain Sequence
QFKNIIVTGGAGFIGSNFVHYVYNNHPDVHVTVLDKLTYAGNKANLEAILGDRVELVVGDIADAELVDKLAAKADAIVHYAAESHNDNSLNDPSPFIHTNFIGTYTLLEAARKYDIRFHHVSTDEVYGDLPLREDLPGHGEGPGEKFTAETNYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKNNKEVLELILEKMGQPKDAYDHVTDRAGHDLRYAIDASKLRDELGWTPQFTDFSEGLEETIQWYTDNQDWWKAEKEAVEANYAKTQEVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dTDP-D-glucose 4,6-dehydratase
publication title Toward a structural understanding of the dehydratase mechanism.
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Lyase
total genus 145
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 4.2.1.46: dTDP-glucose 4,6-dehydratase.
pdb deposition date 2001-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1kepA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1kepA02
4QFCA 4J90A 4PLGA 2GLXA 3DXFA 3KOUA 3INGA 4OXNA 3RROA 3KVOA 3KHUA 4ND3A 4AJIA 1X1TA 1C1DA 1CJCA 1ZH8A 4IPTA 4RVUA 3B1KA 5JY1A 3GEDA 5DCYA 2CVOA 4G5HA 4XGIA 4GX5A 5DBGA 2C82A 3WWZA 1HF3A 2AE1A 3JSAA 4EEZA 1WWKA 5ER6A 3L6OO 3FNGA 4IXWA 2QHXA 4IDCA 2X0NA 1HZJA 2PKQP 3BZUA 3QJ5A 2ZB3A 1XA0A 5DT9A 4BUCA 1FDWA 2Y0CA 1PJCA 3OEYA 4N5NA 4UUOA 2EP7A 3Q3CA 2V6BA 5JYEA 5THQA 1P45A 1U5AA 1ADGA 3GC6A 1K6IA 1LU9A 1PL8A 3B1FA 1C0LA 3WGTA 1I3NA 3ZV6A 3GOHA 1NPYA 1R4MB 2AG5A 4IJKA 1EFKA 1NXQA 5T57A 5IZ4A 5JO0A 2E48A 5DCWA 1YQGA 3WTCA 5L4LA 1GUZA 2Q2QA 1KY4A 3GGGA 1W73A 3HSKA 5DULA 2NACA 3ONEA 4PLHA 2EWMA 3ZWMA 3H3FA 1HKUA 1ENYA 2W90A 5F3RA 1LI4A 2Q4EA 3TQHA 1PJQA 2JKVA 4JK3A 4OKIA 4CV1A 1CEQA 2P91A 1KEVA 3L6EA 4PCVA 1T2AA 2B37A 3AI2A 1I2CA 4R16A 4M55A 5L3ZA 1YB5A 3TZHA 3W8FA 1NNUA 1P3DA 4Z0TA 3OBBA 3E82A 4H16A 1QV7A 1NQ5A 4BGIA 4MP6A 4DIFA 3JQCA 1M6WA 4J7CA 3QRWA 1HYEA 1YDEA 3DZKA 1DIRA 2AA3A 4J49A 1BRMA 3BA1A 4TWRA 3MCVA 5H82A 4BO5A 1TLTA 4TKLA 2DVMA 3BXXA 4OHUA 4BMVA 4JCOA 1F8GA 4Q3CA 2YHIA 3ROPA 4QX6A 3WNQA 5TC4A 4UEOA 4JX8A 3S2EA 3ZWWA 1R37A 2BHLA 3GFGA 4LVCA 3RD5A 2VUUA 1N9GA 5A3JA 5GZ3A 1U3VA 1VRWA 1QKIA 1UXIA 1V35A 1E7WA 2CDCA 2VUTA 1WZEA 3N58A 3MTJA 3NTRA 4FFOA 5G0UA 3H65A 3SVTA 1HWYA 1B26A 5JC1A 2PA3A 1CETA 3HFGA 2EXXA 5C7IO 3GVHA 1H6DA 1W8DA 3H9UA 1PGJA 4HFNA 2G17A 4R68A 1EVJA 3WX0A 2FN7A 4FGWA 4TVOA 5FI3A 4DGSA 4XZ3A 5KKCA 3LU1A 1JA9A 5JCJA 1GL3A 3C85A 3V2GA 2PD3A 2JD2A 2OP0A 3GVXA 4CUZA 3VPSA 2GDZA 1NVTA 1KVQA 2CFCA 2D8AA 2FWMX 2G82A 3DBHA 3PDJA 4H7PA 2HU2A 3IS3A 4OXYA 2J6IA 3WGIA 3C7CB 3OFSA 2W2LD 2GZ2A 3AU9A 4FFRA 1A4IA 3P2OA 5A4DA 1BDBA 4W6ZA 1UDCA 4WCFB 2XXJA 3Q9NA 4ND4A 3KZVA 1P44A 4IQ0A 2PWZA 4CLEA 4NBRA 3RASA 1E1KA 2WYVA 3P5SA 2YV2A 3X2FA 5L4SA 3TJRA 2O2YA 2RH8A 1Z7EA 3VVBA 1K6JA 1LLUA 2VZ0A 4QEDA 4XYEA 5AXDA 1UZMA 5IN4A 3QQPA 5BSHA 1EMDA 4NJOA 2Y1GA 1NAHA 4KUGA 3MTGA 4J9UE 1L7EA 4U0JA 4CM3A 1M75A 2DBVO 1JLLA 1P1KA 2DBQA 3B1JA 1UXHA 3ENNA 4BKQA 1E92A 2W2LA 4CR7A 2OBNA 4KZPA 2X0RA 4D42A 4AJ2A 2HQ1A 3QWFA 3E8XA 3V2HA 3JTMA 2TMGA 3ZNQA 4J7XA 2B4TO 4H3VA 4PLYA 3VDQA 3JD1A 3WDSA 3ANLA 1BXZA 3CUKA 2YW9A 4G65A 5KJ6A 4W9NA 3DZBA 3GMSA 1RKXA 1GPJA 3ZU4A 4E2XA 4FBGA 4R5HA 3BTUA 3FSRA 4XDZA 4IS3A 1ZZEA 4CM7A 4PG4A 4LGVA 3RJ9A 4TMFA 4EZBA 3A06A 4R4JA 1DAPA 1NQOA 2RHRA 3GZNB 4Y9DA 4E2ZA 3CZRA 1B3RA 4P22A 3PHLA 5MDHA 2NTJA 1ZK3A 3K8ZA 4W99A 2HJRA 5I8WA 3K2BA 1C3VA 4J4BA 5A04A 4WEQA 2P4HX 5A06A 4FC7A 1DDOA 1UZLA 3QWIA 3QVSA 2OOSA 2VHXA 2PTGA 1CERA 1N5DA 2R00A 1H6BA 3G3EA 8ADHA 4E6PA 4GWGA 3JD3A 3ZWCA 1NPTO 4BNIA 1MG0A 1I24A 3NGXA 3JQFC 3HDYA 1SC6A 1I3MA 1ONPA 1RYDA 3ANNA 1SEPA 4RCVA 5BQFA 4O0LA 1X14A 4EGFA 5KVSA 3AY7A 1D7OA 3VZRA 1LDEA 4J91A 4LW8A 4YQYA 4WCDA 5TJHA 1V6AA 2V6MA 1NAIA 3ORFA 3DBRA 4KDEA 4UVHA 5ENVA 5T8KA 4BNWA 2PZLA 4BVAA 1DHTA 4BQPA 3C7DB 3N74A 5EIOA 4I5GA 4QQRA 4YRBA 3PPIA 1XELA 3I83A 2AQIA 1ONNA 4CPDA 3NV9A 4XDYA 1SO8A 3FTPA 1H6AA 1DC5A 2O2SA 3FPCA 4FD3A 4R1UA 5DOVA 3VH1A 4CODB 3KYCB 3C7AA 3ON5A 5BSGA 5CFZA 3I6IA 1ISHA 2VYVD 3GR6A 2BELA 4ND2A 4D79A 1V3VA 2AW5A 4GLOA 3AUAA 3IUPA 4RPLA 5JDCC 3ZWPA 4GX2A 2ZIZA 4D46A 4CQLB 1A5ZA 2W2KA 1AHHA 4HP8A 3UW3A 3N7UA 1DAOA 2R6JA 3NUGA 2UV8A 1ADCA 1P1IA 1ZSVA 5I9MA 1KYQA 3AU8A 4KOAA 3L4BC 3L0DA 4LMPA 3FR7A 3K92A 3QHAA 1J5PA 1DC3A 1PGPA 1QP8A 1VL8A 4KWHA 1MLDA 2B69A 2EJVA 4WLOA 3RCBA 1E3IA 3W1VA 3RC9A 3BHIA 1NM5A 1T2CA 2Q50A 3RBVA 1DRWA 9LDTA 2GSDA 3FR8A 4BQRA 4AJNA 4DC1A 1UDBA 1JQBA 2X58A 3LYLA 2GN4A 1T2EA 4EW6A 1SOVA 3KRTA 1LDNA 1PTJA 2GZ1A 3NDIA 2VYVA 2DUUA 4XIYA 3HE3A 4ZVVA 4P8RA 5K6AC 3UUWA 3O38A 2EKQA 1P33A 2QG4A 2NADA 3VH4A 3BMCB 5IG2A 3HWRA 5L7TA 1YDWA 1VL0A 1CIVA 4JXKA 1HRDA 4Y98A 4BMNA 4F6LA 4YJFA 8LDHA 2FR8A 4MP3A 1C1DB 4NZ9A 3ZHXA 2PGLA 4AJ1A 1ZJZA 3WSVA 4U5QA 2P5YA 2Y1FA 4CMEA 4N5LA 3RU9A 4NQZA 3FNEA 2NQ8A 1SBYA 3GG9A 3NTQA 5TF4A 4WLNA 5CEJA 3C24A 5DZSA 5JSFA 1HDRA 3KBOA 1LC0A 3ONFA 3EY4A 3FTNA 4LK3A 3AM5A 5F5LA 2DBZA 4DLBA 1D1SA 4U0KA 2VNAA 2ZCUA 3QA9A 4P38A 1VSUA 4I8XA 4B79A 5CEEA 4ALMA 2FP4A 5KJFA 4BNXA 1E7QA 2B0JA 2VT3A 1C14A 3QWHA 4IUYA 5IDYA 4DRYA 4EEXA 3UKOA 4K9DA 2YFQA 3CE6A 2FR1A 4I9HA 3CEAA 3DTTA 3DZIA 3M6IA 1ZVMA 2Z1MA 3GT0A 2XXBA 3GEGA 4IBOA 4J9VA 4YDRA 2HAEA 1Z45A 3GN1A 2GASA 3OSUA 1QG6A 1GYRA 1KVRA 3PHGA 5KJEA 5CDYA 2NU8A 1F17A 1EQUA 4CL3A 3K73O 4MINA 2QZ9A 5KVCA 2O3UA 1D3AA 4D3FA 2H5LA 1CYDA 3U5TA 4E21A 4WLVA 1RPNA 2I76A 4OIMA 5L7WA 4OQYA 4B4OA 4ZA2A 1Y5RA 5A9RA 3L77A 2P9EA 3GPIA 1A4UA 1X7HA 3DBVO 1PGOA 3HB5X 3WICA 4YT8A 5ITVA 5KVVA 2WE7A 4OKNA 5DF1A 1FXSA 1Z73A 4ZRMA 1OAAA 3PGJA 4DQXA 4PGFA 4MKZA 3T7EA 4IDAA 5HRUA 3CH6A 4GGPA 3WYCA 3GLQA 4HNHA 3O9ZA 4HXYA 4J0FA 1H93A 2UYYA 2YHIB 2XF8A 2Z5LA 4J1TA 5BNFA 3CMMA 3MWEB 1SMKA 4J43A 2J8ZA 1CRWG 2VOEA 2YFHA 3E6AA 3JD0A 5I7VA 1ZK1A 2FZWA 3HNPA 2BH9A 1D8AA 3EVNA 4E12A 3OHSX 5C3MA 1ISJA 3MOGA 2F00A 3PJDA 1LLCA 5DOZA 1U3UA 4XR9A 4JN6B 1XEAA 2H6EA 5KKAA 1H2HA 5ICMA 1VLLA 1KC1A 2DFDA 2E82A 3EZLA 1LDMA 4KTTE 3VVCA 3OM9A 3PDUA 2HSDA 1J0XO 1BMDA 1MG5A 3EW7A 1L7DA 3RJ5A 1I5RA 4XD2A 2HDHA 3F5QA 5C7OO 1KIFA 2OXIA 4OJNA 4TVBA 4XQCA 5IDQA 3KLMX 3BMOB 4I9UA 2NNLD 1E3EA 4IIVA 3KEOA 4YRDA 4B7UA 1HSZA 5B4VA 4Z0PA 1O5IA 4M89A 3TZKA 2CZCA 3SLGA 4CLXA 3DBHB 1LQUA 4YVFA 1F12A 4KUEA 4LVUA 1U4SA 3WS7A 1K3TA 2JFHA 4J4HA 3CTMA 3KXDA 1BXKA 4B8ZA 4MOWA 3WQQA 2BI8A 4L9RA 4AJKA 3FBGA 3E5MA 3ZN2A 3NRCA 3UAGA 4HFJA 1PS8A 2H1SA 1GZ4A 3V1TC 3KSDO 3EZYA 4CMIA 5EL0A 5JE8A 1ISGA 4EUFA 1A72A 2VT2A 3MEQA 1QYVA 3ZNNA 2HK9A 2X5OA 2PR2A 4PRKA 1ZUD1 3D4OA 3GMDA 3AUSA 4BKRA 5IDXA 3I6QA 2ZJ1A 1OBFO 4BO1A 1V3TA 4Z3DA 4WNCA 1XG5A 5FI5A 1HL3A 2SCUA 1PJ4A 2B35A 3PWZA 4U8GA 4U6QA 5I9LA 3GPDG 4ZGWA 3F5SA 3JQBC 2A92A 3O26A 4WECA 5JDCA 1B7GO 5LCXA 1EEHA 2ZK7A 1C0PA 3UCEA 5I7SA 4XQEA 2AQHA 1P74A 1YOVA 2CF5A 2J5KA 1U9JA 1HLDA 5L45A 2VUSA 3PYXA 5MGBA 3PRJA 1NWHA 2D5AA 3QW2A 4R1SA 1LTHR 1SAYA 4E2YA 4U7WA 5KNLA 1IPEA 3MJCA 1IYZA 1XLTA 1VJ1A 3UF0A 2AEFA 1O9BA 2GNAA 3AWDA 1NR1A 2JFFA 2DKNA 3WBFA 3PK0A 1E3WB 4EJ0A 2J3IA 5A3VA 1B2LA 1MGOA 1B8UA 3JQ6A 4DL9A 3KYCA 4A73A 2FZEA 2AQKA 4LMRA 1FMCA 4IDFA 3I5MA 4BB5A 3ETEA 3ONDA 6ADHA 2FRDA 2RAFA 3WQSB 4CQLA 1NP3A 1VI2A 4YRAA 3K96A 1PJ3A 4H15A 4PG5A 2CVQA 4DWVA 4EJMA 1JVSA 2HKIA 2UDPA 1XSEA 4F3YA 1MP0A 2ZKLA 1R6DA 1ZK4A 5F21A 3UN1A 1VKOA 2ZYAA 1U5CA 4F45A 2WMDA 1UXGA 2DBRA 3AY3A 3ZNPA 5JLAA 1R0LA 3GDOA 3TWOA 4QT0A 3PEFA 5AYVA 2HRZA 5FYDA 5DBFA 4Z9FA 5TX7A 3AM4A 1MA0A 3PHHA 3OIDA 1DPGA 1MV8A 4CM9D 2P9GA 3HUDA 1J6UA 1AN9A 3M2TA 3JQEA 3DAFA 2NLOA 1PL6A 4XIJA 1UUFA 2Q49A 2PZKA 2EP5A 3TF5A 3WMXA 3GRPA 2Y66A 2RCYA 4MP8A 3A4VA 2O7QA 3BMCA 4MVJE 1Y8RA 4EI2A 2WE8A 2NU9A 3G79A 4R3NA 4RO0A 1LRKA 5LDGA 4A26A 2IRWA 4FW8A 5KCZA 1HYGA 1PJBA 1QV6A 4YWJA 2FPGA 5KJCA 2G5CA 3FF4A 5BNTA 4Z9XA 4WPGA 2W2KB 1PR9A 3JV7A 2AQ8A 2Q2WA 1H2BA 2YY7A 4HV4A 4XJSA 1PJTA 4LCJA 5T6BA 3ZZNA 1Z74A 2YDXA 1SEVA 5GMOA 3RUCA 2V6GA 1BVUA 1H0KA 3ZHYA 2UUOA 3HQ4O 4CM9A 2YV3A 5F1OA 3B70A 1A9ZA 1OOEA 3ZNOA 1JWBB 3GDGA 2DM6A 4IINA 5IJZA 4MKRA 5DDIP 5LDHA 4RDIA 4WLFA 1YXMA 1E1MA 2GERA 3ZGYA 4XR4A 1I8TA 3H5RA 3ZV3A 4JJGA 4XGNA 1PGQA 3JQ8A 1GV1A 1N7HA 5C5IA 3AJRA 1PWZA 2EKPA 4GKBA 4XQ9A 4R5MA 5BT9A 4Y8VA 1QSGA 4AJOA 4OSOA 3GAFA 3FN4A 1HDYA 2C07A 2VN8A 4PLWA 3JQ9C 4CJXA 3CMCO 1R15A 3DWFA 2DU8A 4JIGA 9LDBA 3NJ8A 5CG2A 2IEBA 1IUKA 2X9NA 3HADA 4O5OA 4Q3DA 1ZFNA 5G4KA 4B3JA 1PZGA 1WW8A 2P9CA 1K6XA 4YJFB 1O95A 5A02A 1JTVA 3MJVA 4XCVA 1FDVA 4RV9A 1ZXBA 1KERA 4N5MA 5IXSA 2BI7A 1HSOA 4BO9A 4E32A 5L7YA 5JY6A 4NBVA 1P1FA 3FNFA 2P68A 1JU9A 1O8CA 4G81A 3T4EA 1ZK2A 3PHIA 2Q2VA 4LRTB 1C1XA 3W4KA 3H8VA 3VZSA 3HHPA 4Q9NA 4TZKA 2C2YA 1QYXA 4NU6A 1WMBA 3ADOA 3H3JA 5JMPA 3PJFA 2Y1CA 3EGOA 1U3WA 2OMEA 1LC3A 3HB4X 5JCXA 4OOEA 4EDFA 1UP6A 2A9FA 4R69A 3DL2A 2NU7A 4FFMA 4NDNE 3PQFA 4DPLA 5H83A 3ZCXA 3H9JA 3WYBA 3WG9A 5IZCA 3OQ6A 3RBXA 1X7GA 2EGGA 3Q2IA 1RM5A 4IIUA 3GEMA 3H6KA 3D4PA 3BMQA 2VHZA 2OL4A 4L4RA 4WJZA 2I3GA 1IOLA 1PIWA 2ZQYA 4MVJM 4K26A 3LF1A 2PV7A 1G6KA 1DLIA 1SNYA 3KLPX 3S2IA 2IXAA 4MIYA 1B3BA 2GR9A 1AGNA 2GN9A 2YHUA 5ER9A 1UP7A 3AOEC 3ROKA 1EE2A 4BNYA 3IQDB 4JJIA 5A03A 4B4VA 1RWBA 1Z7BA 1H9BA 3WGOA 1W6UA 2Y1EA 2IDZA 3OMLA 4L76A 1GUYA 3UOGA 4XRGA 1RJWA 1UDAA 3BMOA 3KO8A 1YONA 4Q39A 3DOCA 4PLFA 1LRLA 3DR3A 2QYTA 5A5EA 2D1YA 1EK5A 3JQBA 3GHHA 1OC2A 1XDWA 1VJ0A 3OIFA 4XQGA 4BOYA 1Q0LA 3FPLA 3NGLA 4L75A 1YJQA 2WSBA 3DZFA 5TIIA 5KIAA 1ZIDA 1YS4A 2VQ3A 1NBOA 4GSLA 4K28A 1A9YA 1E1LA 2PKRA 1WP4A 2V7PA 4XB1A 4UUMA 5HS6A 1G0OA 3RQSA 2EW8A 3PGXA 4DYVA 1GR0A 5DP2A 6LDHA 5EERA 3W6UA 1WDKA 4BO4A 1Z82A 2ZATA 3GUYA 4GSKA 5DCUA 4MVJF 1QRRA 3TRIA 1FK8A 4R54A 4ZHSA 3GUCA 3QWAA 4EITA 3R1IA 2VCYA 3GGPA 4JBHA 3S2GA 3W6ZA 4II2A 4NK4A 3OA2A 3QVXA 4RZHA 1DFGA 3ST7A 3PXXA 2ZJ0A 5COBA 4ID9A 3CKYA 4YJHA 5CHEA 1YBMA 3RUFA 4PLCA 3ZWBA 1XCBA 4BO0A 3UCFA 2WD7A 2OUIA 3EK2A 3SJUA 4M87A 1F0YA 3T4XA 4BO8A 4R01A 5I7EA 1GYQA 1ISIA 2AEMA 2Q3EA 1E6EA 3RVDA 4DMMA 3AUTA 2WTBA 1IZ9A 4QO7A 3UICA 3OJLA 4RPHA 4CM6A 3FWZA 1HE2A 2GF2A 4IJVA 5EINA 3VTZA 4E3ZA 4F6CA 3K5PA 2PNFA 3PJGA 2C5EA 3R3SA 4G2NA 1NFFA 1DJQA 1I30A 1VM6A 3AFNA 3LSYA 3E9MA 3B6ZA 4TSKA 4ZQHA 2IE0A 3OIGA 2VZ8A 1B15A 4ALKA 1E3WA 2Y1OA 4GL4A 4CMIB 5AXBA 1M67A 3A9WA 2WEKA 1LSOA 5ILGA 4FIZA 4LSWA 4OM8A 5DN9A 2GPTA 1OI7A 4LRSB 3JD4A 4QTZA 3L4SO 2O4CA 3QWBA 4IJWA 4BGVA 2QRJA 4RPKA 2I67A 3JQGA 3LLSA 1ARZA 3U62A 3H2ZA 3JCZA 1PJ2A 5G4LA 3FCOA 3ETDA 3VOSA 4AJEA 3RAJA 4DLAA 3IAHA 1PS0A 1XYGA 2PK3A 3Q11A 4IS2A 1DBVO 2NVBA 4DREA 2UAGA 4JNKA 1YOVB 3EHEA 4YTEA 2Y0EA 4CQMD 3MZ0A 3PLNA 2J3HA 1DXYA 1I32A 1PL7A 2I65A 3C8MA 3RFTA 4UVEA 5G0SA 4FCCA 2HMVA 5KVQA 2I66A 4ZD6A 1O94A 4B7CA 5TT0A 1QORA 2C0CA 2QW8A 3V5NA 3I4FA 4ALIA 2IZ0A 5TS3A 3E5RA 1GU7A 3FWNA 3PWKA 1XKQA 3BYZA 4FGSA 3VPXA 1GV0A 1PU2A 2IYOA 1LUAA 2YV1A 2VRCD 3RWBA 4XGKA 2VTEA 2WJPA 1WVGA 3R0IA 3WMWA 1K89A 4ND5A 4Y6SA 2J3KA 5HA5A 3PHJA 4D3SA 2Q1SA 1BGVA 3F47A 2O3SA 4YJGA 4NNJA 1S7CA 3GDFA 4D3DA 3JQ9A 5L95A 4BNJA 3LC1O 4PVCA 3WIEA 2I3AA 2J5RA 3JYOA 4BGEA 3INTA 1PZHA 1EQ2A 4KQXA 4S3MA 5H81A 3K6JA 4BNLA 1ZBQA 3WNVA 2Y05A 3W4JA 2JCVA 3R6DA 4RDHA 4RLHA 4XYBA 4NG5A 5G0WA 1IE3A 3GRKA 3SBOA 4BNZA 3RIHA 3FRJA 3ZW9A 2DUWA 4E4YA 1ZCJA 4IZIA 5CDSA 2VRCA 5A9SA 2B5VA 3CSDA 1YBAA 2HUNA 2AMFA 5HS4A 1ONOA 4XYGA 4R1NA 1ENPA 5L4NA 2C59A 3ZWYA 1GADO 3KTDA 4YA6A 5EQDA 4YT4A 3V8BA 1T2DA 2CF6A 2C7VA 2ILTA 3JYQA 1FF9A 3IMFA 3DQPA 3TSCA 3LT4A 3ZDFA 4BNFA 4DIOA 1EDOA 2VTDA 4MIOA 4AL4A 4MVJG 1YKFA 4CMBA 1XHLA 4DIBA 3L6DA 1Z6ZA 3ZU3A 2HK8A 1Y8RB 5FWNA 1BWSA 4R3WA 3WSWA 2BFAA 5B4UA 4RF4A 4CM1A 5TJ9A 4BHTA 1R0KA 4J7UA 3IP3A 1F14A 1Y7TA 1IHXA 1K0UA 4NBTA 4RF3A 1HZZA 3K30A 4ZQFA 3WLFA 1GCOA 1Q7BA 4Y6PA 1P1HA 3SEFA 1EBUA 3KYBA 4RQTA 2CUKA 5EPOA 3C3XA 1QLJA 3DZJA 3HJAA 1E7MA 4AJPA 1E3SA 3GA0A 5L53A 4Q3EA 2PFGA 1GD1O 1LNQA 3G1TA 4WOKA 4FS3A 2HMUA 1RM0A 3QVTA 4IJUA 4P4LA 2CNBA 2OHXA 1PS9A 2NSDA 3AK4A 3AOEA 1YL5A 2BGLA 4FOOA 4IGFA 1BW9A 1M2WA 1O0SA 4D0RA 1P1RA 2I99A 2YJZA 5CAEA 4D44A 2GN8A 3DAGA 3P2YA 4OXKA 5FFFA 5L51A 3DB2A 1EBFA 2QZZA 1ZK0A 2H9IA 2GRAA 2EJWA 2BGMA 3JQ8B 4BNNA 1DOHA 1ULUA 5CPBA 4NFHA 4ZQGA 4ESOA 4HWKA 1SB9A 4PVDA 1U28A 3NT4A 3TN7A 1DIGA 1DRVA 3S55A 3TZQA 3SXPA 1P1JA 7MDHA 4WOJA 1IHYA 3JQ7A 5IN5A 5F1PA 5G4KB 3FD8A 4I9NA 5AVOA 3WGHA 4E31A 1JAXA 2Q99A 1S6YA 3AI3A 3H4VA 3LC2O 1Q1NA 2RH4A 3Q6IA 4RORA 3BAZA 5A9TA 1UR5A 4XJTA 2GO1A 1GQYA 1PZEA 1ZNQO 4PN3A 5IF3A 3IIEA 1N1EA 3GH3A 4BKPA 1X13A 1GZ3A 3DAPA 2PD4A 4GX1A 4GKVA 3WBBA 4YEDA 1C1XB 4A27A 4UUPA 3W8DA 2G0TA 4J6FA 4ONEA 1PZFA 4E0BA 3FHLA 4YAKA 3W8EA 5ICSA 4AVYA 3O03A 5CP8A 4YT2A 5BSFA 3IC5A 1GFSA 1E3JA 2ZYDA 3H5NA 1F06A 3DOOA 1JKIA 2E49A 1A71A 3GG2A 2HO5A 1DRUA 2P2SA 1YBVA 1P0CA 4NK5A 4A5OA 1SPXA 1ZSYA 3S2FA 3BMQB 3ASUA 1XQ1A 5EQFA 4CV0A 1TT5A 2IYPA 1DHRA 1EE9A 2VRBA 4ALNA 4FB5A 5I9NA 2QYSA 2JD0A 1XWFA 2QQ5A 1N7GA 3DHNA 1OMOA 4FDAA 4RZIA 5AXCA 1HDOA 2AEJA 1PJLA 5A05A 3W4IA 3KYDA 1HDXA 2VOJA 3KSUA 4E5MA 5JAMA 1BHSA 4FJ2A 5JAQA 5COAA 2BFPA 2WM3A 4OAQA 2RBEA 2J3JA 1Z75A 2PGJA 2JL1A 4HY3A 3VKVA 3GY0A 4XYLA 1U4OA 4YXFA 1X15A 1BDMA 2CDBA 4YB8A 3IKVA 3EAGA 2NVUA 2DPHA 4I1IA 3JQFA 4B3HA 1HEUA 4K6FA 4R41A 4TRJA 4P4GA 4S1VA 3ZI0A 3F4LA 3HFSA 4EUEA 2D0IA 5IXYA 3A28A 3AM3A 1U7HA 1Y8QA 2BFOA 1P31A 2O3QA 3ZHZA 2PLAA 2BFMA 4J1NA 4ZRNA 3NDJA 5JS6A 1MFPA 2BKAA 5JW6A 1HLPA 3AY6A 3P7MA 1NTOA 4HUJA 1LSSA 2EKLA 3I9MA 4JBGA 4L0QA 4DQUA 1TI7A 3STHA 1M76A 2ZTUA 5B4TA 4R51A 2Z95A 1IL0A 2WWRA 4J4TA 5JFOA 2O3JA 3GF4A 4JP2A 1AHIA 2YQ5A 3F1KA 4IQGA 5DBIA 4R1TA 5TQVA 3DBLA 1K5HA 3PVZA 2WYUA 4YJHB 2OFPA 4J2OA 4EYEA 2WD7B 1LBEA 2FPPA 4MKXA 1QLHA 5G2OA 3RUDA 2EG9A 4BO6A 3PWSA 1H6CA 1JAYA 4ND1A 3RUEA 4CLRB 3I1JA 1F8FA 4TRMA 2P5UA 4XRRA 1Y5MA 4DUPA 1MC4A 2VZ9A 2PKQO 3OEWA 3WQRA 4E5NA 1ENZA 3L4BA 1YB1A 4QXMA 3VDRA 5G0VA 3IJRA 1YRLA 3F46A 1HE4A 4URFA 3OJFA 1HDZA 1CF2O 3M1AA 2JHGA 2J5QA 2POQX 3RUAA 1MB4A 1VJTA 2NVWA 3AFMA 3PZBA 1L1FA 1GQ2A 4IDBA 4CMHA 4A7PA 3VKUA 3F3SA 3DFZA 3DMTC 3CPSA 5K6AA 4WK6A 1GUFA 3D1LA 1PQPA 2LDXA 4GX0A 5ES3A 2HRBA 3I9KA 1XQ6A 2WD8A 1AE1A 3IP1A 1N1GA 1KEPA 1ZEMA 2A94A 3JQGB 2I6TA 3GVIA 3HDQA 2GZ3A 5AQ1A 1Q0HA 4YACA 4WE3A 5COQA 3I3OA 3VH3A 2ZB4A 4YAJA 4C7JA 1KEWA 4AJ4A 2OZPA 1P9LA 2G76A 3BMNA 3NYWA 1GCUA 5T64A 1TXGA 2E4AA 3VZPA 1ZW1A 1MXFA 4NFYA 2NWQA 1EVYA 1JVBA 2QX7A 3DZHA 1HYHA 4M54A 3H5AA 5GZ1A 5EJ2A 4JP3A 2B36A 5BR7A 3IUSA 4LCEA 1HTBA 4OH1A 3RFVA 1KBZA 3RBZA 1E3LA 1DFHA 1A27A 4X54A 1NWCA 4WNIA 5CDGA 2AXQA 3GVPA 3TFOA 3NKLA 4GPD1 4KUHA 4RVGA 4RPGA 3LDHA 4O63O 4ZQEA 3X2EA 3JQAD 2F1KA 4BNHA 3LT1A 1YH3A 1KVUA 4YJGB 2ZYGA 1U3TA 3I9OA 4DMLA 1AXGA 1YVEI 2JCYA 4CMGA 4D43A 2BRUA 4M1QA 4N54A 2G1UA 4CQMB 3IL2A 1R12A 4EUHA 4INAA 2X1HA 4PRLA 3TZCA 4C4OA 3ZU2A 2GYYA 1KVTA 2D3TA 1N8KA 4B7XA 4TRRA 3OH8A 2PY6A 4FFLA 3JYNA 1YQXA 4D0SA 1BXGA 4K1LA 3A1NA 3CXRA 4BNKA 3E18A 2VNSA 1B16A 1XU9A 4L73A 4MO2A 2ET6A 1J4AA 5TGDA 5A9SB 1PJSA 2PD6A 1A7AA 1LLDA 1KEUA 2WYWA 3BTSA 3JD2A 5IFLA 2CVZA 3JQAA 4MDHA 1TEHA 2EHDA 1R4NA 3RFXA 5C7LO 4Q3NA 5T8KC 1MX3A 1YJ8A 4GVXA 3TZ6A 1XU7A 5A1TA 1LDBA 4RVSA 3ROQA 4N7RA 2PZJA 3C1OA 2CMDA 2FY8A 3PZRA 1WPQA 1X7DA 2CD9A 3MJSA 2UUPA 2YZ7A 3QIVA 4AJLA 3LT0A 4UAGA 3KB6A 1DIAA 3HDJA 1V8BA 4IDEA 1HT0A 1WMAA 4E2WA 1LLQA 3VTFA 4RPJA 1BG6A 1D1TA 1WDMA 3K31A 4BNVA 4KDFA 1B8PA 1UP4A 2X4GA 3GAZA 3ADPA 4FJ0A 4RL6A 4KWIA 4QUKA 1EK6A 1NVMB 3AW9A 1WAMA 2C20A 3U4DA 3K9QO 4M86A 5THKA 4CLHA 1QYWA 4L8VA 5ILOA 2X0JA 1HE5A 4DPKA 1BW9B 2ZB8A 5TRTA 3WR5A 3SJ7A 3R3JA 5C37A 1I2BA 1Q2XA 1A7KA 3ZWXA 1YL6A 1T1RA 4HKTA 2HLPA 1NFQA 1Q0QA 2JD1A 3ULKA 4XEHA 4A03A 4YR9A 1WXDA 2TMDA 3VPGA 4UVGA 1BSVA 2EERA 1DIBA 2QRKA 5TLSA 4CM5A 4GAEA 2Y67A 3E48A 3I52A 1KOLA 1VL6A 2X86A 1D4FA 2R2GA 2FOIA 2GUGA 1KS9A 4W7HA 1UJMA 5HTOA 3I4CA 2PH5A 1ORRA 2OGUA 1DO8A 1RYEA 2Q1WA 4NBUA 4U6SA 3BHMA 3JQ7B 5T67A 4DBVO 3VPHA 5K0ZA 2WDZA 3COSA 2JFGA 3DDNA 1UAGA 4GMGA 3WIDA 2BMAA 1GPDG 1KC3A 2IODA 3AOGA 4YQZA 4BO3A 4BV9A 4D7AA 3IKTA 3JYPA 5JCJD 2IZZA 5F1KA 4FN4A 3VH2A 1X1EA 2HMWA 2NUAA 4DLLA 1I3KA 2X9VA 3WFJA 3LT2A 3EMKA 3E9NA 1CQJA 3SX2A 1J49A 5JDIC 1ZXLA 1U8XX 4CMEC 2O4UX 2NQTA 3PYLA 3D0OA 3GQVA 1HETA 4R9RA 1I2ZA 3OJEA 4FQ8A 2VHVA 1YGYA 3GZ4A 3HG7A 4BKOA 3GVCA 2XAAA 1UXKA 2GD1O 3WGGA 3KSZO 1T26A 1V3UA 5HWSA 1EVZA 1YO6A 2A35A 3KETA 3RI3A 5DNAA 2OBYA 3FNHA 3GGOA 3P19A 2V65A 4KMSA 3ICPA 4DVJA 3CINA 4OQZA 4Z9YA 4TZTA 4GLLA 3SC6A 4L74A 3V1YA 2A4KA 4OMUA 1VPDA 1TVEA 1ID1A 1DC6A 2Y68A 3BIOA 4UEJA 2X8LA 4CM8B 1NHWA 1TT5B 1WZIA 4NI5A 4PZEA 4Q3AA 5KWEA 4RF5A 3VZQA 2D5CA 4ROSA 2D2IA 3DOJA 7ADHA 1DFIA 2PGDA 1I3LA 5FF9A 2B83A 3U3XA 1FDUA 1I33A 3E9QA 2X7HA 4HX5A 1R66A 4NHEA 4WLEA 3ZWOA 4A0SA 5JNLA 4UVIA 2H63A 2E37A 4WEOA 3QP9A 2FMUA 1B0AA 1Y9AA 3G49A 3DMTA 3KYDB 4BV8A 4TQGA 4CLOA 3C1TA 3F1LA 2DQ4A 1V0JA 1JW9B 4GWKA 2AG8A 1XR3A 2Y99A 1V9LA 4CLRA 3INRA 4AICA 2PZMA 1NX6A 4XWYA 4PG6A 3NX4A 3WJ7A 1JDJA 1C0IA 1P0FA 1HXHA 3ENKA 3RUIA 1MUUA 1M66A 4DYDA 2XPCA 4RJTA 5J23A 3L07A 5JAZA 1GEEA 2HCTA 4CV2A 3UGKA 4NH4A 1PEDA 2NVUB 5JMWA 2W4QA 3LZ6A 3CZMA 3VPFA 2W98A 1E5LA 5JYDA 4BB6A 4NU5A 2ZTMA 1E1NA 2Y93A 4QECA 1ISFA 1VE9A 4MVJD 4K6CA 3I9JA 3QY9A 3WGYA 2O23A 4MVJH 2C7GA 1BVRA 2OO5A 2OORA 5B12A 1GZ6A 1Y8QB 3OF2A 5KOIA 3U09A 4DQVA 3O8QA 3I23A 3QE3A 4PLTA 4GGOA 2NU6A 4WCFC 2FSSA 4L4XA 1ZKMA 2DLDA 3OQBA 5T5QA 3GK3A 1LSJA 4ITUA 1YL7A 3BTOA 1YWGO 3S8MA 3E1KA 2CSUA 2FSVA 2OP1A 1H94A 2DPGA 5I8ZA 4E5PA 1W0CA 3GFBA 3RKUA 4AFNA 3MJTA 4Q3BA 3PQDA 1T1SA 3ROMA 3DBLB 5EN4A 4ZU3A 1DSSG 3G17A 5HM8A 3PIDA 5CG1A 3GNSA 4PZCA 2X5JO 3ICCA 5TSDA 4MVJA 2GCGA 5IAAA 1C0KA 3U49A 1DEHA 1EDZA 1X0XA 4NJMA 4ZQBA 4UULA 4Z6KA 4DXHA 3TOZA 3L9XA 3NDRA 3RUHA 1QR6A 4WASA 2EIHA 3VC7A 2DAPA 3ANMA 3L9WA 3O4RA 3KEQA 3Q2KA 3LVFO 4P4NA 4ILKA 4RVHA 5JPIA 5EMHA 3NAQA 3VAZA 1RM4A 4E5YA 4IQ8A 1I01A 3Q0EA 5BNIA 2BF7A 4BS9A 3BHJA 2BGKA 1NHGA 2NM0A 5GY7A 3Q1LA 3GNTA 2D4AA 3WLEA 4AG3A 3DHYA 4GQAA 1OZAA 4KP7A 3U0BA 1GY8A 2DFVA 5L40A 4CMJA 2NTVA 1EFLA 1ZMTA 3TOXA 2BLLA 3D5QA 3D3WA 1FDTA 1Y81A 1H5QA 1GTMA 1KY5A 4IDGA 4I08A 3I9LA 4J3FA 4CQMA 3TL3A 1G1AA 4BO2A 3ETGA 4I5EA 1KETA 4ZN6A 1TA4A 1M6HA 4IM7A 3DTYA 4O59O 2B4QA 4MIEA 3UCXA 1IULA 1O6ZA 1E6WA 3LC7O 1YQDA 2DTXA 2Q46A 4YPOA 4CM4B 3BMNB 4CV3A 4IGEA 1NVGA 4R9SA 1IB6A 4UREA 1E5QA 4GBJA 3UFXA 1E7YA 3U4IA 4PIVA 2O3TA 3D5TA 4FPXA 1UH5A 1Q7CA 3D7LA 3NT2A 3ZW8A 1DC4A 1NQTA 1N2SA 5F5NA 4BIIA 2VHYA 1B14A 3M2PA 3S1LA 3NTOA 3JQDA 4AJJA 1JKFA 1R0SA 5JAIA 2X9GA 1RM3A 4II3A 1IY8A 4JROA 3UVEA 1U8FO 3TDKA 4A10A 5JBIA 1MFZA 4JJFA 2EV9A 3NJ4A 3GHYA 2FHSA 3I9NA 1KVSA 4IY1A 1TT7A 2LDBA 1P77A 4GVLA 1HDGO 2X6TA 3WTBA 3HZZA 4YAGA 1E7SA 1AXEA 4FFPA 1EVIA 3QLJA 4GMFA 1R4MA 4YCAA 1H9AA 1QXSA 5ADHA 5CDUA 2VWQA 1E6UA 2DC1A 3DONA 3RSHA 4BNTA 5K9ZA 4FSHA 3KUXA 3ZH2A 4DA9A 4ZICA 4CUKA 1FJHA 1T2FA 3H9GA 2VWGA 4Y67A 4MVJI 2FPIA 3WWYA 5JO9A 3NEPX 4HBGA 1ISMA 1BXGB 2HMTA 1U2DA 1SZJG 5GZ6A 2Z1NA 4GH5A 5BSEA 3QVOA 3MJ4A 4PLVA 5CPFA 3DZGA 1Y1PA 4IZHA 3IDSA 4JGBA 4MPDA 3EYWA 2ZCVA 2ZTLA 1XIVA 3WJAA 5JDIA 1AUPA 3D3EA 1LRJA 3JQAB 1QYDA 5U1PA 3LLVA 2RHCA 1R4NB 3PFWO 3E03A 4HFMA 4LSMA 2ZTVA 3OA0A 1E77A 2O50A 3DMYA 3PYMA 2Q45A 1I36A 1B8VA 1NR7A 5ENDA 2B5WA 1LQTA 5AOVA 3H9EO 4RQUA 2IEDA 1U1IA 4NMHA 1ZSNA 4PZDA 4ZJUA 5B1YA 2PH3A 1JKJA 3D4NA 3CIFA 3TL2A 2YQ4A 2C29D 2JHFA 3AUUA 4BGUA 4C7KA 3U9LA 3WB9A 2X5KO 1CWUA 4J1SA 4HFRA 2HK7A 3RU7A 3OQ1A 3B20A 4WKGA 3WFIA 4WGGA 3G0OA 3GN2A 5IDWA 2VYND 1LX6A 4NBWA 1IPFA 1LDGA 1UAYA 2QRLA 4HNGA 4RLSA 1U2GA 1GQQA 1PWXA 3DHEA 1DB3A 3G1UA 2CDAA 2ZB7A 1T24A 4FOSA 4DBZA 3F4BA 4UUNA 2YYYA 1BTOA 4OGWA 4J2HA 4YJDA 4OYRA 4TROA 2W8ZA 1PR3A 4LN1A 3PFFA 1ZJYA 4XYMA 3AI1A 1MC5A 4FR5A 3ZHBA 2VWHA 2E6UX 3H9QA 3K2EA 3DFUA 3TNLA 5FEUA 5ITWA 2FR0A 1PSDA 2Q1UA 4MVJP 4BKUA 1Q7GA 2ZQZA 1EUCA 3OJ0A 4EBFA 3QVWA 1U7TA 3Q9UA 1VKNA 5AXAA 3EC7A 1LSUA 2DTDA 3EUWA 4TKMA 4QO8A 4PLZA 1FDSA 2XOXA 3JYLA 2VYNA 3MOIA 5JC8A 4Y6RA 3OJOA 1K2WA 3PJEA 2HMSA 4CM8A 4ALJA 4KTVE 3OICA 4OO3A 3TPCA 4F46A 5CDTA 4M49A 1CDOA 2P4QA 2X0IA 1R16A 1E7RA 4BNMA 1CQIA 1EZ4A 1T4DA 3ASVA 3H7AA 3MJEA 4WUVA 4BL5A 4CR6A 1VSVA 5CEFA 4WCFA 3ZV5A 2C54A 3D64A 2JAHA 4N18A 3PQEA 4I5FA 4OL9A 2C2XA 2GGSA 4BNUA 2DTEA 3RC2A 1IZ0A 4IDDA 2AHRA 2IZ1A 4NFSA 3ITKA 1PX0A 1N9GB 3PIIA 4CLDA 2BD0A 2CY0A 2EEZA 3ABIA 3F9IA 3H2SA 2HJSA 1YB4A 1I0ZA 4HADA 3LK7A 2D59A 1T4BA 1ZEJA 2I5PO 1GEGA 1PQUA 3KV3O 4E13A 5U4QA 1JWAB 4O6VA 2JCXA 3DEYX 3C1AA 4LISA 4PFJA 4IMPA 3EVTA 5LC1A 1W4ZA 1WDLA 1ENOA 3ZV4A 1LXCA 4YBZA 3WGQA 4CR8A 1TB4A 2V6FA 2RIRA 4MJLA 3SC4A 5EESA 3UXYA 5IZCC 1GYPA 1ADBA 4E5KA 3RC1A 2Q4BA 5KJ1A 2Y1DA 5I7FA 1NASA 1T25A 2I9PA 1NQAO 3FBTA 4XX0A 1OC4A 1DLJA 1I10A 4PG8A 5L9AA 1GAEO 2YDYA 4FJ1A 4D45A 4CMAA 1LDYA 1WNTA 3PTZA 4XA8A 3NT5A 3GZNA 4GI2A 3EDMA 1G0NA 1XGKA 4NR0A 4CLOB 3IOYA 4E30A 4RVFA 3KM0A 1JN0A 4B4UA 2Y0DA 4EJ6A 3UHAA 1ULSA 3ITDA 2GN6A 4YT5A 5G0TA 4IXTA 1O89A 1YE3A 4FC6A 5HBRA 3RKRA 5A5FA 1LA2A 2Q1TA 2O48X 4KQWA 5KTKA 3VHRA 1LEHA 4D41A 4WLUA 3BTVA 5TT1A 2UVDA 3ZWAA 4M8SA 2B4RO 4RVDA 4FFNA 1MXHA 2NTNA 4JBIA 3HN2A 4XB2A 3O8QB 4OOFA 1NFRA 5U9CA 1ZO8A 2QIOA 4Z0HO 3OECA 4JQCA 3ZWNA 4CUJA 2X23A 4BO7A 4OSPA 4W7IA 3DC2A 1GDHA 1PQWA 3WOHA 5JXWA 3F6YA 1E0DA 4QSMA 4DPMA 1ZMOA 1QMGA 3LQFA 4W4TA 3DO5A 3U4CA 1Y9EA 1HE3A 2IXBA 4CMCA 4CL8A 4IMRA 4YAEA 3FI9A 4NPCA 4JLWA 1WLYA 3M1LA 3OETA 1LJ8A 1UXJA 4W82A 3UH1A 3IJPA 4NJMB 3GNQA 4B4WA 3PLRA 4CM4A 1EUZA 2X22A 4DTIA 3WXBA 3WYEA 4CMKA 4DC0A 3T7CA 4I5DA 3U4HA 4J16A 2YUTA 1PGNA 3HDHA 3QV1A 5DP1A 2AE2A 1VC2A 4ALLA 4L4SA 4RF2A 2EF1A 1NYTA 2VHWA 2VWPA 1DJNA 2O7SA 3A14A 4TRNA 1EUDA 3WGZA 2C5AA 3PI7A 4UEKA 4W9NC 4J0EA 4E33A 4YAIA 4A2CA 4BNGA 3ZU5A 1HDCA 4YYZA 1SB8A 4NIMA 5TNXA 3V2UA 4O1MA 1QYCA 4PLPA 4UVDA 3ZWVA 1DIHA 3HN7A 2DT5A 4QFDA 3MWDB 4PG7A 3PP8A 2EGHA 1UZNA 4RGBA 3DBRB 4B3IA 1SCUA 3TFQA 2NV6A 3RC7A 4B8WA 1X0VA 4AJHA 2JAPA 4BMSA 1N92A 3D3WB 3LF2A 1ADFA 3SLKA 5B37A 1Y6JA 3QSGA 1ML3A 4Z3KA 2JJYA 3V1UA 2O3RA 1OFGA 3OP4A 2R00C 1SOWA 1NPDA 4XKJA 4J1QA 2EW2A
chains in the Genus database with same CATH superfamily
1AQNA 4J90A 4PLGA 1RNLA 5EVCA 3KOUA 1KA9H 4S1NA 4HXGA 4OXNA 5AK3A 5JNUA 3VZBA 1ZM7A 3O6VA 1CUVA 1IMJA 1VLJA 2FG7C 1X1TA 2FG5A 3CWCA 1BC5A 3NVMB 3AMVA 4Y18A 1G7SA 4EX6A 1U99A 3BK1A 3CR3C 1SHZA 3DEHA 3KKQA 5G3YA 3FCAA 4RCYA 4RVUA 3RIXA 3I53A 3OE5A 3GEDA 4A16A 2AWOA 5EJGA 3EPPA 3FGZA 4XGIA 2C82A 3HSSA 3L0ZA 4JMPA 4JI6B 3ETNA 4NESA 4IXWA 2OLJA 4ZAWA 5C4GB 5BUCA 4HR7A 1XCGB 2YZKA 3OQHA 1QUFA 4G97A 1HZJA 2GFHA 1KI6A 5B53A 2O8CB 2H06A 3LQYA 3QU7A 1AX9A 1FZTA 3L7BA 1TM7E 1EXVA 1W0KA 4CQNA 1PJCA 4LRYA 4UUOA 1MRNA 2EP7A 3HKEB 3Q3CA 1LTQA 2QL5A 2V6BA 3PPVA 1P45A 3FY4A 1SQSA 2I80A 4QDXA 3O84A 4FOTA 5K4GA 3CQ9A 1C0LA 1SIBE 4DAEA 1I3NA 2JIZD 3H1GA 2AG5A 4LTDA 5T57A 2IHNA 1LFDB 5IZ4A 1H0HA 3AVVA 2Y2UA 3D7SA 3DUFB 5HIKA 1YQGA 1AK9A 3E22B 5L4LA 3CX7A 5LMCA 1KY4A 5H16A 3T9DA 1E96A 1G41A 1KI1A 1JMYA 1W73A 1OLXB 2XYGA 3HSKA 2NACA 4W8OA 2XRMA 3OM1A 1C9KA 2PKWA 4FBMA 1N6NA 5CYFA 3UAYA 4PLHA 3QPAA 4C2BA 2XMRA 2HXGA 3RIMA 3ZWMA 1JHYA 5CLGA 2O5VA 3H3FA 2D54A 2J4DA 3N7AA 4BKMA 2W90A 4EG6A 2Y8EA 2Q4EA 5L3SB 3TW4A 1QFSA 3U17A 2CL6X 2JKVA 1GZUA 3P2IA 3THXA 1GPWB 1KAOA 2R86A 4OKIA 1QK5A 1YZYA 1EDEA 2QTZA 4GPZA 3ZXYA 1GRRA 2YS6A 3L6EA 4PCVA 1CUEA 2EFYA 2I3ZA 2C1XA 3AI2A 3OLQA 3BJIC 4M55A 1Y37A 1ATZA 4ZPXA 5ITZB 5FORA 4G8BA 4WOBA 3CVXA 1Q2UA 1NNUA 1P3DA 4QGFA 4U5XA 3TD6A 4AF6A 4H16A 3PPWA 5AI6A 3SIWA 3IDFA 4BGIA 2ECKA 2RSLA 5B7QA 3JQCA 1N2HA 1USUA 4CI9A 1CJUC 4DY4A 3FKJA 2FPMA 1JAHA 1OY1A 2PRZA 1ZW6A 3KUDA 1HYEA 4MYDA 1P2DA 1YDEA 3RR2A 5ESWA 5E3HA 1OH6A 1JKJB 3E7WA 1TMGE 4O2RA 5DYTA 3BA1A 2QF7A 1PFQA 4TWRA 2FP4B 1OD6A 2DVMA 4KV7A 2D13A 3FW1A 1F8GA 4RLFA 2DFLA 1T3SA 2YHIA 4X61A 4UZEA 3DLPX 2OE2A 1YCFA 3ROPA 4QX6A 1JGTA 4UEOA 2C7QA 4U8HA 3V9PA 1R37A 1KO4A 1Q1BA 2BHLA 4Z54A 1YZNA 4HL6A 5C8VA 1J0CA 2HSZA 2VUUA 1N9GA 4X95A 1U3VA 3N0WA 1RJ9A 3LHFA 5D86A 3V42A 4HUQB 4BFSA 2LIPA 3DV9A 1H1DA 3HHEA 4O33A 3TLKA 1T91A 5HE9A 1GG8A 4GM1A 3FBWA 4FFOA 1T5TA 1KYXA 2H8KA 2PA3A 2IYQA 4EKEA 1NVFA 5AW5A 5C7IO 2ZRMA 3OF3A 5HUJA 1FVOA 1HOTA 2ZUDA 4CF6A 4R81A 2ZUTA 4TYWA 4KSBA 2XNHA 4GR5A 2BFWA 4RNCA 2Z2ZA 4O2BB 4OMCA 1GL3A 3B9RA 2YN2A 3I8OA 2OP0A 2ZSKA 5EE5B 5K8CA 2HYDA 3O1LA 2I3DA 1AKMA 1JLHA 5KNCD 3L8FA 3N70A 1KVQA 2D8AA 2FWMX 1HNNA 2XIQA 3B5IA 3ILHA 4IL5A 2HU2A 3L6CA 4OXYA 3OZSA 3EWIA 3WGIA 1U9IA 4PE5B 3H8JA 1CW2B 3NBQA 1ZUWA 4KBFA 5TPWB 2GZ2A 2VATA 3VDMA 4F2GA 1A4IA 2GI4A 3P2OA 1OGJA 1QH9A 1FUYB 1YCDA 1N5OX 5B3AA 4CF5A 3ZJUA 3IESA 4QBKA 2VDMB 5C9ZA 2XUOA 4KRXA 3VH2A 3CNLA 4IQ0A 2K7ZA 4HYEA 3RS2A 3V46A 2WYVA 3RSOA 2WNIA 2H52A 2WJ3A 3QTLA 3F3MA 4FUTA 3WC4A 3A4IA 1J0AA 3A4YA 1M0TA 3P5SA 1C4WA 3QYJA 3ZU6A 1J2UA 5F76A 2QMZA 2JASA 4B6OA 1L3IA 1OQAA 4Q6WA 1OX5A 1QGOA 3LUKA 1OIVA 5JNRA 4RMJA 3CLVA 1QRUA 3BULA 3JVDA 4DCOA 1ZN2A 2XUDA 1GXSA 4IMIB 5D7BA 5A3SA 5KOHB 5F77A 1PFGA 4J9UE 3RYIA 2DPLA 2ZREA 4OK3A 4DNOA 1M75A 3RRNA 1MPTA 1USIA 3OQOA 1OFIA 3G5UA 1FFSA 1TQ4A 1CDDA 3VV2A 3BBPA 4YUWA 2G5PA 3VXKA 2HQ1A 3BILA 5I3CA 2RGWA 3EPLA 3VKHA 1NXOA 1WUYA 2AN3A 2V3VA 3ZNQA 1VL1A 4DWOA 1Z4NA 3G0CA 2FUCA 4PLYA 3QX7A 3LGSA 4D82A 1K06A 1TTHA 2JLSA 3JD1A 4G4IA 4QEKA 4QSHA 5CNIA 2JK1A 5HOQA 4HYQA 2IS1A 1A8HA 2ESRA 1G5IA 1ECBA 2G36A 4QBGB 1GPJA 4YMIA 3HYCA 3F3YA 4HSEA 5K1ZA 7GPBA 4WXMA 4R5HA 4R6XA 1Z4IA 3FPHA 1MZVA 2XWQA 4OP1A 3W5AA 4LGVA 4PCAA 5L3QA 2PS3A 3TL6A 1D4AA 1G5QA 4RZQA 5BN4B 5A2GA 2J7PA 4F85A 4P3KA 4ZYLA 4JR2A 2PZFA 4E2ZA 1VDMA 3D2AA 3CVYA 2QLNA 5D6NA 1ZA2A 2WMYA 4M1WA 4BAGA 4D9EA 3D4IA 4H59A 3K2BA 3LLUA 5I8WA 1M8KA 2JEZA 2P4HX 3PC6A 4P9NA 3TTWA 2IYUA 3QWIA 4AKSA 2YH2A 2XVAA 1GDTA 3IEPA 2GEFA 3QVSA 1YR2A 2Z2IA 4FT4A 5ALZA 3TRFA 3VBEA 3UBTA 4MW5A 3RAFC 8ADHA 3IE1A 3JATA 4JUAA 1UT6A 3OJXA 5TXGA 3DEAA 1T4MA 1FLDA 1KU6A 4Q9AA 4DMHA 5F23A 4BZQA 1ZM3A 3BC1A 3ZD9A 4WSOA 2QN2A 1RBQA 1I24A 3BB3A 3QXJA 2W9XA 1SC6A 1K86A 2KX7A 1RYDA 3QKIA 4CKWB 4X1YA 1M1YE 3IXLA 5KVSA 1FRQA 2QGFA 2R5FA 2JJQA 2V4MA 3EVFA 2CVPA 4XJVA 3VZRA 4DM3A 5BR4A 2LW7A 1Z5GA 4LW8A 4YQYA 1EFHA 1JR4A 3DCYA 3F3KA 1EB9A 1NUPA 3NM5A 4M0DA 4OHBA 1Z39A 4WCDA 4XLLA 1GTG1 3ER9A 1F8XA 2H4ZA 4KDEA 5ENVA 5EJ9A 2I2AA 1C9NA 5SYMA 1WBDA 2BKLA 4FMBB 2VJYA 2JI9A 2VCHA 5BN5B 3RWMB 4U2GA 4BQPA 4ZYTA 4Q66C 5F3DA 3O83A 1KYWA 5J3JA 3MBIA 4YMGA 3B89A 1KZ6A 3PXDA 5K3DA 1YC5A 4WX2B 3LXMA 4ZYVA 4EECA 3F78A 1Z4KA 4AJ9A 5JSHA 5DM60 2F3UA 4X63A 2F43B 1P2GA 2VF2A 2YMPA 4XDYA 1EP3B 4XM1A 3DVQX 4C6SA 4N8DA 1CUZA 2W6CX 4BV3A 5GONF 5AUPB 5IM4A 4CODB 3KYCB 3ON5A 5BSGA 4HGQA 3I6IA 1RYMA 2ERCA 2VYVD 1NA5A 1VXOA 4DG9A 3COJA 2BELA 4ND2A 2DHEA 1V3VA 3FLEA 2V96A 3AUAA 3B3JA 3ZL9A 1IBRA 3P1JA 3FYUC 1OX6A 3M6VA 2B9EA 2QR2A 3JWJA 5F12A 4ER6A 1AHHA 3UW3A 2Q8PA 2WPDD 4A15A 2Q9CA 2R6JA 4EG1A 2UV8A 2WZBA 2BP7A 3HGMA 1ZSVA 3T35A 2WHRA 3PUIA 4C76A 2IDJA 1Z5VA 2C4VA 4KR7A 2JLWA 4LMPA 2H7VA 4RTMA 2ANCA 2IY8A 2WSLA 4M9UA 3QHAA 3MLEA 4MUMA 3LKDA 5C8ZA 3ZDDA 4JI7B 2YWJA 3I9FA 5INTA 2VP2A 3JALA 1KAQA 2AUMA 3EGIA 3QBDA 4XWAA 1E3IA 1Q20A 4MKIA 2UUAB 4JLSA 2AZMA 2CW5A 5HE8A 1T2CA 2Q50A 1DRWA 1UT5A 4AS1A 4BQRA 4DC1A 4V1CI 5CT8A 4HN2A 1JQBA 3VO9A 1JHUA 1NBEA 5A5VA 3LFHA 2I6SA 4KPYA 1HC7A 3OZEA 4X5OA 2AYXA 1PTJA 2WAMA 2IYYA 5I4KA 4R2KA 1YFKA 3EFOB 4ZVVA 3I8SA 1MOZA 1UJNA 1AZLA 5K6AC 3T9FA 1WM1A 1DS6A 3EJ6A 1O77A 3AY0A 4RY9A 4WZAA 1TL7C 1TPZA 3EE6A 1H5NA 4Z8YA 5WRFA 3ZXSA 1NNSA 5FI1B 2XNDD 1R0ZA 4HB3A 2PWYA 1I6MA 1EFRA 3FPKA 1VP3A 3N2IA 3I2YX 3IAEA 2R97A 4C30A 2WU1A 4ZT2A 1CIVA 4Y98A 1J2EA 2H0AA 4GXRA 4BMNA 1VHQA 3TQCA 2EU8A 3X43A 4HVLA 5FWYB 4R6WA 4EJSA 4RDCA 8LDHA 4L57A 4BIMA 3SYKA 3K0AA 3CW9A 4MP3A 1C1DB 1MR3F 2EW1A 1M5TA 4NZ9A 3RRJA 5DWQA 1K7FB 4TXHA 1ZJZA 4F1JA 4ZT3A 5C4MA 3O4GA 4U5QA 1T9AA 5F5XA 3EWSA 4C0WA 3RU9A 1FCJA 3P4UA 4H0FA 1XZIA 1KZ7B 1Q0ZA 2D2VA 2HIMA 5EJAA 5LZ5A 3GG9A 3RTEA 1NF2A 4G86A 5JSFA 1HDRA 3RJZA 3MK31 4BBJA 1LC0A 4F2WA 1BCRB 4RK7A 1NE7A 2JF0A 3C6BA 2ZJ2A 3NNDA 3NBUA 4RMGA 5JI3E 1W49A 1WCWA 1CJVC 4ECAA 1RAGA 1LLFA 3QA9A 1C4OA 1G3IA 3QX8A 3RW9A 4OQEA 2FNAA 5CEEA 4ALMA 2PKXA 1Q95A 2GX6A 3CCFA 4WADA 1E7QA 4MRMB 1R00A 3OOHA 5ALNA 1PWHA 2XJ4A 4FS8A 4DRYA 5IDYA 2P7HA 3KXKA 3FJ1A 4KLAA 3PGA1 4OMFG 4U2CA 5KHAA 3KWJA 3ZKWA 4K9DA 4IIHA 3I0ZA 4MTCA 1AB5A 2FR1A 5F7ZA 2O2DA 1S7GA 3CEAA 3DZIA 3M6IA 3PCTA 2QEQA 1ZVMA 2JGAA 3GT0A 3HYNA 1XTZA 3ROGA 2Q3MA 2HAEA 1T9GS 1Y3IA 1BHO1 5DM4A 3VR4H 2AK3A 1USWA 2BLNA 3N05A 3BQ9A 3WAJA 4M1YA 3GJXC 3L8HA 3MYRA 1MDBA 4ZEMA 1K27A 1EQUA 1FP7A 3LV8A 3LXUX 3ZPXA 4CL3A 5J43A 4KC0A 4X6LA 2CEAA 1JX6A 2P5TB 2V4ZA 2Q5IA 3UG7A 2BE9A 2Q9UA 3HBFA 3WB0A 1T9HA 2I76A 1IRXA 5I9IA 4TS9A 4B4OA 1KZYC 1LV8A 3VU8A 2B8TA 4NYIQ 4JUIA 3JPYA 2DSTA 4FEEA 1UMCB 4EW3A 4HRXA 4NC9A 1U0BB 1PGOA 4AQDA 3TG8A 1W4RA 2XE8A 1VZ3A 3RVKA 3H9BA 4L3OA 1XOIA 3CRMA 5SY9A 2BTQB 1AHNA 4OKNA 4W6QA 3WK5A 3KUCA 4E03A 1OAAA 3GLRA 3GYGA 2QRHA 4B71A 4PGFA 1UKYA 2QQEA 2WZCA 3MWYW 4WFQA 1FL9A 1KI7A 3AEQB 4IDAA 4PINA 3ZZMA 5HRUA 2UXBB 4AWBA 2O5EA 4LX8A 3WYCA 4DF3A 3GLQA 4D56A 3F8TA 3LKVA 3I30X 4BLWA 4KGZA 3Q8LA 3H13A 1KJ8A 4J0FA 1YRQA 3IVMA 2UYYA 3EIHA 2XMSA 4E09A 3OD1A 1ZGAA 2BHNA 3NHFA 3X1WA 2ZIFA 5F7OA 4J43A 1CRWG 1UFOA 3E6AA 3CXUA 2VVTA 1F3LA 3HO6A 1AO3A 1NN5A 2HIGA 2I7VA 2BH9A 3CUTA 4XCQA 1TZCA 1RDFA 3EVNA 5DTRA 4CKXA 2C1ZA 5DXAA 3VC1A 4EGSA 2F00A 1ZOSA 5IH7A 3STXA 5DOZA 1U3UA 4XR9A 5A71A 5KMGB 1XEAA 3WWDA 3PXUA 3IVGA 2AS0A 2F17A 1KC1A 4DDMA 4FHFA 1F2UA 2QTBA 5AKKA 3QPWA 1DQNA 4KTTE 1P39A 3R6TA 3A0RB 4TXNA 3PG5A 3EW7A 1Y1TA 1MG5A 3RJ5A 1ZG3A 4JZKA 1M2NA 2Y92A 2IHYA 3MT0A 3ELWA 3EIUA 4TVBA 1YZLA 1XNHA 1AXRA 1YR8A 4PC1A 3IDQA 4DLVA 5IH3A 2C2ZA 3AEUB 5BVGA 5CUQA 4YRDA 4B7UA 3E4CA 4AC9A 3R8CA 4LCBA 1O5IA 4M89A 2OVBA 3IBTA 4X8MA 3TEFA 5EQJB 1EWTA 3DBHB 2AZTA 2WIJA 3U7FB 3IBYA 4KUEA 1DUIA 2WLSA 4XD7D 5B3JA 2P6PA 4MB6A 4B8ZA 4EQ6A 2CLIB 3B6KA 2IW1A 4Q4CA 2POCA 4AJKA 3FBGA 3H7IA 4FMCF 1XKXA 4JA0A 3ZBPA 5HW0A 1M8JA 1PS8A 2I2XB 4LJ6A 3FZNA 1Q84A 3KSDO 3PUWA 4A36A 2I54A 3EZYA 4BMXA 4PRZA 2ZOSA 2PT7A 5JE8A 4EPWA 2LD4A 1USGA 2GPWA 2JBAB 2VT2A 2Z4TA 3MEQA 4ARUA 2OG2A 2IK8A 4RWZA 3NHZA 4H6XA 3PXBA 3TB6A 2ONKA 3D4OA 2N46A 2AWNA 3UB4A 1XT6A 2CFRA 1T3LA 1TEVA 3H16A 1CV2A 4Y6LA 1WY5A 4MR7B 2CXTA 3EEBA 3MSCA 2SCUA 3CX3A 5AJTA 5C1OA 2B35A 5ESXA 2VQDA 2DG2A 2YNMA 4U6QA 1WCIA 1MD9A 3F5SA 3JQBC 2A92A 2AKYA 2WZDA 2ZSEA 3O26A 4G5XA 3V4FA 2XITA 5K2OA 1GITA 2OCLA 5EZYF 1R1DA 5LCXA 1QRTA 2G67A 1ZUHA 2KQUA 3RANA 1OAOC 3A9UA 2BF4A 1NE2A 2CF5A 2UYQA 2ZIAA 4LTNA 4BRWA 3OAAA 4H7DA 3AETB 4XW2A 5L45A 2VUSA 1RBMA 2B7LA 3PYXA 2ZJ6A 4I1SA 3SFZA 5EMJA 2FSHA 1P0IA 4Y6QA 1RXEA 2WTUA 1M8PA 2VHTA 3QXXA 4R1SA 4AQ7A 1I4WA 3EVDA 1LTHR 2WSIA 4HYTA 1SAYA 3EVAA 2R66A 2H65A 4P08A 2W0MA 2CGEA 1YB2A 3ESCA 3IVCA 2EJBA 4U7WA 2ADOA 1IYZA 3AM1A 4FSXA 4M7OA 2PX6A 1Z3IX 2IIPA 1D07A 4GF5A 1CZRA 1YJXA 3GQBA 2GNAA 3Q0TA 1NR1A 2JFFA 4C03A 4OLFA 4KVAA 2CWWA 3KEFA 4B3DA 4Q9KA 1E99A 4V39A 1B2LA 1MGOA 1J7JA 2R5WA 1J8VA 3JQ6A 3RSCA 5A6SA 1PCXA 3DAHA 4MROA 2ISSD 2Z56A 4BEJA 2Q1YA 2AQKA 2W22A 2W8BB 1FMCA 3IHWA 4R0MA 5JLJA 1Y3BE 3I5MA 3ETEA 1JHMA 1YDHA 4F9TA 2QWXA 3NW9A 3TMYA 4BLTA 2RAFA 1G5PA 3T5AA 3OQPA 3LUCA 3CG4A 3LCUA 3R09A 5CITA 1T0BA 3M6LA 3TNFA 1PJ3A 2H17A 3MS4A 4EJMA 1JPJA 3H18A 3ZHUA 3KL2A 3H83A 3SIRA 1KO7A 3I28A 4Y0NA 3OFVA 4KPUA 4UM7A 1N78A 2WWXA 3AHIA 5F21A 1E2BA 3UB2A 5KAMA 2Q3CA 3WQBA 2ZYAA 1U5CA 1W44A 1Z0SA 2WMDA 4IHJB 1UXGA 2DBRA 3IAFA 1FFGA 1K8QA 1T1GA 1OT5A 1RE1A 1H2FA 2B98A 2CLMB 5ECYA 2VDQB 3GDOA 3H1AA 2UZ0A 1OKKD 3GGCA 4QT0A 5ALFA 3EZXA 3KKLA 5CNKA 4EFNA 5KHLB 1V7ZA 3EWAA 1AKYA 3KOWA 1SKBA 4WFJA 1TUBB 1FFXA 5FYDA 4Z9FA 3R3VA 3QBEA 4KNWA 3AM4A 2IYXA 3AVPA 1B0PA 1SULA 2BUAA 1K08A 3PHHA 1RCUA 1YF3A 1J6UA 3KL4A 4DDVA 4KKVA 3M2TA 4I4NA 5CB4B 1XZJA 2BFCB 2NLOA 4HUTA 2I1LA 1WU8A 2R6R1 1P9OA 1UUFA 2Q49A 4Y2UA 2OHGA 4TN1A 3L7CA 4J7AA 3A4VA 1N9ZA 5JSYA 1OVMA 1Y8RA 1TCCA 2UVPB 1F4LA 2VPWA 1UK9A 4GHWA 1EXMA 4EM6A 2O7RA 2QZ4A 4FLEA 4RA9B 4RO0A 1LRKA 5MFPA 4TPKA 2BHTA 3VJRA 1HYGA 4FHGA 2QPAA 3L1HA 4XLZA 4H18A 2G5CA 3F9CA 5EIAA 4Z9XA 1TYDE 1P73A 2QV7A 1EK2A 2W2KB 3GFVA 4HD8A 2I4TA 3K1AA 1G6Q1 1H2BA 1ODLA 1C8KA 2YY7A 4N6GA 5CVUA 3W7AA 3ZHOA 3O47A 4PU0A 3ZZNA 2PRKA 3YASA 2C83A 4IJQA 3RUCA 3QPVA 1BVUA 3DXYA 4Z5XA 1QG0A 2ZFUA 4Z9BA 1ZCAA 3CFYA 2Q7XA 3LOUA 4CM9A 1YDMA 4PEVA 4EY8A 3O3MB 1JWBB 1AKRA 1NUUA 4DZTA 5LDHA 4RDIA 5TMDA 4G07A 1Q0UA 1XCOA 4ERNA 2GERA 2GFQA 4U9UA 4XR4A 3ET5A 1FPMA 1I8TA 2NZJA 3QBTA 4FK8A 1IOVA 4AYWA 3SNHA 2CDNA 2RGAA 4JJGA 4XGNA 3JQ8A 2XRYA 2GZSA 4PIPA 5K99A 4KJXA 3REFA 2JATA 1OF1A 1TVKA 2O19A 3VU0A 1OFUX 4P81A 1QSGA 4Y8VA 4AJOA 4HX9A 2SBTA 5TDHA 3IERA 4H6VA 2YV4A 5LYJF 3FN4A 1D4OA 1HDYA 4U7FA 2C07A 2JA2A 2XNJA 1QFMA 2Y1LA 1FSFA 3SGLA 4CJXA 1R15A 3NJ8A 4FYMA 1VGRA 4B3JA 2C5LA 2P9CA 3PL5A 1K6XA 4IFIA 1O95A 4PR0A 1YIOA 1JTVA 3MJVA 5CDHA 1TTPB 4OYLA 1KGSA 1UFVA 4N5MA 4Y2QA 2OO3A 3CYFA 5B3KA 1TGVA 3D7MA 1BYUA 2ILVA 3K5IA 4OP2A 4BO9A 2ZIUB 1VBKA 3CUUA 2A0YA 5L7YA 5LLSA 1D0VA 5AO9A 4A8TA 3RADC 4U2EA 3EVCA 1T0IA 1J9ZA 4RADA 4X9XA 5IKPA 5FL7A 3SZUA 1N8TA 1TJPB 4BFZA 4BDSA 3W9BA 1JJVA 1C1XA 3W4KA 4HZUA 4TZKA 1QS0A 2C2YA 3KQWA 4TV9A 1ECLA 2FW0A 1CQZA 1G6OA 1UBRS 2WJAA 1WMBA 4EHDA 3H05A 3H3JA 5BXQC 5AKXA 3PJFA 4L9SA 1K7YA 3VSCA 1CF9A 2I1QA 2KYRA 4YRMA 1J0DA 1U3WA 2FF7A 3VYUB 1YK0A 2CHQA 4EDFA 1NV9A 2A9FA 4KR6A 1L7XA 4ZCPA 2KB0A 2NU7A 6YASA 5EVJA 1CUHA 1NYLA 2A14A 3B5EA 1RXVA 3H9JA 4GW3A 2DPYA 3WYBA 3CR7A 3VJLA 1UK7A 2H85A 3CB2A 3IAUA 3GARA 2EGGA 3HCFA 2H2AA 5BQFA 3H6KA 3AESA 4JXXA 3JZIA 3PX7A 2NAFA 2NGRA 3I76A 4XPZA 4LJ7A 3NVAA 4HDCA 3N8DA 3GMIA 1K8ZB 1ZISA 2E89A 1YC2A 1I5OA 3OKCA 4H1UA 1QCCA 2ZQYA 1TGYA 4L07A 5CX1B 4RHUA 1TEXA 1AZWA 5IWAB 1XDUA 1L4NA 1SNYA 2YRXA 3KLPX 3O82A 5TV2A 3EBPA 2NU8B 4EA7A 4U39A 1WSAA 2WT4A 4PQRA 4ZP1A 2OXTA 4KR2A 3SZLA 2I6QA 3SD7A 3VDNB 5LWQA 3X0DA 5JXJA 3IQDB 1I4LD 5FUWA 3DE4X 3OZBA 1H9BA 1RWWA 2D1RA 3TZLA 2JI6A 2QP9X 4WL0A 1EGVB 5AW8A 4HH3C 2OZLA 5EPEA 1O2DA 4B35A 3T1VA 2EWWA 4NOKA 3KO8A 3A10A 2CV1A 1U3FA 2R7AA 3SF8A 2DR2A 3TUZC 2R6GA 3KK0A 1DTWB 3GHHA 1OC2A 3OIFA 4BOYA 3TBHA 4F4JA 1DJOA 3NGLA 5LXTF 1FEZA 3OEHA 1JE1A 5DMXA 2ZJ8A 1FC0A 5TIIA 1SBZA 3U3MA 1YS4A 3G9XA 4QE3A 3O1HB 2VJNA 1VP9A 1MORA 1OFUA 3FNBA 3SBXA 1OYYA 4EGJA 1YR7A 4FYHA 5HS6A 1KQ3A 2ZR0A 3BM5A 5K09A 1TW2A 2FFJA 3K0HA 3H86A 1FQKA 2GHIA 1PEYA 3PEUA 3W0LB 1VSBA 5EERA 2BKUA 3HA2A 3W6UA 1OT3A 1WDKA 3K35A 1KHTA 1QCDA 1Z82A 3NZEA 2WKRA 1AGPA 1QP0A 1QP4A 1VBFA 4I19A 4MVJF 3TRIA 4DCNA 1N33B 1B23P 4R54A 1QZTA 3OSZA 4NWIA 1WA5A 4EITA 1V11B 1XO1A 2HNKA 4WKBA 3GGPA 4X6XA 3S2GA 3RIGA 1CFZA 4KQ2A 3TYXA 2UXDB 4N03A 3S5JA 1CIJA 1PRYA 1UJ2A 2G04A 1ZICA 3I62A 3KQVA 2JGIA 4KWEA 4ID9A 1P4RA 2ST1A 4FKMA 5F78A 3ZWBA 4BO0A 1XCBA 3JWPA 1SK9A 1PFKA 2PBLA 5LZ7A 3SJUA 5JZBA 2AVNA 3RAEC 4UEWA 1F0YA 1Y63A 4YCMA 3OQVA 2J0UB 4HWOA 5IC5A 4PGHA 4YV1A 1QH0A 4R01A 5KOJA 3P2MA 2O2IA 2AEMA 3QX9A 4AP5A 4DMMA 4EPVA 3MMSA 1LBTA 2WTBA 2EFEB 3UICA 2PAFA 1E2QA 3OEED 4FDUA 4JMLA 2Q41A 4RPHA 4CM6A 3QUBA 1CY7A 1W2GA 1HE2A 2GF2A 2C8VA 2IOYA 1IWOA 4IJVA 4NZYA 2XEDA 5EINA 3SZMA 3VTZA 4CIAA 3K5PA 2PNFA 2CHGA 3PJGA 5CXXA 4J76A 1PT6A 2M6LA 3RYHB 4C4AA 1DJQA 2PJDA 4HDAA 3RT9A 3E9MA 3B6ZA 5FPTA 1QX3A 1Z6TA 2VI5A 2RGEA 4JD5A 3D8TA 2VHQA 2VZ8A 5E6SA 2Q4TA 4LV5B 2VP0A 3KQHA 2ATCA 2WKPA 2Y1OA 4CMIB 1OXBB 2GHRA 1NLYA 3A9WA 3MJRA 3E27A 3IB6A 2EJCA 4FIZA 2JLQA 2A9PA 2MSDB 3DV2A 3MRVA 4O4HF 3JY6A 2ODPA 2CXPA 4DCPA 2I2DA 2C2GA 3A6KA 2AFHA 4BZWA 3L4SO 4IZ6A 3R6LA 4ZQIA 2YXEA 4LZAA 2VH1A 3T1QA 3TNYA 3B60A 4NEQA 1QMPA 3HL4A 5CGZA 5GP1A 3UAVA 1W4CA 1V8FA 1VDZA 1ARZA 2D2XA 3WMXA 5JJ5A 4FQ5A 3U62A 3JCZA 2VT6A 1RACA 2E1RA 5G4LA 3P9CA 5CW1A 2OHVA 1LY1A 3KJXA 4M0PA 4WAUA 1XXHB 4JC0A 1PS0A 3IR6A 1X7YA 5EIHA 5FNVA 1DBVO 5ERYA 4YRPA 3PD0A 3THSA 4HATA 3ENQA 4DREA 5KTMA 4LNAA 4ADSG 3B1WA 4ES6A 1UFKA 2XECA 4I1VA 2Z08A 2K5UA 1IHOA 1QIMA 2IW3A 1IN6A 1MVNA 4LYHA 3SZOA 3H99A 5I48A 4GL2A 3CWQA 4CQMD 4F72A 3MZ0A 1JEEA 3KIPA 3PLNA 4RXUA 2V7EA 4BGDA 1DXYA 4JX9A 5JD6A 1CJTC 1R0CA 1W5SA 3C8MA 4L7QA 2ZRCA 3RFTA 4D9HA 1MCZA 1SKMA 1NU6A 2GBFA 2Y77A 2I66A 5JHGB 3I5UA 4ZD6A 5FOSA 1GA4A 2C5BA 1SUDA 4D0GA 4EY3A 2QX6A 3PQ3A 1MDFA 2QW8A 3V5NA 4UE6A 2ZJFA 1T5OA 4L3WA 3E05A 4B2PA 2IEAA 1T3ZA 4QRDA 3H04A 2OCKA 3FWNA 1AKQA 1MOSA 3PWKA 3SC3A 2WJHA 2ZKIA 3BYZA 4Y2VA 3R7WB 5YASA 3UW1A 3VPXA 1LUAA 2VRCD 2EDCA 5LQDA 2BT4A 2WJPA 2J08A 1WVGA 2PBRA 3AQIA 2QTFA 5AHOA 3WMWA 2RGXA 4Y6SA 5HA5A 2FWAA 1RXCA 4HNUA 2TSYB 1E62A 4D3SA 4BEWA 4PONA 1M34B 3W2TA 1BGVA 2F59A 3F47A 4G0MA 1NL3A 2XDQB 4JJZA 1CR6A 1DZIA 1E9VA 2VDVE 2QIPA 3GFTA 4AIRA 1E9DA 3GDFA 4D3DA 4QOHA 4XUGB 3JQ9A 4AX8A 2H08A 1EFCA 1L5OA 5L95A 5JJKA 1VB5A 4PVCA 1GG9A 1E2NA 1FTQA 3WIEA 1Z0IA 1YR3A 3F2IA 4YJ3B 3PFNA 5CX4A 5H1YA 2H1FA 3EMVA 2XQKA 2JFBA 3DDHA 4EKDA 4KQXA 5H81A 4S3MA 3L82B 3WNVA 2Z8YM 1NUSA 4YJ2B 1QB7A 4RK4A 3MXTA 1K7CA 1R0YA 1Z7YA 4XYBA 2PJRA 3SZGA 4LDNA 4NG5A 3PNYA 1MO2A 2R47A 3GRKA 4RJIA 3K0FA 2FZLA 4DCGA 3M6XA 3NATA 4OU5A 2EFDB 3ZW9A 4NS1A 4FXOA 4R7TA 1OFHA 1ZCJA 2O8BB 4TTSA 3OZCA 1GZ5A 3MFQA 2YICA 3DMNA 4LE2A 5E7IA 3STWA 1YBAA 3TTXA 4X64B 1TYAE 3W1WA 2OFWA 2ZWOA 5ARCA 1ONOA 2FVXA 4DA6A 3GLGE 3EGVA 4DZZA 4E5DA 5FH9A 5FPPA 2GPNA 5KCMA 5B2ZA 3EFEA 3KTDA 3R4VA 4N3CA 4PHHA 5FOWA 2C7VA 3V8BA 5A4AA 2J0SA 1FF9A 2B1JA 3ZDFA 4CDMA 5HMMA 3LGAA 4JODA 4DIOA 1EDOA 3ZDBA 4JEIA 4MVJG 5J2UF 4PCLA 4RQBA 3BJZA 2ZAMA 3ELDA 1YR1A 1KFKB 3A0UA 4HMQA 1X7WA 5FWNA 4Y7CA 1BWSA 2BFAA 3ZHRA 2FQWA 1E20A 1PQYA 3A4LA 4CM1A 2CFSA 4QXOA 1UWKA 4B84A 1Y7TA 1K0UA 4MRNA 1TQHA 1NW8A 4R2WA 5FUVA 5C31A 4ZYUA 5HZHA 3AR4A 3K30A 4CKCA 2O54A 1J8QA 3WLFA 3L7DA 5IUKC 5BQ5A 4UUQA 4IVNA 2AFIB 3HV2A 4LZJA 1C30A 3FOAA 4AN0A 5AVXA 2CUKA 3DCIA 5CFPA 5EPOA 1UKBA 3HJAA 2HIAA 4B32A 2QE6A 2PFGA 2H07A 1LNZA 1GD1O 3EAFA 4R7ZA 4WOKA 2C9MA 2ENWA 4MKGA 1DELA 3W77A 4CN8A 1RM0A 3ESDA 4KODA 2OHXA 2H7XA 1PS9A 3AEZA 3BXPA 3K15A 1G2IA 3LDGA 2ZRDA 3LO8A 1UEJA 3MINB 3NHMA 4IMJB 3TLJA 3IQZA 3ZK8A 1ZGZA 4EL5A 5AJHA 4MUBA 1ZLXA 4PNZA 2V5UA 3V8PA 4CE6A 2O7NA 4PFQA 4BZZA 1Y48E 4OKSA 1LW7A 3ZGOA 4PFKA 5ICGA 3DAGA 4LWZA 4ZDKA 2JNWA 5ALKA 2GEBA 2BGMA 1I1NA 1K9VF 3KELA 4OEHA 5EIBC 3SYLA 4BNNA 1J2TA 2E1PA 1M6NA 2VDWA 3LO5A 3DYBA 4WK2B 5FKJA 2D06A 3BD8A 3OPQA 6GPBA 2XTAA 4LHVA 1KI9A 1AUVA 1I6WA 1O4WA 4F91B 3KDSE 1TLLA 2VEOA 4P2BA 5FO0A 4B45A 4TM7A 1DE0A 2AMJA 2NO4A 3NT4A 5GIOE 3ZDEA 1KFBB 1RZ3A 3TZQA 3S55A 1BGWA 4EARA 1P72A 3WLRA 1N6PA 4LRQA 2QRPA 1IHYA 3JQ7A 2BFEB 4B48A 3R0VA 5F1PA 4Z53A 1B6TA 1KI2A 5G4KB 3OG9A 3TTTA 4WKNA 3IXMA 5F7JA 3WGHA 3EQZA 5FFNA 4B09A 1JG3A 1J2YA 4PYIA 2Q99A 1JQJC 3EC1A 1R6TA 5JVDF 2OKGA 3K70C 3CZAA 1EFPB 2C8KA 2JBHA 5A9TA 1UR5A 4ND8B 1IBSA 1FRZA 4NG4A 1O4VA 1YS9A 4PN3A 4D5GA 4WN3A 1U9ZA 3P52A 4ESEA 3F6PA 3UH0A 3DAPA 1H1LB 4GX1A 4A0GA 3S7TA 1NW3A 4BX0A 3D6TB 3HS3A 1EK1A 1P7ZA 4UUPA 4LF8B 3GLIE 1TLFA 4GYKA 1W0JA 2XCRB 1B2RA 5AKZA 4KIUA 3E35A 3H9CA 4ZK2A 5FDFA 1TFRA 2OV8A 2IJGX 1EAMA 5BR1A 1E3JA 2ZYDA 3BEDA 1T0HB 3H5NA 5FWDA 3L40A 3B6JA 1JKIA 1U7PA 1HI9A 1Z08A 1A71A 2E49A 3GG2A 3IMEA 1G5RA 2IU0A 5CCEA 1AQUA 2ZBGA 1P0CA 1U02A 2OM2A 3ND9A 1V5GA 3NKVA 4TLCA 5DSXA 4ZT4A 4M99A 3AB3A 4KLCA 4LMBA 2WIDA 4YMWA 1JEYB 3O3NB 1YK1A 2EYQA 3OPYI 4OV6B 1A2BA 3B8EA 3EG9B 3FA2A 3N2NA 4JQYA 3S2FA 2UYCA 3KXIA 4KDRA 5AHWA 2ZR8A 2R1ZA 5LQSA 5E4JA 3DFKA 4UCFA 4RS4A 4YMTA 3FUVA 2ODEA 4IJSA 1KFCB 1G55A 3WDMA 3N5CA 3QG1A 4O2LA 1ZR4A 5HM6A 5JAIA 1FQJA 1GSOA 2QQ5A 2QTNA 1RQLA 3BL8A 3DMHA 4RZIA 1IXZA 1Y3CE 3ZYCA 1LK0A 2PBZA 3REQB 1PJLA 3MQ4A 2VDPB 1XEFA 1WO8A 2DY0A 1HDXA 2GKOA 3KYDA 4IHQA 3TLBA 4Y2RA 4E5MA 4TKVA 5JAMA 1IVYA 5JAQA 3TOVA 3QF4B 5K8VA 4XDHA 2WM3A 2FKAA 4OAQA 2Q6TA 1EVQA 2RBEA 2B99A 3SVLA 5IKXA 4URUR 1YSCA 4J2TA 1D5CA 1NTRA 1XD2A 1WU7A 2E5FA 3FUCA 1PW7A 5K5EA 1ORIA 2DWPA 3GLHE 3GLFB 5AVJA 1P17A 2ZGVA 3SBEA 3NLLA 1N5MA 3T3NA 1BDMA 2CDBA 5LIPA 3OT1B 3C97A 1E5VA 1SC4A 5LB4A 1Z4JA 3GIDA 4EABA 5JANA 1PJ8A 1ZINA 2CNWA 2VC2B 4EHFA 2O2EA 3HKBB 1NURA 4Z4FA 1GTRA 1ZHHA 2V3WA 5E3IA 3UGTA 4TLMB 1L2TA 1QZZA 4R41A 1SXJE 5E2BA 3FRHA 5K3FB 1I2DA 5JZVA 3ZI0A 4WNAA 1W5FA 2HWUA 1RRKA 4EUEA 1VL5A 2D0IA 1E66A 3CEJA 1BO6A 2AYYA 2FLKA 1IJKA 3G8CA 3NFYA 3P9ZA 5TGZA 4D8XA 4BYMA 4KQ6A 1O8BA 5DYYA 3WA6A 1Y3FE 1QTQA 1M1YA 5AM1A 4BJHB 1LFAA 4O2AB 3RVPA 821PA 2IPLA 1V8OA 4J1NA 4ZRNA 3ZIUA 4ENWA 1JEQA 1C9YA 2BKAA 3P7MA 5FHQA 1NTOA 3FDXA 1CJSA 1KL7A 4Q7MB 4L0QA 3GA7A 1JSLA 4GR4A 4DQUA 4DDWA 1XTVA 5LOVA 2FDRA 4MEJA 3PT5A 1DKOA 4R51A 3HB1A 5CYPA 2Z95A 4DKJA 1IL0A 3ZZUA 1QO0A 4ZTUB 3AHEA 4EKYA 3GF4A 4JP2A 4IQGA 1JVNA 2QN9A 4ZZ1A 4RGQA 4I55B 3OTIA 1GRVA 1G7RA 10MHA 2COUA 4NE9A 3CH7A 2J32A 4EI9A 3I64A 7REQB 3K4PA 3NYIA 1H8ED 3TTSA 3ZLAA 1LBEA 2FPPA 3CJTA 3DMRA 4JT8A 4Q4LA 5G2OA 3RUDA 4BO6A 5KYYA 1H6CA 1RI4A 4CLRB 2QXYA 2VZLA 3FWYA 4MXDA 2BFDA 1XTPA 2VTVA 4Y6GB 1KDOA 4XRRA 4BWGA 5JISA 1WOYA 1J2RA 2JJ2D 3BHNA 1MC4A 3PUJA 4GZLA 4LAFA 4PAGA 2O07A 1TM1E 3TECE 1S8NA 3F67A 2BOVA 1ULAA 3VDRA 2WKQA 3MWLA 5BV0A 2OVFA 2XMCA 5KYUB 2BZGA 3VR1A 4DW8A 2WICA 4CZ2A 1EWKA 4ZVTA 4XUEA 3FNRA 4KCGA 4LV6A 3M1AA 1ID8A 1WZCA 3BWEA 1WXIA 3TRHA 1LGYA 3UJ9A 2CJFA 2Q2OA 4XWWA 3DFIA 4EG4A 4AU1A 3AF0A 3PJRA 3IALA 5CM9C 1CBUA 4BLPA 4EO9A 1IY2A 4RZSA 2FWPA 2VS1A 2EP8A 5CCXA 2CKMA 2I6XA 2GEDA 3CZQA 5K6AA 4V0KA 5H68A 2CLHB 2LDXA 3LUDA 5ES3A 5KZMB 3L41A 3AFOA 3EF1A 3HLTA 3V3TA 1U31A 1XTUA 3K20A 2RONA 1DDIA 3KOXA 2C0PA 2W5UA 3JQGB 2QTVA 5JJIA 1H4QA 5NLLA 4DLNA 2GPYA