1KEPA

The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-xylose bound
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
346
structure length
346
Chain Sequence
b'QFKNIIVTGGAGFIGSNFVHYVYNNHPDVHVTVLDKLTYAGNKANLEAILGDRVELVVGDIADAELVDKLAAKADAIVHYAAESHNDNSLNDPSPFIHTNFIGTYTLLEAARKYDIRFHHVSTDEVYGDLPLREDLPGHGEGPGEKFTAETNYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKNNKEVLELILEKMGQPKDAYDHVTDRAGHDLRYAIDASKLRDELGWTPQFTDFSEGLEETIQWYTDNQDWWKAEKEAVEANYAKTQEVIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dTDP-D-glucose 4,6-dehydratase
molecule tags Lyase
source organism Streptococcus suis
publication title Toward a structural understanding of the dehydratase mechanism.
pubmed doi rcsb
total genus 145
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 4.2.1.46: dTDP-glucose 4,6-dehydratase.
pdb deposition date 2001-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1kepA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1kepA02
4M87A 1J6UA 2VHZA 1QORA 5C7OO 3AOGA 1SC6A 5I9NA 3UCFA 2VHVA 4J7XA 3AK4A 4DGSA 3MTJA 4L0QA 4DLLA 1ENPA 5L51A 1YRLA 2YZ7A 4CQLA 5EERA 1Q2XA 3SX2A 4NBVA 3CZMA 1YQXA 3LF2A 1D1TA 4RPJA 2B69A 1UXIA 4OAQA 3H3JA 1ISMA 4Z3DA 3ZU3A 1A4IA 1MB4A 3QP9A 4NK4A 4JBGA 3FBGA 1NQTA 1P1JA 3RUIA 2R00C 1CJCA 5KVCA 3V2HA 4MVJM 4EJ6A 1R6DA 4IJVA 3WGYA 3VZSA 1ZK0A 2C29D 3DAGA 2UUPA 4R41A 3UHAA 2WM3A 2DM6A 3AM4A 1C14A 3AM3A 1L1FA 3LC7O 1UP7A 3WYCA 3DMTA 2I65A 2NU8A 4GKVA 3GRKA 4CUZA 1HZZA 2PFGA 4CMIB 4D0SA 4DUPA 4YCAA 3DAPA 1CEQA 3BTOA 3WGZA 4PFJA 2RHRA 3NGXA 4J3FA 1DRVA 2HMUA 2AEMA 3I83A 2AEJA 4OHUA 1S7CA 2A9FA 1LX6A 1E1MA 5CAEA 4BNIA 4BB5A 1PGNA 3LLSA 4MVJH 5G4KB 4DQXA 4JJFA 2FPGA 3V2UA 1WVGA 3FD8A 2HMSA 3G3EA 4QO7A 5TS3A 4GSLA 3DZBA 4I08A 1X1TA 1TLTA 3VPGA 3A06A 1E7WA 4IBOA 1ZW1A 4BIIA 1IULA 3I6IA 3U4CA 3QA9A 1E77A 5B4TA 1NPDA 3ONEA 4YAKA 2IEBA 3A9WA 1JWBB 1P9LA 3ZU5A 5B4UA 3OIFA 1V3VA 4UEKA 2NTNA 4LGVA 3JQ7B 4R16A 3ZCXA 2OZPA 2Z95A 1I8TA 3U5TA 3WSVA 1XQ6A 3AI3A 4KOAA 3ZV3A 3L4BA 4BMSA 1L7DA 3M2PA 2FY8A 3PZBA 2QRJA 5JW6A 5IDYA 3VTFA 3JQDA 3ORFA 2LDXA 4YAGA 1PZGA 1C1XA 1G0OA 2GERA 4IQ0A 1EK5A 1V0JA 1DAPA 1D3AA 3VH1A 2I67A 3NV9A 5CG1A 4MIYA 1U3VA 5JE8A 3QV1A 3AI2A 1YBAA 2PZMA 4UVGA 5C7LO 1F06A 4K1LA 4NK5A 2WE8A 3UW3A 4OO3A 3P5SA 4AJKA 2YFQA 5JYEA 4LVCA 4CMHA 3KSUA 2YV1A 1WWKA 4GI2A 5T6BA 3WJ7A 1E1NA 1Y8RA 4FFNA 1NVMB 5C3MA 3TZQA 5BNIA 1ZK4A 2JD1A 3E82A 4MPDA 4RVDA 5IF3A 3VTZA 5GY7A 3CMCO 4UAGA 1W4ZA 5G2OA 2TMGA 2I9PA 2VZ9A 2PD3A 5FI5A 4CLHA 3RFXA 4F6CA 3HSKA 5JCJD 1BRMA 4AJEA 3IMFA 4H3VA 4WLVA 3RC7A 1GY8A 4GPD1 4ZQHA 2C59A 4YDRA 3VAZA 3Q9NA 4KQWA 1EK6A 3KYDA 1WMAA 4QUKA 3L9WA 3GMDA 1OC4A 3OHSX 4CQLB 4QO8A 1PR9A 4MVJE 3WNQA 1YDWA 3V1UA 3PPIA 3BMQB 1HXHA 5ILOA 3BHJA 4IDBA 1EBFA 5EQDA 3TQHA 3E9NA 3EGOA 1IL0A 3O4RA 3H65A 4IS3A 1I3NA 4XYLA 1H9AA 4MVJG 4CLXA 3H9UA 5JO9A 2PZKA 5ER9A 5I8WA 4FOOA 3AUTA 4FFRA 1HKUA 3DZJA 1SAYA 1ZK2A 4Z0TA 5ENDA 1DFIA 1N2SA 2IZ0A 2QHXA 2J5QA 2C7GA 3DBHB 3RUAA 3WGQA 4BL5A 4TZTA 1UXHA 1LRLA 2ZJ1A 3L6OO 2GN6A 5A3VA 2PD6A 5L4LA 3KHUA 5LCXA 4CLDA 5B1YA 3GVHA 2W98A 5EQFA 3ZHYA 4BGIA 3EDMA 4FPXA 3ASUA 3K31A 4R69A 1C0PA 4AJJA 1GL3A 3GPDG 1X7HA 4B4UA 1I33A 5CG2A 4DLAA 3V8BA 1NHGA 3AU9A 4LSMA 4YJGA 2X9GA 5I7FA 2HLPA 1ONPA 1ZH8A 3R1IA 4MP3A 5AVOA 4EGFA 2VYVA 2V6FA 2PK3A 3G17A 4C7KA 1NX6A 4FSHA 4NJOA 5B12A 5L4SA 5T8KC 4Z9FA 1E7MA 4FS3A 4IGEA 3KVOA 1X0XA 5DP2A 2EF1A 1SNYA 3PDJA 3MEQA 4IQ8A 1ML3A 2AE1A 4YT2A 2ZQZA 5T5QA 4B3JA 1MP0A 1KC1A 1XGKA 2D3TA 5IN5A 4BNYA 1TEHA 2UYYA 3E03A 3FPLA 3FWNA 4CM3A 2YQ5A 4YJDA 4IINA 4S1VA 1AXGA 3WNVA 1PJSA 3LU1A 4IPTA 3KOUA 4LK3A 4YT5A 4YR9A 5I7VA 3S2EA 4PLCA 5JMWA 4W4TA 2W8ZA 4AJHA 5BNTA 1YS4A 3GEMA 3LT4A 3ZZNA 1GZ4A 3OEYA 1H93A 2CVZA 4Q39A 4JJGA 2BGLA 3RUDA 1ADCA 3DOCA 4Z6KA 3PRJA 4R1TA 2R2GA 3C8MA 3MCVA 1TI7A 5DCWA 3WYEA 3GGPA 4CM5A 2AHRA 4ND4A 1J4AA 1PJ4A 1LQTA 3RBXA 5F3RA 3INRA 4W9NA 1FDVA 1M76A 4M1QA 4MJLA 2VYVD 1O5IA 2GUGA 3JQBC 2BD0A 2EP7A 4EW6A 1E6EA 1PZFA 4CM6A 3C1AA 4ONEA 2O3SA 3KBOA 4N5MA 4XQ9A 2FN7A 3GVIA 4D44A 4XB1A 4MKZA 2F1KA 1MX3A 4L9RA 3MJTA 4HUJA 4N5LA 4O1MA 2W2LD 2VWQA 2O4CA 3AU8A 4RLHA 3JSAA 3DR3A 3ZHXA 3F5SA 4AJ1A 3VKUA 3BYZA 1U5CA 2C5AA 5FWNA 1QV7A 1XU7A 4TVBA 4J49A 4QX6A 1YO6A 2E82A 3ITDA 4F46A 2XPCA 3GVPA 3RQSA 6ADHA 4J7CA 1DIBA 5T67A 3ETDA 4KQXA 1B7GO 2D8AA 3ZWCA 3UN1A 3IP1A 1DHRA 2JL1A 1EUDA 3AJRA 4CPDA 1AGNA 1OI7A 5DN9A 1A9YA 2Z1MA 2V65A 1JLLA 2PGLA 2X86A 3OFSA 2C07A 4IDEA 3UCXA 5IZCC 2PD4A 4W7IA 3WGHA 2DUWA 1QP8A 1T2DA 5G0VA 1I3LA 3HHPA 3NRCA 1E5QA 1IHYA 4PLZA 3JD1A 3MWDB 5TX7A 4AFNA 5CHEA 3GDGA 4RVHA 2Q49A 4E13A 1DJQA 1GPDG 2BRUA 2JCYA 2Y1FA 3JQ9A 3PZRA 4JCOA 5JMPA 3RJ9A 5KJFA 4TWRA 3BHIA 1GU7A 3D3WB 1Z74A 3PDUA 1E3SA 2D5AA 2XXJA 3R3SA 4FJ2A 5CEFA 3GH3A 3BTSA 4PLTA 5KNLA 3FNHA 5BSEA 3M6IA 1DB3A 1AUPA 4DLBA 2GYYA 1NVGA 1ZK3A 4IIUA 3UUWA 1ZSYA 2EKLA 1YBMA 3MWEB 1X7GA 2PA3A 5JCXA 1VC2A 1EQ2A 1Y8RB 3ZV5A 5DDIP 4DVJA 3L4BC 4BO9A 3GMSA 2AQ8A 3TZKA 3TWOA 3ZI0A 3OECA 3JQBA 2F00A 3E9MA 5IFLA 3GFGA 4GWGA 4O0LA 5TNXA 4KMSA 1Q7CA 5TRTA 2FRDA 3GAFA 1NAIA 3TOZA 1UZNA 3Q9UA 4CM4B 2G82A 2CF6A 4XB2A 4CV1A 3KTDA 1ZSNA 4DYVA 4U6QA 1B8VA 1UXJA 3TL2A 4JP2A 2IODA 4NPCA 1VJ0A 4ND5A 4P22A 5BSGA 3GZNB 4XRRA 4GBJA 3PGJA 3PHJA 4GX1A 1D1SA 1E1KA 3I9JA 4BNJA 3E8XA 3PTZA 4J1QA 1IHXA 3I9OA 1P31A 3GGOA 2JD2A 4BKPA 1X13A 1YXMA 2X5KO 3IKVA 4II3A 4NH4A 1GAEO 2H5LA 1DIHA 1I30A 3A28A 3WBBA 5KKCA 4JQCA 1P74A 2GASA 1WZIA 3LK7A 2FR8A 2NACA 4YJFB 3E9QA 3TN7A 4E21A 3KB6A 3F9IA 3K96A 4E5MA 3DZFA 5HWSA 1LC0A 4R51A 1DC4A 1R4NA 3BHMA 2JCVA 2JAPA 2J3IA 4E33A 1J49A 1DLJA 4YB8A 1M6HA 1K6XA 3FI9A 1B8PA 4DQVA 1HE5A 3KO8A 3TDKA 1JDJA 3R0IA 4RDHA 2ZK7A 3TZHA 3VZPA 1QXSA 4UEJA 3MOIA 3QLJA 2X9VA 3F6YA 4RF2A 1YJ8A 1T2CA 3MZ0A 3GF4A 1P0FA 4HX5A 4RPHA 5BQFA 2EG9A 4TROA 3DL2A 4YWJA 4XKJA 3GK3A 3PI7A 2CUKA 4GAEA 4KTTE 4KZPA 1SMKA 1DC3A 4JGBA 1PGPA 3WLEA 4Q9NA 2OORA 2OMEA 1R15A 3GVCA 3Q3CA 5C37A 3QWIA 3ROKA 4XRGA 4CMKA 1Y9EA 5KIAA 3HE3A 3PYXA 2O7QA 2Q4EA 2EGGA 1YONA 3K5PA 2HJSA 3AI1A 4R3NA 4YJHB 3QSGA 5I9MA 4NBRA 1P0CA 4U6SA 5T57A 3RC9A 4J4HA 4BNGA 3CZRA 3KUXA 1CQIA 3I52A 3NJ8A 2P9CA 4J91A 4CM4A 4DC0A 1NXQA 2HAEA 3NDRA 1UJMA 1O95A 1Y81A 2J3KA 4J1TA 3ZWNA 4GMFA 4DQUA 1K5HA 3DEYX 4WGGA 1E92A 5EL0A 4PLHA 1DIGA 1Z7EA 3L07A 3ZDFA 1EVYA 4BMVA 4JNKA 3VPXA 4D46A 1E7YA 4ZGWA 2HJRA 2YHIA 2Y1GA 3JQFC 2YY7A 3RCBA 1NVTA 1LQUA 1YQGA 4OXYA 1YWGO 1ZCJA 3GZ4A 3HDJA 4IJUA 3QWBA 4Z0HO 1Y8QA 3W8EA 1DO8A 3ETEA 3U4DA 4HFNA 3IAHA 2SCUA 4XGNA 2NM0A 1DFHA 4XQGA 3P2OA 4BKOA 1P1KA 5ENVA 2FZWA 2E37A 2OXIA 1P1RA 3UKOA 1XLTA 1V3TA 2O3TA 5EPOA 3DBRA 3LT2A 1Y5MA 5JY1A 5KTKA 2I3AA 2AW5A 4Q3NA 3OQBA 3VVBA 4RGBA 3I23A 1MA0A 4DTIA 2NUAA 2VRCA 3C7DB 3QWAA 3OEWA 4Z9XA 3CMMA 2CSUA 4ALKA 4GL4A 4MIOA 1QG6A 1VSVA 3EYWA 3RSHA 1QLHA 4ALLA 3B6ZA 4XGKA 4YT8A 1WNTA 4K28A 4ZU3A 3G1UA 1OZAA 3QVTA 3WGOA 2NQ8A 4N54A 4PG4A 4ZRNA 2Q2QA 4IMPA 2B37A 3DDNA 4EITA 2DAPA 4XQEA 1U3WA 1FDSA 3CEAA 3EUWA 3GHYA 3VH4A 2YV2A 3GNQA 1Z7BA 4GMGA 3VPFA 1E3WB 1HDYA 4GGOA 2E48A 2AQHA 3GFBA 5BSHA 4J4TA 5AXDA 3GA0A 4WCDA 1XQ1A 1V3UA 2J3JA 5L7WA 3WTCA 1GPJA 3D7LA 3B1JA 3FNEA 1IYZA 4JLWA 3H3FA 4BKRA 2Y93A 3U09A 4MVJF 1FJHA 3DMTC 3ABIA 2E49A 2Y1EA 5L3ZA 4D42A 4HFJA 3WS7A 2V6MA 3ENKA 3JQ7A 3ZNOA 4NZ9A 4HNHA 4D7AA 1BW9A 2PLAA 3N74A 4Y67A 4II2A 2EJWA 3JQFA 4U8GA 4XYGA 3ZWXA 1K3TA 1BHSA 4U7WA 3ROQA 5TQVA 4PG6A 4WEOA 1EVZA 5JO0A 1C0IA 3KETA 3RVDA 4WKGA 5KKAA 4W7HA 3RAJA 1NR1A 4OGWA 4PLPA 3Q0EA 4AJNA 2YYYA 3E48A 4BNKA 2A4KA 4HFMA 5FFFA 3OJ0A 2YW9A 3SEFA 2YQ4A 3UOGA 1HE4A 1PU2A 3FF4A 5CP8A 4HY3A 3VC7A 2HK9A 2PKQO 2ZYGA 2J3HA 5DOZA 3D64A 3EZYA 4BO1A 1NASA 3H7AA 4JBIA 4LRTB 4Y6RA 5HA5A 5TT1A 5CDGA 2H9IA 3K6JA 4PVDA 2A35A 4MKRA 2GLXA 4UUOA 5HRUA 2EKPA 3JQ8B 3SC4A 3LF1A 3W1VA 3EW7A 5I7EA 4PGFA 3WWZA 4EEXA 4CLRA 4D41A 2NTVA 4ITUA 2ZB7A 4BGEA 2CZCA 1N92A 1ONOA 1M6WA 1R4MA 3ADPA 4N7RA 5C7IO 3DO5A 5CDUA 1DRUA 4BNLA 1TT5B 3KZVA 3NUGA 1T26A 3S2IA 1RWBA 1V9LA 2ZTVA 3S2FA 1GYPA 3WGTA 4EUHA 5IDWA 3PFWO 2EKQA 2VN8A 5A3JA 1ZMOA 4O59O 4CV2A 5HM8A 2HQ1A 6LDHA 2VUTA 3DXFA 1SEPA 3O8QB 1UXGA 2EW2A 4WOKA 2NWQA 5JS6A 4ZN6A 3HDYA 1B15A 1GCUA 5EJ2A 3ZGYA 1AHIA 1P33A 2CDCA 1U9JA 5G4KA 2X0JA 4PLYA 1HDCA 4MDHA 1ZSVA 3ZNQA 3I9KA 2Y1OA 1PTJA 4W9NC 5L95A 4IZHA 1C0LA 3FR7A 3K30A 3GOHA 1U4SA 2BH9A 4YXFA 3S2GA 5ITWA 3BMQA 1I3MA 1U7TA 3GDOA 4WLUA 2DC1A 2H63A 1MFPA 4MKXA 4YPOA 3WFIA 2G76A 1V6AA 3OM9A 4MIEA 1KVSA 2BI7A 2YJZA 4NFYA 5CDTA 2GSDA 5J23A 4R54A 4FB5A 2C5EA 2HKIA 4QXMA 2FPIA 3ZWYA 3DB2A 1UDCA 3CKYA 3DBHA 4ID9A 3DC2A 4OM8A 4BNUA 1Z75A 4CMEA 2WD7B 1DC6A 3B20A 1SB8A 5DBGA 3AUAA 3PJFA 4ALNA 3DHYA 3W6UA 4N5NA 3KYCB 3G0OA 3Q2IA 4I5EA 4NG5A 5A1TA 4UUPA 2R6JA 1BMDA 1YVEI 2DUUA 4G65A 1KIFA 2CY0A 3IKTA 4OQYA 4NDNE 3M2TA 4ZQEA 2I5PO 5CEEA 4MP8A 3RKUA 2YFHA 4CODB 1K0UA 1YOVA 1VPDA 1ADFA 3JQGA 1EE2A 5F1KA 1IB6A 2H1SA 5THQA 3VHRA 2PKQP 4BO0A 2VQ3A 5EIOA 3HDQA 4J1SA 3PIDA 3U4IA 3NT5A 1AHHA 4I5GA 1LDYA 1K6IA 3W6ZA 3D4NA 5BT9A 4U5QA 4DBVO 4NI5A 1XG5A 5G0UA 1ENOA 1JAXA 4NU5A 4RZHA 3FPCA 2C7VA 4WPGA 1T4BA 5F5NA 4L4RA 3RASA 3LT0A 1HDGO 2DTDA 1XDWA 4BVAA 5U9CA 2BFAA 3TF5A 2AG5A 4E5YA 3W8DA 5KVVA 4LN1A 5C5IA 5K0ZA 3ZH2A 1P44A 1Z6ZA 2VYNA 1DDOA 1Y8QB 1CF2O 1ZXLA 4DPMA 3OSUA 4E6PA 3PQFA 4ALIA 4Y6SA 3C24A 3PWZA 1FF9A 4OJNA 1DFGA 4R4JA 1UH5A 3ZU4A 4AJLA 3TNLA 4FOSA 4XR9A 2OFPA 2HK8A 3WX0A 2BI8A 1Y1PA 2C2YA 2P2SA 2GD1O 2UV8A 3I9MA 3DMYA 1DSSG 1NWHA 1ZXBA 1PQPA 3AUUA 1LDNA 3GEGA 4IDDA 1BTOA 4CM7A 4QFDA 1HE2A 1DIAA 2AQKA 1WZEA 4MVJI 2HCTA 4BNNA 3QE3A 3KYBA 4ND2A 3INTA 4WUVA 4I9NA 3OF2A 1ONNA 3FR8A 3AOEA 4GX0A 5A04A 2JHGA 1SB9A 3CINA 5FYDA 1F8GA 3KM0A 2FOIA 5JSFA 4BNZA 1XR3A 5A02A 1ADGA 3PYLA 4F45A 3T7EA 3ZWBA 3L4SO 4JXKA 1PS0A 3C7CB 4D3FA 1E7QA 4HNGA 2FPPA 3ZW8A 3K73O 1LUAA 5AXCA 3N58A 1CDOA 5TC4A 3KYDB 5A5EA 1EDOA 1MGOA 3JQAD 4J2HA 2XAAA 1LA2A 3ICPA 3MJEA 1ZEJA 2WDZA 3EMKA 4IDGA 1FDTA 4CMBA 4B79A 1BW9B 2NVUA 3WIDA 1MC4A 3GVXA 2Q3EA 1BXZA 5H82A 4YYZA 5FEUA 2YDXA 3C85A 3WQQA 1RM0A 2Q99A 2RH4A 3HN2A 3KEOA 4RPKA 3QJ5A 1ORRA 2Y0EA 1C0KA 4DBZA 4XCVA 3ST7A 2VWHA 1ISHA 2NADA 1BSVA 3QWHA 4IY1A 3ULKA 2PH5A 3NKLA 4BNFA 2ZKLA 3RBZA 1H2BA 5GZ3A 2NVBA 4EUEA 1B2LA 3ZHZA 4BKUA 4J2OA 1LRKA 4TKMA 4KDFA 2RHCA 4NFHA 4RPLA 3ITKA 1CRWG 2Y99A 2PY6A 1P77A 3QVSA 5H81A 3UH1A 4J4BA 1EMDA 2B83A 1M67A 1HLDA 4FDAA 3L0DA 2BGMA 3WR5A 3HDHA 4BHTA 1T2FA 4DL9A 3W4IA 1B16A 1LRJA 4RVSA 3O9ZA 5KVSA 1W73A 1TT5A 2X22A 4YAIA 5KJ6A 4UUMA 1GDHA 1YOVB 4J1NA 1JAYA 2O50A 2FR0A 3VPSA 3MOGA 4YEDA 2X4GA 3ETGA 2X6TA 1UP6A 3GR6A 1XHLA 5A5FA 4B3HA 2OOSA 3ZWVA 3QRWA 1W0CA 2DU8A 1KEWA 4KUEA 1V35A 4QECA 3WMWA 1YB4A 2PZJA 2IRWA 5JXWA 3MTGA 4E3ZA 1E1LA 4QTZA 1GADO 5I8ZA 3I6QA 1LBEA 4LMRA 4PLWA 1E7RA 1PJ3A 2BGKA 4CR8A 5COAA 1HDOA 2CDBA 1TB4A 3SVTA 1DRWA 2WEKA 1GZ6A 1I0ZA 3FSRA 1LLUA 2B36A 5TJ9A 3WFJA 3BZUA 4PG5A 3ZHBA 1F17A 1MG5A 2TMDA 3ICCA 3JYPA 2CD9A 4GWKA 3RU9A 4ZJUA 1FXSA 3WGIA 4OH1A 1XU9A 2LDBA 2P4QA 1NR7A 3ENNA 1ENZA 3F3SA 1PJBA 1MLDA 1EEHA 3TFQA 5JDIC 2X9NA 3E6AA 3GG9A 9LDTA 2O3UA 5HTOA 2RAFA 3IIEA 3JQAA 2CVOA 4DWVA 2PWZA 3V1YA 5JAIA 2HO5A 4FC7A 4B7CA 4E31A 1P3DA 3SJ7A 3B70A 4WCFB 5IXSA 4E5KA 4RLSA 2YDYA 1GQYA 2WTBA 3DZGA 5T8KA 3PXXA 1PSDA 4E2ZA 1EE9A 2QIOA 3PWKA 1IPEA 1R4MB 1DEHA 4ZQFA 5JAMA 1JWAB 4A73A 2O2SA 3CE6A 1ENYA 4MP6A 2DT5A 1OFGA 2I6TA 4A0SA 4QT0A 2PH3A 3PJEA 1JN0A 3H9JA 2WYUA 2P4HX 1LDMA 2PNFA 5F1PA 4RZIA 1ZBQA 1HF3A 1YDEA 1DOHA 4YJHA 4P8RA 5TT0A 1DBVO 1LNQA 2FSSA 5JFOA 3E5RA 3OICA 1XWFA 4D43A 5F5LA 3TZCA 4LW8A 3RKRA 1BDBA 5IZCA 1ZUD1 1BGVA 1G6KA 1I10A 3DQPA 2IYPA 2I99A 4YRDA 3DHNA 2VRCD 2HMTA 1U28A 3INGA 4CM8B 3I4CA 2FP4A 1H0KA 4K6FA 3DONA 4PN3A 3D0OA 3OJEA 1O0SA 3E18A 3A1NA 3A4VA 3IOYA 3DTYA 4WK6A 3VPHA 1B8UA 3L6EA 2E4AA 2X23A 4OSPA 3U4HA 2O23A 1E7SA 4R9RA 1E3EA 1CQJA 1T1SA 1U3UA 1VJTA 3C3XA 4FW8A 4P4NA 3X2EA 4BUCA 3OA2A 4NFSA 3GGGA 1S6YA 5JDCC 4PLVA 1WDKA 1NAHA 4HP8A 4MVJP 1YKFA 3DFUA 3ANLA 4TRMA 1AXEA 4IJWA 3NTQA 4PLFA 1Y5RA 4XYEA 4BS9A 4CJXA 1YBVA 1HL3A 1N7HA 1TA4A 1HWYA 3OIDA 3BTVA 3QHAA 1Q7BA 1JW9B 2HDHA 4XZ3A 4YRBA 3EY4A 1Z82A 4P38A 1NFRA 1I2BA 3QVXA 4JJIA 1M66A 4RPGA 3D4OA 1IZ0A 1T4DA 3BMOA 1E3JA 3GZNA 4BQRA 1P1IA 2PV7A 1HDRA 4EJ0A 2CVQA 4KP7A 3VDRA 5K6AC 3UAGA 1QR6A 4WCFA 2IXBA 3OQ1A 2HUNA 3OJFA 4MOWA 3GT0A 2AXQA 7ADHA 1HTBA 3RBVA 2O3JA 2AA3A 4LSWA 3WMXA 2Q1TA 3TPCA 4R9SA 4B7UA 1EVIA 1ZJYA 2Y67A 4E5NA 4YT4A 5L45A 1NQ5A 3RIHA 1ZVMA 4MINA 1PL6A 5U1PA 1ZNQO 4OIMA 4DMLA 5BSFA 5AXAA 1HETA 1I36A 4EEZA 2Y0DA 4E12A 2HRZA 3OQ6A 4HWKA 2J5RA 3WQRA 1CWUA 2V6BA 4BNVA 1U8XX 3RUEA 1WPQA 1QRRA 4B8ZA 3A14A 4DIOA 4UUNA 1TVEA 1JKFA 1TXGA 4TRRA 4FJ1A 2DVMA 4DXHA 4L4XA 4OXKA 4BO7A 2HU2A 3BA1A 3R6DA 4TMFA 4ZQGA 3UICA 3ZN2A 1M75A 2J5KA 2OL4A 4JBHA 3WBFA 3F4BA 4S3MA 1ISJA 3VVCA 3W4KA 5L53A 2WYWA 3ZNNA 1D8AA 3Q6IA 4OKIA 1U4OA 5A9SA 5IJZA 2VNSA 4GVLA 4PRKA 4Q3AA 4B7XA 3QIVA 1WDLA 3ZNPA 4B8WA 2XF8A 1Q0HA 4E32A 1RJWA 4D45A 4EJMA 2Z5LA 4IM7A 3DBLA 1PZHA 1U2DA 3O8QA 4FD3A 4Z0PA 2UUOA 3PJDA 1KY4A 2GDZA 2VHYA 4DPKA 2GPTA 3K2EA 3HB4X 3PK0A 4TZKA 4FQ8A 4P4LA 4A03A 2I66A 4GQAA 5DNAA 4O5OA 4WLFA 1RM3A 2ZCUA 3BMNB 5CEJA 4BMNA 5IAAA 1MXFA 5HBRA 4I5FA 4DMMA 2ZQYA 4NU6A 3WSWA 4XDYA 1GYQA 3M1AA 3WB9A 4DA9A 4PG7A 3U9LA 4HXYA 3TZ6A 4L8VA 2VYND 3HZZA 3BMNA 1EUCA 2FHSA 2W2KA 4BGVA 3C1TA 1C1DA 1KS9A 5JY6A 1IOLA 2VUSA 4FGWA 3OIGA 1O89A 4LCJA 1WXDA 2X0RA 1E6UA 4F6LA 4J16A 3V1TC 3ZWAA 2D59A 3SLKA 5KJ1A 5JC8A 1XA0A 2W2KB 1DPGA 5L7TA 2I76A 3LC2O 4E2XA 1LLCA 2W90A 3LZ6A 4AICA 3H9QA 3Q2KA 1KOLA 5EN4A 1GV0A 3JYLA 4BOYA 4FFMA 1QYXA 3KYCA 4BO6A 1X1EA 2B5VA 3PEFA 5DBIA 2WMDA 1MG0A 4WLNA 1KVQA 3T4EA 1VL6A 5GMOA 4CL8A 3JQEA 3WDSA 1RKXA 1SBYA 3U3XA 3D1LA 3CXRA 1R0KA 3V2GA 4FFOA 5COQA 3PLNA 4OOFA 4Y9DA 5KWEA 1O9BA 4XIYA 2O48X 3WQSB 4XYBA 2OP0A 4LCEA 3WXBA 2NTJA 1XELA 3DAFA 4FIZA 1I5RA 4LMPA 1VRWA 3PIIA 4E2WA 5A4DA 2YUTA 4RORA 3HJAA 4XX0A 2NU7A 2JD0A 4KWHA 3COSA 4OL9A 2Y0CA 3F5QA 3LVFO 1YQDA 3F1KA 4U0JA 1GYRA 2X8LA 3E1KA 3NTOA 2O4UX 4RF5A 3L9XA 1RYEA 3DFZA 3NT4A 4R5HA 3MJ4A 5MDHA 1BG6A 2DQ4A 4CMGA 1DAOA 3HFSA 2VNAA 2CDAA 2PR2A 1AN9A 2EWMA 2VCYA 4IDCA 3I4FA 1I01A 4BB6A 5MGBA 3H4VA 2VHXA 2P5UA 4IDAA 4BO2A 3VH3A 4J90A 2Y1DA 1FDUA 1GUYA 2IYOA 4YRAA 5ILGA 1VLLA 2GR9A 4H7PA 3TFOA 4QEDA 5I7SA 1A9ZA 3PHHA 1DC5A 3I5MA 3DBRB 4W99A 5JAZA 4ZQBA 3ROPA 3K8ZA 2BELA 2AEFA 4YAEA 2GF2A 2Q50A 2ET6A 5JPIA 4NBWA 3PP8A 1HRDA 4YAJA 4A5OA 4Y6PA 1NWCA 1HYEA 4K26A 2JFGA 1NNUA 4CMCA 3GLQA 4FC6A 5L7YA 4L4SA 4BNMA 4RQUA 4YQZA 2DFDA 4GSKA 5DULA 3OH8A 4B4VA 1ISGA 5JC1A 4AJIA 3MJVA 1LLDA 7MDHA 3GNTA 3RUHA 4AJOA 4JX8A 4UREA 1GR0A 1Q0QA 3DTTA 3AFNA 1JKIA 1XCBA 1YGYA 5I9LA 4DYDA 1O6ZA 1BXGB 1JQBA 4YA6A 2HMWA 1EQUA 3LSYA 1QYDA 4RQTA 3FN4A 1F12A 3KEQA 1A72A 2NNLD 4CM9A 4E4YA 4XA8A 5IDXA 3WICA 1PJCA 4INAA 2X58A 4D3SA 1PJLA 1B3RA 2C0CA 4YJGB 5G0TA 1PGOA 2G5CA 1JU9A 1I2ZA 1UZLA 4U0KA 4RDIA 2JKVA 1U1IA 2B4RO 1JVBA 1OAAA 4M49A 5KJEA 4PZDA 5CDSA 3V5NA 3PHIA 1KYQA 2AMFA 2JFHA 1N8KA 4BKQA 2CNBA 2Y66A 5JYDA 1WMBA 3B1KA 4R68A 4IXWA 2PGDA 4D3DA 3LDHA 4Q3CA 1X15A 2YHIB 4A26A 1WAMA 1I24A 4OSOA 1EZ4A 3BMCB 4ND3A 1NM5A 2AE2A 2XOXA 1DLIA 1I2CA 1N1GA 1SOWA 4GGPA 3KRTA 1E0DA 4WLEA 2CMDA 2PKRA 1ZJZA 3EVNA 2NV6A 3T4XA 2XXBA 4I5DA 5B37A 4WE3A 1CETA 1PGQA 3AOEC 4AVYA 3AY7A 1GQ2A 1LDGA 2G1UA 4CV0A 2DBZA 3GDFA 3GG2A 3OETA 3NAQA 5DP1A 4ZHSA 4Z3KA 3AUSA 2DBRA 3EHEA 4IIVA 1TT7A 4OQZA 5ER6A 1B3BA 1UUFA 2JCXA 1LC3A 3SJUA 4ROSA 4RVUA 2WJPA 4CM1A 4TVOA 1MFZA 4BV9A 1KY5A 4K9DA 3RD5A 4DPLA 5IDQA 1K89A 4A27A 3HQ4O 1E5LA 1VI2A 3KSDO 4M55A 3GY0A 5LDHA 3HG7A 3ZWWA 1PS9A 2A92A 3I9LA 4WLOA 2VWGA 4J43A 1XKQA 3UFXA 3VH2A 2EP5A 2QZZA 4GX2A 3G49A 1W8DA 4ILKA 4TQGA 1EUZA 4BQPA 1UDAA 1PEDA 3LQFA 5K6AA 4JIGA 1QV6A 2JJYA 1ZKMA 3JD4A 1OMOA 1WDMA 4KUGA 4M54A 2O3QA 2DPHA 2DTXA 3QVWA 4I9UA 5KJCA 3FNFA 1JA9A 4XWYA 1UAYA 3FRJA 1NP3A 2IZ1A 2YHUA 3GUYA 4W6ZA 1QKIA 1U7HA 3QY9A 1EFLA 3F1LA 5JCJA 3D5TA 3DBLB 5TGDA 1UR5A 3QW2A 4A2CA 4AL4A 4CR7A 4C7JA 1HLPA 3FHLA 4G2NA 4IXTA 3Q1LA 2FZEA 4KWIA 4BNHA 3WTBA 4AG3A 3S1LA 4HBGA 4CMAA 4L74A 5IG2A 3H5NA 4I1IA 3KV3O 5L4NA 3UXYA 4CV3A 4CMEC 4GX5A 4J6FA 1A71A 3EK2A 3FNGA 5T64A 1LXCA 5TJHA 2D2IA 2X5OA 1PR3A 2ZTUA 1NFFA 1PZEA 2ZB4A 3DZIA 4Q3EA 3UCEA 4CLEA 1BVRA 1PX0A 1FMCA 4AJ4A 4CUJA 1LTHR 3L77A 1N1EA 9LDBA 2VUUA 1U2GA 4CQMD 4PLGA 1H6CA 5TSDA 2P91A 4R1NA 1EFKA 1U5AA 4O63O 3BMCA 5AQ1A 1MV8A 3JYNA 3NDIA 5A05A 4YTEA 3GC6A 3P2YA 2Z1NA 1IPFA 1VKOA 3IUPA 1GD1O 1SZJG 2QW8A 1LJ8A 4I9HA 4ALMA 3HFGA 1R0SA 1CERA 3VDQA 1HYGA 1LLQA 1UP4A 4IS2A 4RVGA 1EVJA 2RCYA 3H5AA 4CR6A 1NBOA 2O3RA 4J0EA 3H2ZA 4CMJA 1NYTA 4ZICA 4CLOB 2J6IA 1ID1A 3MJSA 5B4VA 5JBIA 3KLPX 4PIVA 2DPGA 4WNIA 3C7AA 1KETA 1YJQA 1BXKA 1MXHA 3NGLA 3OBBA 3G79A 3IS3A 4K6CA 1YH3A 5TIIA 1BXGA 5K9ZA 1GQQA 1PL8A 4GLLA 2WE7A 2VOEA 1PGJA 2ZB8A 1ZK1A 1Z45A 1HT0A 4L75A 4XGIA 5EESA 3FBTA 5BR7A 2QYTA 1DXYA 2O2YA 2ZTLA 3NEPX 3DZHA 2X7HA 1T2EA 2HRBA 1SEVA 1VJ1A 4M86A 4YVFA 5HS6A 4TRNA 4GVXA 4BO5A 4Y8VA 1NTOA 1T1RA 4G5HA 4G81A 1LSSA 1HYHA 3OJLA 4UVHA 3NTRA 1R16A 5FF9A 4Q3BA 1UZMA 2EW8A 2ZATA 4M8SA 2VZ8A 4CM8A 4FGSA 4ZA2A 1H94A 4ZRMA 2YV3A 4NHEA 5A06A 2GCGA 2B4TO 3K9QO 2C2XA 1N5DA 2DTEA 2FSVA 3D3EA 3JD3A 1KVTA 4RL6A 2X0IA 3GEDA 3GRPA 4L76A 4LISA 3ANMA 3ZV6A 4OXNA 4Z9YA 3PHGA 3STHA 1BVUA 2GN4A 1PJ2A 3F47A 4L73A 1YL7A 3OP4A 4TSKA 3ZW9A 1QMGA 5H83A 4XEHA 3O03A 4RF4A 3VOSA 1DJNA 2GN8A 4YJFA 3E5MA 4R01A 5GZ1A 1P1FA 2EERA 4LVUA 2BFPA 3R3JA 1GEGA 2R00A 3O38A 3ZV4A 3GAZA 1R4NB 1V8BA 3U0BA 5IZ4A 4DC1A 3BXXA 4PZEA 2ZJ0A 4PCVA 3GNSA 1WP4A 4FBGA 4H15A 4WCFC 2NQTA 2FWMX 1VL0A 3DHEA 2JHFA 2E6UX 4EYEA 2X0NA 4XDZA 3NT2A 4WOJA 1HZJA 1E6WA 1Q7GA 2H6EA 1WW8A 1R66A 4QFCA 1IUKA 4NQZA 3JQGB 4CM9D 3RI3A 3GN1A 3RROA 1PL7A 3RU7A 1N7GA 3CSDA 4BNXA 3PVZA 1PIWA 4ND1A 2BKAA 2GRAA 2Q46A 3NDJA 1HSOA 2NVUB 2GGSA 3L6DA 3LLVA 1OBFO 1HE3A 4IZIA 4JN6B 2WD8A 4HADA 1E3WA 3JCZA 1G1AA 2OP1A 3HADA 3ZU2A 1LDEA 2Q2WA 3AFMA 1GTMA 1R0LA 4UVIA 1MC5A 3DBVO 1KEVA 1PQUA 1YE3A 3O26A 2QZ9A 3UF0A 4I8XA 3W4JA 2VRBA 1KERA 1N9GA 4NR0A 2W4QA 1T24A 3C1OA 1PJTA 4E30A 3PQEA 2WD7A 4BO4A 2G17A 2DBVO 2VT3A 4NBTA 5IN4A 3ZWMA 5A9RA 5TF4A 3U62A 1Q0LA 1CYDA 1VSUA 3D3WA 2J8ZA 5ICMA 1SO8A 4PZCA 4YACA 2ZYAA 2DKNA 4RCVA 5G0WA 3QWFA 5A9SB 2BLLA 2EXXA 1FDWA 4RJTA 4AJ2A 1YL5A 5EINA 3EAGA 5ES3A 1KVUA 3CH6A 2HMVA 3PGXA 1WLYA 1ZMTA 2X1HA 4KDEA 4FFLA 2A94A 4CLOA 3D4PA 2P5YA 3PFFA 3H9GA 4DREA 3H8VA 3JQCA 4IMRA 3SC6A 1XSEA 2O7SA 2Y1CA 4BV8A 2GO1A 2EIHA 2DBQA 3N7UA 4E5PA 4CMIA 4Y98A 4XJSA 1KEUA 1MUUA 4CLRB 2ILTA 3IC5A 4CQMB 2BF7A 3VZQA 3PYMA 2D0IA 1GZ3A 2FR1A 3S8MA 2BMAA 2HSDA 4FFPA 4R3WA 1F0YA 1IZ9A 3QQPA 3RC1A 3WYBA 4KTVE 1O8CA 5DCUA 4D79A 4A10A 2EEZA 4JROA 1ZIDA 3B1FA 4URFA 1EDZA 4EZBA 3LC1O 4PG8A 5JDIA 2P9GA 3BMOB 2VZ0A 4O6VA 4ESOA 2B35A 4F3YA 1HSZA 4YBZA 4IGFA 3PWSA 4WECA 2ZB3A 5BNFA 4NJMA 8ADHA 1Y9AA 1KVRA 2IZZA 3JV7A 4JP3A 1GFSA 2RBEA 3P19A 3HNPA 5U4QA 1VM6A 3TSCA 1C3VA 3IP3A 2NLOA 1NQAO 3T7CA 1T25A 4GKBA 8LDHA 1XIVA 2GN9A 2X5JO 2CF5A 4FCCA 5DOVA 5HS4A 5CPBA 1QYVA 1OOEA 3ONFA 2BFOA 5KCZA 4XJTA 4XD2A 3TJRA 1H6BA 1Y6JA 2Q2VA 3JQ6A 1QYWA 3M1LA 4FJ0A 1B14A 4N18A 3TOXA 3G1TA 1RPNA 3TL3A 1NFQA 2B5WA 1LDBA 3EVTA 4D0RA 2D1YA 3JD0A 3JQAB 1NQOA 1F14A 4IUYA 2IEDA 4HFRA 1PQWA 1HDXA 1ZEMA 2DFVA 3P7MA 4BNWA 1NHWA 1GEEA 1P45A 2C82A 3DWFA 3I1JA 3H2SA 3IDSA 4UEOA 3IQDB 1P1HA 1YB1A 2VWPA 2IE0A 2C20A 2JAHA 1HEUA 3JTMA 1R12A 2PTGA 3Q11A 3F4LA 3S55A 4E2YA 3OMLA 5TLSA 4RV9A 4DIFA 2AG8A 2DLDA 2I3GA 4WJZA 4TKLA 4UVEA 4CL3A 3RJ5A 2Q45A 3FWZA 3UGKA 5ITVA 3RUFA 4A7PA 2WYVA 3BIOA 3D5QA 3H6KA 3UVEA 3WLFA 4IDFA 1PJQA 1ZFNA 5JNLA 4OKNA 4GH5A 1H6DA 1UAGA 3F46A 3KXDA 4H16A 2QQ5A 1X7DA 1QLJA 2EHDA 1K2WA 1QSGA 3HUDA 1RM4A 3VZRA 2G0TA 3LT1A 1ADBA 3OJOA 5JLAA 4ALJA 1A4UA 4OOEA 4ZVVA 3FTNA 1U8FO 4R1SA 4B4WA 1ULUA 2OBNA 2NSDA 1D7OA 5A9TA 3CPSA 3GPIA 1Q1NA 2AQIA 3X2FA 4QQRA 3QVOA 1YL6A 4OYRA 4R1UA 3DZKA 2V6GA 4B3IA 4EI2A 2V7PA 4E0BA 4NJMB 2OUIA 3H9EO 4HKTA 4NBUA 3PHLA 4WASA 5JAQA 1LEHA 2OO5A 5ADHA 3CIFA 2IXAA 4J7UA 3AY3A 1KBZA 2Q4BA 1A5ZA 3JQ8A 3WIEA 1T2AA 3IJRA 1J0XO 2NVWA 3NYWA 1LSJA 1LI4A 4GLOA 5AYVA 1X14A 3SXPA 5DT9A 2Y68A 2B4QA 1H2HA 1B26A 2BFMA 2QRKA 1SPXA 1GUZA 3AM5A 2GNAA 4Q3DA 5DBFA 3K92A 3GQVA 3FTPA 4AJPA 4CQMA 4BO8A 3I9NA 5DF1A 3BAZA 3CTMA 3ONDA 2JFFA 5A03A 3DOOA 2GZ1A 1KEPA 2POQX 1PWZA 2D5CA 4EDFA 3RC2A 1E3LA 5DZSA 4J9VA 2NU6A 4WEQA 3SBOA 2VHWA 1VL8A 3PLRA 4IQGA 3KSZO 1N9GB 4RVFA 5L9AA 3JYOA 2B0JA 3JYQA 3ASVA 3EZLA 3HB5X 4DIBA 2ZCVA 4MVJD 2W2LA 1B0AA 2GZ3A 1RM5A 3GHHA 3RFTA 2VTEA 4W82A 5ICSA 2PGJA 3RFVA 1W6UA 1H5QA 4PRLA 2QYSA 3IJPA 3PQDA 3TRIA 3ON5A 3GN2A 3SLGA 4NIMA 3IL2A 1GCOA 3ANNA 5G4LA 1IY8A 2OHXA 2PZLA 2BHLA 2C54A 2IDZA 3MJCA 1C1XB 5CDYA 4ZD6A 3NX4A 2VOJA 2VT2A 2OGUA 4P4GA 4UVDA 2EGHA 3FCOA 4UULA 1DHTA 3EC7A 4B4OA 1ISFA 1J5PA 1M2WA 2EJVA 4NMHA 4YQYA 4WNCA 2D4AA 1H6AA 4HV4A 1AE1A 3AW9A 1U3TA 5COBA 4FN4A 1Y7TA 2FMUA 4X54A 3JD2A 5EMHA 5AXBA 2Y05A 1JVSA 2HK7A 1BWSA 5G0SA 1DIRA 3ZWOA 1PS8A 1PWXA 1E3IA 2VTDA 3VKVA 4PVCA 1Z73A 4DRYA 4J9UE 1HDZA 1I32A 4MVJA 5KVQA 2ZYDA 1D4FA 2P9EA 4NNJA 2WWRA 5LDGA 1A27A 1GUFA 1ZZEA 5F21A 1UXKA 3CUKA 4BO3A 3HN7A 5JDCA 2GZ2A 5FI3A 5KOIA 1ISIA 2UVDA 4RO0A 3HWRA 1YB5A 3RUCA 3NJ4A 3GUCA 5CPFA 2CFCA 3ROMA 3I3OA 3WWYA 4CUKA 4XIJA 3WJAA 2UDPA 4R5MA 1R37A 3AWDA 4OMUA 2QRLA 1XYGA 1RYDA 5IXYA 1KC3A 4RF3A 3IUSA 3U49A 2Q1SA 3OA0A 1ULSA 2Q1UA 2EV9A 4M89A 2QG4A 1A7AA 3AY6A 1NPTO 3K2BA 4XYMA 1GV1A 1XEAA 4BNTA 4EUFA 1LU9A 1UDBA 2ZIZA 1K6JA 4FR5A 5AOVA 1C1DB 1IE3A 2OBYA 4QSMA 4BGUA 2RIRA 2UAGA 4IJKA 3JQ9C 3WG9A 1G0NA 1VKNA 4TRJA 1ZO8A 3DOJA 1JKJA 3W8FA 4LRSB 3PJGA 2Q1WA 3RWBA 2ZTMA 4XQCA 1L7EA 2QX7A 5L40A 2WSBA 1BDMA 1FK8A 1LSUA 1H9BA 4J0FA 5CFZA 3BTUA 3WGGA 4EBFA 1F8FA 1NPYA 1A7KA 1OC2A 3KLMX 1ARZA 5GZ6A 1JTVA 2P68A 3H5RA 1SOVA 1LSOA 2NU9A 4JK3A 4KUHA 3ADOA 2RH8A 5DCYA 1CIVA 3LYLA 1I3KA 5LC1A 1X0VA 3WOHA 4C4OA 5F1OA 4XR4A 1EBUA 3ZWPA 4MO2A 1SCUA 5THKA 1QYCA 1O94A 1VE9A
chains in the Genus database with same CATH superfamily
3H2YA 4C3ZA 2P35A 1J6UA 1SUFA 1FRFS 1I7QB 4C0KA 5C7OO 1F2TA 1MAAA 5I9NA 4ZALA 3OEHD 3AB7A 3KWJA 2AX3A 5G40A 1RRCA 2X77A 1L4UA 4QU0A 6PFKA 2JJ1D 3MTJA 1D2MA 4OHCA 1JJBA 3CRVA 3MMSA 4DLLA 7MDHA 5L51A 4XFDA 3AI7A 3A9SA 2IYWA 1E2LA 3IUJA 5ALEA 5EERA 3AW8A 3BCRA 4WZZA 4A16A 4MUGA 5JYCA 4L50A 5E0KB 2BFEB 1YQXA 1Y33E 2ZS8A 4RPJA 1E4OA 4BPBA 4G0MA 2JGMA 4OAQA 4G4IA 3EXEB 5K0BA 3OFJA 3ZU3A 2B20A 3QP9A 1U9IC 2PGXA 2I2XB 4CG0A 4HGYA 4EO7A 1ORIA 3NP7A 3E58A 1NQTA 5CM9C 2YIVX 2R00C 3O9MA 5KVCA 3IT3A 1WHTA 2E6KA 2CUNA 1AKQA 1CZOA 1TTQB 1XLWA 4W9RA 1CY4A 4EJ6A 5JCZA 1J0CA 1VLJA 4FMDB 4OHOA 1P7PA 2R7LA 3WGYA 2C29D 3L7LA 4I4TA 1M2FA 4R41A 4BMPB 3NQ41 3UHAA 1VE1A 5EJIA 4OI4A 5IMSA 3I2FA 1WMSA 3F5FA 4HLCA 3M5DA 4ZV9A 5JD4A 4EYOA 3DMTA 2NU8A 1DEXA 4M22A 1TVKA 1T9CA 2W5UA 2Q3MA 4GKVA 4QOHA 1JZSA 3MCTA 5HQ3A 4YCAA 1GXSB 3I73A 4KXLA 5LB4A 1YJ5A 4BXOA 1MD9A 4I50F 3CUWA 4LZOA 1DADA 1FP2A 3MBOA 3OLWA 2WWWA 3SQNA 3WYGA 1VLMA 1OXMA 1USGA 1I7SB 2BM8A 2VT7A 3UC9A 2Q6VA 3KJFA 3UJ6A 2OLEA 3QFTA 2Z8YA 1S7CA 4KFRA 1E1MA 4DQDA 4IGIA 4L08A 4BB5A 4P7KA 1L7BA 1T3ZA 1R6AA 4JVMA 4JJFA 3V2UA 3ICEA 5ALPA 3TJZA 3G3EA 4B3BA 4XOUA 5TS3A 4I08A 3VPGA 1TLTA 1Y3IA 2AG6A 1JFRA 3DOFA 1XPRA 2MINB 4BIIA 1IULA 1ZU4A 3I6IA 1Z68A 2I1LA 1I1QB 3IBYA 5HE8A 1UJ6A 3U4CA 1YB7A 2GARA 1E77A 2I4MA 2IOFK 2EL7A 1NMQA 1TC2A 5JSKA 1JWBB 2QI9F 3B9QA 4IDPA 2QA5A 1V3VA 1C3OA 2NTNA 3DEFA 4QICA 5SZJA 4D4IA 4DHWA 1I8TA 3IB6A 3KUKA 1FBNA 2C61A 3TIVA 5LP6F 4YRSA 1XQ6A 3CV3A 1CHNA 4XD7D 5EXSA 1L7DA 1CR4A 2YR0A 3MLBA 2JG3A 2FZGA 2Q9BA 2WKSA 2QRJA 1K27A 5JW6A 1L7QA 3VTFA 2CJPA 1MZVA 5IEJA 2C3MA 3O4HA 3S7ZA 4QOGA 1OGIA 1ZNWA 4CIXA 1JHRA 1G0OA 5FX2A 4IQ0A 1DKPA 1U8UA 3TIXB 1V0JA 1DAPA 2VYQA 3B6KA 1SWVA 4YJ3F 1BQEA 4ED9A 3C3KA 1DKLA 2BM0A 2DERA 5ALQA 1GPMA 1XCMA 4MIYA 3AI2A 2OZEA 4ZANA 2GAIA 2FYTA 4ZK6A 4BY9E 5C7LO 5E0OA 2YCLA 3W7BA 5KSWB 4X5OA 3UW3A 1MH9A 4JJEA 4FLMA 2AJLI 4K2AA 4OO3A 1DKQA 5E9JA 1XXHE 2YFQA 5AT1A 5JYEA 4LVCA 2PUEA 2G28A 2JZOA 2P9QA 4OGLA 5T6MA 3WJ7A 1Y8RA 4HS9A 3GEEA 4JU8A 4FFNA 3R0VA 4KYUA 3IUNA 5BNIA 1EWTA 1WB5A 1W85B 2YWDA 3HLYA 1Z18A 1R9JA 3GRUA 4MPDA 5BN4A 3PGVA 3RRZA 3NBZC 4R8SA 2BEUB 2VCHA 1P9OA 3T7DA 1R6BX 1VHJA 5M34A 2QRVA 3IP8A 5GY7A 3CMCO 1BCRB 1N0WA 1W4ZA 3KPUA 1V37A 1AXRA 5HX7A 1IY0A 3AETB 3ELBA 2Q4TA 1J1ZA 1IBCA 3RFXA 3V3KA 4BXOB 4IX1A 4NCXA 4PFSA 2GM5A 1XNRB 4OMDA 3PDCA 2C2BA 2PT9A 4CEHA 4HGZA 4UU8A 3KPJA 1GY8A 4YDRA 3Q9NA 2HFJA 4KQWA 4OB7A 4QUKA 3L9WA 3PTAA 1EHIA 1OC4A 3OHSX 3TMYA 1OXSC 2PT5A 4MZXA 1XRSB 1HT1E 1CR0A 1S8OA 3WNQA 1YDWA 4PO1A 3C3JA 3WSTA 3PPIA 1HXHA 1AK2A 1S1CA 2OB1A 4UEWA 1OLUA 1V26A 4IDBA 3PSAA 4NE2A 5J43A 1M1ZA 3E9NA 4B7AA 3O4RA 3TNDA 1AKVA 3G9TA 4XYLA 4MVJG 2VF8A 3ET5A 1COWA 1TF2A 2QDXA 3JPYA 4FYKA 4X6UA 3OPMA 3VYUB 5I8WA 4FOOA 2W6JA 3VZDA 2V6IA 4FFRA 4FFWA 1HKUA 3BHNA 2GD0A 2Q5FA 4WFIA 4YHBA 3HY4A 4N0EA 4R2HA 3GIDA 2G4LA 3QKIA 2XMPA 2QHXA 4JX9A 2J5QA 3DBHB 4B80A 1T6YA 4BL5A 3BBPA 1H2WA 4M9QA 3I01A 3PEVA 4RSGA 5TPZD 1UXHA 2ZJ1A 2NZWA 4WADA 1ABEA 2PMCA 1U1EA 2GN6A 5A3VA 1J0DA 1MU0A 2GPSA 2LW7A 5EP3A 3T1TA 4CLDA 5B1YA 2X7JA 5BYAA 2JATA 1AQIA 1I7LA 2OXRA 2CB0A 2ZITA 2VSFA 1QUFA 3FGOA 4GP7A 2JI8A 4KRGA 4Y1FA 4JI0B 2XEDA 2B1IA 2V4MA 2IPMA 2W71A 3MYYA 1XMQB 2GJAA 1X7HA 4B4UA 2GM4A 5CG2A 4DLAA 1MJGA 5I4KA 1YR9A 1I7DA 4MRNA 1NHGA 3AU9A 2GETA 4LSMA 4XDHA 1E2DA 1NBHA 2GO7A 2C1ZA 2QAGC 2Q4DA 1KDYA 4MP3A 5JIBA 3D8TA 1EP3B 4QEKA 2VDKB 1ZQ1A 2F3TA 3K6RA 3QPUA 4FSHA 3SNKA 5KOJA 5B12A 3LWDA 4PX3A 1V8OA 4I55B 3TMKA 1JSRA 4Z9FA 1E7MA 3T3PB 3ZVRA 3HKBA 4JVLA 2AXEA 4XPZA 4LJ4A 2EF1A 5DP2A 3WNZA 2EFGA 3PDJA 3AFGA 5IS2A 3THXB 1IBSA 4IQ8A 4DLSA 4M0EA 5B3JC 3G7SA 1E4YA 3BSSA 5T5QA 2C78A 3OOYA 4MYHA 4B3JA 5B7QA 2JDID 2D3TA 1PJZA 4PCAA 1TEHA 4V0NA 3S44A 5BVGA 3QU4A 4EMTA 5KREA 2D54A 4IOLA 3MSXA 3K15A 4IINA 5DKFA 5FQOA 4L16A 3NYQA 1HC7A 4S1VA 2XTJA 1RQLA 3DH0A 4ZOQI 4IPTA 4LK3A 1ACLA 1EVEA 1RKQA 5JMWA 3IBGA 1QX4A 4Q82A 3A2MA 4W4TA 2XKJE 4V39A 3SMVA 3IHTA 3VYRB 5BNTA 5IVHA 1YS4A 2GB4A 3SIRA 1Y1SA 1MN6A 1W75A 4W5HA 3CT4A 2QTTA 3BWYA 5CGQB 4JJGA 4K86A 3RUDA 3DOCA 4EX6A 1U31A 2C8VA 4QWWA 2PQMA 4F2PA 5KNDA 3WYEA 1M6EX 3GGPA 5DNVA 4CM5A 3H17A 1GQFA 3RBXA 3QX3A 5F3RA 4IH1A 5AUNB 4BAGA 1FNCA 1W9HA 4MWBA 5LBIA 4X3OA 3T1QA 3T3GA 1G5HA 3TSWA 1QU3A 4MJLA 3A0UA 1R0RE 2GUGA 3PNQA 3U80A 4QDZA 2Q29A 4JSTA 4EW6A 1E64A 2JIZA 3THYA 1PZFA 2A4MA 4I55F 4BYMA 4OM7A 5K01A 9MHTA 5ILQA 4N5MA 1O4WA 1I4WA 3RWMB 1E1QA 5LZ8A 4C22A 1MX3A 5JPDA 3U3ZA 2XQIA 3GLUA 4L9RA 5LA6B 4IRMA 3QXXA 4BWGA 2RJNA 3G2MA 2W2LD 4O1MA 2VWQA 1U65A 3VR4H 3I2JA 3UWDA 4C7OA 4UARA 3JSAA 4R31A 1F7UA 2PXCA 4U2BA 1GP2A 2W6NA 4W5WA 5KQLA 2C4HA 1U5CA 3MB5A 3FCEA 4HPJB 4JIMA 3BWDD 4TVBA 2X1MA 4QX6A 3LA8A 1Z06A 3E2MA 3ITDA 4WFKA 4F46A 1RWMA 5C1IA 1E1RA 1WSWA 4HDQB 3RQSA 2OZLA 4J7CA 4Q9HA 2EZ9A 3IAAA 3LXRA 3VJMA 5BV1A 3ETDA 4KQXA 1SQGA 2AKAB 4DQKA 4F3KA 5FI1B 1AB6A 1Y9JA 2D8AA 1XZAA 2E21A 3AR9A 1W52X 3H8WA 2BEVA 2XV1A 3IP1A 3EJWA 3IX7A 3OFVA 2OILA 4PRZA 1TM1E 1KEZA 1EUDA 1QQ7A 1M1YB 3CONA 4QATA 1O87A 4N8DA 3WLMA 4UQOA 3OE4A 1NRXA 3JARB 2PGLA 2X86A 3OFSA 4BDTA 3TTSA 5CFNA 1DP4A 1KHTA 1TUEA 1K3UB 4DBLE 1B6RA 1PWEA 2RHWA 3DYVA 4W7IA 4QDKA 1QP8A 1G20A 1FW8A 2SICE 2PCLA 3ABQB 4EUNA 2IXTA 2VXCA 3JASB 4FCTA 5K7SA 4PLZA 1FFCA 5JJKA 5DNUA 4JFRA 2XB6A 5H9VA 4AFNA 1QYIA 2O8CA 1MOQA 1MB2A 1RDFA 3NPMA 5CHEA 4QTYA 1YZNA 4C2UA 5HDQA 4EQ6B 4OQ4A 3M4XA 4RVHA 4UHEA 5JG7A 2XGGA 1GPDG 2JCYA 4R1OA 2DCUA 3IE0A 1CXZA 2ZYSA 3RJ9A 5GIOE 1BJRE 2P3SA 3C14C 3LUHA 3PX3A 1PJAA 2WIBA 3BHIA 3D3WB 3INYA 3R3SA 2P41A 2O9JA 2XXJA 4HMQA 5EUMA 2HBRA 3ZPXA 2AN1A 1JG1A 5KNLA 3M6IA 2I03A 4IWYA 4DNPA 4RHCA 2JA2A 1RACA 4OVKA 1NVGA 3OT1A 4LPSA 1FVHA 1A8PA 3LLUA 3N7AA 2FU5C 1CY6A 1H22A 2XAUA 2WU3A 1XNQB 4KEAA 4P84A 4XTCS 2ZRAA 1EQ2A 2VPXA 3L7MA 3TBFA 4IVNA 3GPBA 5K8LA 1JQ5A 2J9ZB 3GLHE 4MCIA 3L4BC 5DDIP 3KCNA 3GMSA 4DVJA 2AQ8A 2NO9A 4J7AA 3OZEA 3OECA 3JQBA 2F00A 3DOHA 4UHJA 2FN3A 4BPRA 1Z4LA 5FIUA 5TNXA 3TM5A 4EHDA 5TRTA 3DKVA 2XJ4A 3GAFA 5LZ7A 1E2QA 5F73A 1PI3A 4X1OA 2G82A 2QN6A 1XD8A 1U8ZA 1K8XB 1ZSNA 1UF9A 3IQHX 5A4MS 3VU9A 1ZW6A 3D81A 3ERCA 2RB5A 4L5YA 4MQUA 4N5DA 1UXJA 3EEYA 3IVRA 5KC8A 3VHXA 1B8OA 4E6EA 4H6VA 1TM3E 2AXNA 1I1OA 1R3DA 3RGGA 4S2EA 5JSHA 4C29A 2QLMA 4P22A 5LP6A 1L5WA 1NDHA 2PIAA 3GZNB 3IUMA 3QFHA 2G08A 3UHJA 5HOEA 4QOEA 4JL5A 2XA2A 4ZI7F 2J5BA 1C2TA 2AZTA 5M5BA 4Q03A 2YIDA 4R9NA 5CVJA 1GA6A 1Y1KE 2V45A 3BFXA 3PE6A 1CUWA 1JZTA 3TBHA 2OCPA 1A77A 4LBZA 1NJ1A 3GGOA 3OZWA 4DDKA 1G9TA 3FIJA 1X13A 2C2GA 3G0IA 3I04M 5TXGA 4Q7QA 3B5EA 1AH2A 3G6KA 4V2UA 2X5KO 1NJSA 3SJAA 3GNLA 5EJ7A 1J2TA 4FD2A 1T5IA 4G36A 1I30A 4RC9A 5KKCA 1E69A 1OFUA 1P74A 2GASA 2QXUA 1CYEA 2OHVA 1Y4SA 3LK7A 4YJFB 2XVZA 3N5KA 1W96A 3E9QA 1DAGA 3IGFA 3P9KA 1OXUA 3GW8A 4IGAA 5FR1A 5AM1A 4ZEMA 4MRMA 2OECA 5M29A 2J4CA 2QPTA 3D43A 2DKOA 5HWSA 2VTBB 1DC4A 3BHMA 1CZNA 4GLJA 3WOVA 3AEUA 4ARCA 2E5FA 2FN8A 2JCVA 4KN9S 4YDSA 4CIBA 4EMSA 2DG2A 4YB8A 1K6XA 2A7QA 4AZ0A 4Q4JB 3FI9A 1B8PA 1FTGA 2EFEB 4AJ9A 4DQVA 1Z3IX 2I34A 3HYSA 1L7PA 1G2PA 1NMZA 1JDJA 3R0IA 4YMTA 3FWKA 1II8B 1RQ2A 2RAPA 4JI4B 3CUTA 1NG9A 4MWCA 2ZJZA 1KY2A 1YJ8A 4S1NA 1T2CA 2WTEA 3MZ0A 3T9DA 1Y1RA 1NN3A 4RPHA 5KMGA 2O8BA 2EG9A 2ZRQA 1N5OX 4G5OA 2P7HA 2QTBA 2ECFA 4HDKB 4Z7OB 1Z36A 3BD6A 4IVQA 4H1TA 3FAKA 3W9YA 2WICA 4EA9A 3GK3A 5HNKA 1NIJA 3RS4A 1YRQA 2VDRB 3N8HA 3IDFA 3JYHA 1WKVA 4KAAA 5DMXA 3ZZ1A 2G8LA 3EWSA 2OGTA 3T7TA 1MJ5A 4WAUA 1J21A 3ROKA 4XRGA 3QELA 2WPNA 2EGGA 4YJHB 3AI1A 3ZLAA 2E4WA 1OTHA 3VC2A 1XJ0A 4GNRA 5CT8A 5T57A 3UHPA 4J4HA 1IG3A 3CZRA 2JGDA 3LP5A 5DJ5A 4CM4A 4J91A 4DC0A 4LXQA 4XFKA 5KYKA 1C4WA 2L69A 1OPXA 4MUXA 4XWGA 3V4SA 4J1TA 1UJMA 1Y81A 2J3KA 4MUBA 5CD9A 1Y7HA 1N1DA 1K5HA 1DJMA 3DEYX 4ZI2A 1E92A 1RAFA 5JQGF 1SUBA 2XYGA 4PLHA 1Q0RA 4UBLA 1Z7EA 1AY0A 1WSBA 2PWYA 4EFMA 3VPXA 4D46A 4YJ2F 1XTUA 4ZGWA 3HXQA 4HDMA 2YY7A 2BP7B 4I46A 3RG2A 1VSTA 4PC3A 3NLLA 3QE4A 1CD5A 4DEVA 2ZSJA 5CFOA 1U0TA 3KQSA 1ZCJA 2NAFA 3GZ4A 1VPEA 2A9RA 1UBMS 3MJHA 4OLJA 4W1QA 4YMUA 5I7UA 1XZNA 3A6KA 2G8NA 4G4SO 3D7RA 5EE0A 3THYB 3QJYA 2WC1A 2NM0A 4TUYB 3HB1A 2X13A 1MVOA 4ZAYA 1TVKB 4EKNB 2EL9A 3AJ8A 1T9DA 1JXAA 3GQBB 2G7ZA 4UMVA 5FJIA 5IAEA 2VHUA 1XF1A 4Y1GA 1N9ZA 1D4ZA 2DHCA 4JBXA 3VI3B 3TQCA 4EFDA 1XLTA 4DNQA 4B87A 4DMKA 1JFVA 2O59A 3LK6A 4RH1A 1Y5MA 4KSCA 2AW5A 4M7PA 2D3WA 3HKDA 4FR2A 1RBYA 2HQBA 1TQDA 3C7DB 4FDVA 4JB8A 1ORTA 5BN5A 2JLZA 1RE1A 4QASA 3DZDA 4K9QA 2PIDA 3RT7A 3JQPA 5J9FA 4I50B 4L7QA 4YT8A 2J67A 1JEOA 2BFFB 1MEJA 1OF1A 1UKBA 1ZA1A 3TQQA 4M7WA 1DKMA 2QMOA 2NQ8A 2WIKA 4FUTA 4MS4A 1ZL0A 3JATA 1SBIA 4N54A 2H48A 4OBWA 4PG4A 5C8YA 1R0XA 4LHEA 5GQSA 2FEAA 1Z0JA 2QBYA 2DAPA 5HGXA 2B7CA 4YN3A 2EWWA 2GA9A 1U3FA 2PS0A 4MAMA 1Z8HA 3W78A 2OFWA 1Q17A 3KL2A 4K9OA 4DIKA 5A3RA 1QPGA 2AQHA 9ATCA 2C97A 1QAMA 4OQFA 2OA0A 1WY7A 2C2OA 2OWDA 1M2HA 4J4TA 2F7SA 2QXYA 1XQ1A 4FNGA 1DS6A 5L7WA 2X8JA 3D7LA 4Y6QA 3ZCUA 4EAQA 3TTUA 1H9CA 2ZS9A 2CHGA 1SCJA 1L4NA 1GNSA 4A23A 2I54A 2PX8A 1J0BA 1LPSA 3ORRA 3BGIA 1ODSA 3CRW1 3CR3C 5L3ZA 4HRAA 4JL8A 2GHRA 3IR6A 2H1RA 3WS7A 1OBVA 3JQ7A 3R09A 4W8HA 3EIFA 5D7BA 2E5WA 4YY3B 3SBXA 3GLFE 3N74A 5TV2A 2P3QA 3RSCA 3ZZMA 2GBGA 4ND8A 4U8GA 2E1PA 4XARA 2V74B 3QXJA 4U7WA 1P6XA 5G1OA 3ROQA 2UXBB 1WCWA 4JP8A 2JLCA 3RVDA 3CX7A 4TWBA 4WKGA 5EQFA 2YJ5A 5KKAA 3C3PA 3TZLA 4W7HA 4UKDA 3W34A 4FU0A 1TVCA 4C88A 4TV9A 5ED4A 3R8XA 1DU4A 1V6SA 2Q9UA 3D3KA 2GK3A 5FFFA 4BCDA 1NSYA 2A3RA 3DDZX 2IYAA 1HE4A 2Z2IA 1SOAA 3FF4A 2XECA 4QXOA 5IBPA 3THWB 2PKQO 2DPXA 2GD2A 3LUAA 3LX5A 2ZDGA 5DOZA 3AEXA 3D64A 821PA 5E1BA 5IDVA 3I0NA 1VPTA 2D1TA 1T91A 1DE0A 3KU4A 4NPHA 3ZKWA 4BO1A 5HA5A 4KQHA 2HA5A 1NUAA 1MQ8B 4M0LA 4Y6RA 5TT1A 4JHXA 4NCJA 4KHPB 5HG0A 4MKRA 2GLXA 1GZHB 4F4CA 2CKDA 1ZD5A 3HO6A 3GCDA 1TW3A 4PGFA 4E88A 4UNSA 1U99A 4W1SA 3M49A 2JFNA 2NTVA 4BGEA 1HE8B 4CT5A 2O8NA 3D9QX 4XVQA 3S8YA 4MVYA 4N7RA 5HMMA 1GSAA 3ADPA 1Y7LA 2HSJA 5GGXA 4ARSA 2IOYA 1WF3A 3DNFA 4MW2A 4Q19A 3SI7A 3KZVA 3D6NB 4F4IA 1DOZA 1S5PA 4CKCB 5CCXA 4EUHA 2OCBA 2YV5A 2VN8A 1U0LA 4G0QA 1YDHA 2CXPA 3FKJA 3HYTA 2VP5A 5C1OA 2D5LA 2H3EA 2IS1A 1JSCA 1CZKA 1UXGA 1N6HA 4EG7A 4L5BA 5JS6A 5BWCA 2DX7A 1PR6A 3DM9B 4CKXA 1XD2A 1NW7A 1LFDB 5ALJA 4B75A 1AHIA 2CDCA 4YRZA 4TT3A 2QRMA 5JVDB 4HD8A 3TNFA 1Q22A 3BQNB 5HXAA 3WL8A 4JLSA 3ZNQA 2HJ9A 2Y1OA 1CUZA 1H4QA 5FTJA 1C80A 3FR7A 3NCTA 5I7OA 2XMDA 4ZDJA 1TGYA 4LY9A 4B1FA 1BX1A 1ZR4A 4YXFA 1X8XA 2YN0A 3K94A 5INTA 1UZAA 3BBLA 3DBIA 2WJYA 3QSYA 1JIQA 3H11B 1UDRA 1NUPA 3R24A 2J0UB 1PR0A 5HE9A 2YH2A 4HLUC 1M6YA 4TTIA 1LFAA 3W5CA 2RAUA 2G76A 3ROEA 2O8EA 1QV9A 2VK8A 1ZWLA 1Y89A 3BZWA 4GXRA 4MIEA 3N2LA 4P81A 4YIKA 2BI7A 2QTFA 3KKOA 2OO5C 3TEFA 2P90A 1UMDA 1X38A 4U02A 2XOKA 5K3DA 4FB5A 5DN6D 5K45A 1KZ9A 2HKIA 1H5UA 5ALUA 2P0AA 2IXDA 1INLA 2EFYA 4W5NA 2O2IA 4WA8A 1JR6A 2DPYA 4BNUA 2GZHA 5JNUA 4KE9A 1DC6A 1R64A 3B20A 4QJIA 1SB8A 4F6RB 3UKDA 3PJFA 4TYPA 5JAOA 3DHYA 3KQHA 4N5NA 2CLEB 3LFUA 4QVIA 3BD9A 4R8RA 3FDJA 2Q7DA 1GLVA 3KYCB 4I5EA 1OAOA 1Z56C 3LY5A 3Q2IA 3CIOA 1P2GA 1UBKS 1BMDA 1YVEI 4JBWA 4LCBA 2M2IA 2CY0A 1N25A 3CJQA 4GPEA 2O0JA 2VPQA 1VI5A 2JRCA 3VMMA 2BN4A 1GO2A 1CR1A 2QD5A 2GTPA 1Q84A 3CO0S 3GJ4A 3M2TA 4ZQEA 3ZHSA 4ZZ3A 2YFHA 3QKSB 1YOVA 1EWVA 1HTTA 4X3PA 3ZE2B 4CZ2A 1O97C 4J03A 4H0CA 5REQA 3KUUA 5AK3A 1ILWA 3VR4A 2A9QA 2OM6A 1EVKA 3JQGA 1UK9A 5EGSA 4OQEA 5EZYA 1NQXA 2ZI3A 4KITB 2RE8A 4K9RA 4UFPA 1AS3A 5DHSA 3C3AA 3DLBA 4UU7A 4P0PB 1W59A 2VQ3A 4J1SA 2A0YA 2HHHB 4RVOA 3IAUA 5CUQA 3DE6X 4M9SA 4KN8A 4GBGA 4W9MC 1ZHOA 5KYXA 2FAXA 5JRJA 1JGTA 1HLFA 5JI3E 3L2OB 3U4AA 1TZ2A 2H7VA 2OORC 3NIFB 3X1YA 4KIGA 4NZNA 4CIWA 1ENOA 2B25A 3KOZA 1A5BB 1POXA 5JNRA 1U6KA 5KNCH 1Y6GA 2BKVA 3U2QA 1G7CA 3FPCA 5E4JA 2C7VA 3LGAA 3BDAA 5FHRA 4IDUB 5F5NA 3KQLA 2VQDA 2C0QA 1HDGO 1JJAA 1SIWA 2Z3VA 2XUDA 3G5LA 1WB4A 4N6GA 4K8OA 5C0OE 5K8VA 5DHTA 2CEKA 4RXUA 4TM7A 3ND5A 1XXLA 3EXG1 5K0ZA 3DDCA 3A1UA 4IDUA 5IUKC 4XJVA 3AKZA 1FU4A 1GZSA 1ZXLA 3OSUA 3GLVA 3RK0A 4X1IB 4NF2A 1RFLA 2QTVA 4LRUA 1N2CE 4EHIA 4PO3X 3HABA 4ZVOA 3GP3A 5LBUA 1TE2A 3P2JA 4M9XA 4OLHA 4XR9A 2OFPA 3DE2X 2C2YA 1Y1PA 3HCCA 5HJ7A 1NLMA 1FFEA 2UV8A 3I9MA 1Z0UA 3NM5A 4R6XA 4J07A 3TVYA 3KAPA 5CU7A 3ZJUA 1PQPA 3KJQA 3GEGA 2ONCA 3DTVB 3RVOA 4DJEC 1BTOA 1SPBS 3Q3JB 3EEIA 1HE2A 4JEIA 1AKUA 4LXTA 4MV3A 4TXHA 4YP7A 1POWA 4G9GA 4OB6A 1SKAA 1MO2A 4BWFB 3K0KA 5D2CA 4WUVA 2FFJA 5FLEX 2OMKA 3VYWA 2Z98A 5GJBA 4KYIB 1JYFA 3RT9A 5LZ9A 4RIFA 1CJBA 1QTIA 1BHO1 1W35A 1U2EA 2ZBUA 5ENZA 1HM5A 1T2VA 1RXCA 1RYFA 1TK3A 4HDNA 1ADGA 4MQFB 5ANRB 3BH6A 3R7LA 3UMCA 1Z5UA 4N3NA 5I4BA 3WMFA 4H7DA 1MKYA 5A3SA 1P0MA 3OFND 4HXFB 1IRIA 4TMVA 1E7QA 2QZSA 4HNGA 2FPPA 2JB9A 2PKYX 2GEJA 2F6RA 2UVPB 2B3DA 3BDVA 3CCCA 2Q5IA 5CDFA 1F6BA 3GD5A 4TLDA 5AXCA 5EUCA 1IN8A 4HNRA 3N58A 4P4SB 4RIIA 5G1PA 5ALIA 3T3IA 2F3PA 5A4FS 1PZMA 2E7ZA 2C4VA 2XAAA 1LA2A 3AFIA 3CWQA 1UINA 5DB4A 4ENVA 1CRZA 1FDTA 1VRCA 3BXEA 4D8XA 1EK0A 3EG9B 3JSXA 4M7OA 2D0PB 3IBSA 1ZD2P 1T9ZA 3MYRA 4XDGA 1MC4A 1ND5A 3FZGA 4GOOD 2XD4A 5H82A 1W7AA 5FEUA 1PQYA 3NXSA 1TJ5A 5DYGA 1LPAB 5SZIA 6Q21A 1U0JA 2DQYA 1DBQA 3AIIA 3DMGA 3OJCA 1E6MA 3QJ5A 1ORRA 1C0KA 1TYDE 3KK0A 4RYDA 2XHZA 1FYFA 4D92A 4DBZA 4GDFA 2I3BA 3ET4A 3QWHA 4IY1A 1K7XB 4OQDA 4BNFA 5E6SB 1TAUA 2ZKLA 4I19A 5TE9A 4DABA 3RSQA 3OM8A 5GZ3A 3AV0B 4HHEA 5SZKB 3B8EA 3D6UA 4Q7EA 2IDJA 3EULA 1MIOA 4X8LA 3U7FB 1IN1A 2AFIE 3PQ8A 1H0RA 3QITA 3TSZA 4BKUA 1XDBA 4TV8F 2XBMA 4QXRA 2EOAA 4P93A 5SYMA 5IWCA 3HZOA 4FM9A 5DNDA 5CB4F 3LWBA 3ITKA 1CRWG 4CF6A 1P77A 2PU7A 2ZRGA 3LFHA 5H81A 3UH1A 3V4RA 3HU1A 3LY9A 3OJXA 4I5IA 1HLDA 3UK7A 2O2EA 1W46A 3NG1A 4FDAA 3WR5A 4A2WA 1CEYA 1BFKA 3HDHA 3Q98A 1FMTA 1T2FA 4DSNA 3S99A 1H2RS 3GZTB 1LRJA 2HXSA 3O9ZA 5TEVA 2HU5A 4F12A 5KVSA 1O6GA 1A1VA 3OSZA 3U44A 4FWIB 3DBOB 3M9XA 2UUAB 1T6NA 5L3RA 3L1UA 2X22A 3A4MA 1XZFA 1CUFA 1HPLA 3QUTA 4LZAA 4YAIA 3D4BA 2ZM6B 2LWIA 5IBQA 5KYUA 4JEMA 1UBHS 2WLSA 3BA6A 1M6NA 3KZ1E 2WSSA 2X4GA 1Z6YA 2JFZA 4EA6A 1LW6E 3Q3IA 4N1AA 1QBKC 4ZRDA 1MOSA 3BH7A 3ICWA 1VPVA 1UP6A 4O4HA 1U1CA 5KO2A 2AWOA 4X1YA 2XSZD 5A5FA 3MLAA 3B82A 2N47A 1JKXA 1W0CA 2JEOA 3FVQA 4KUEA 1V35A 2C2KA 4QECA 1RQGA 3AINA 1N2JA 3MTGA 3E7PA 4UFNA 3KJIA 3NMUF 1TYZA 3PUVA 4WXMA 5I8ZA 3I6QA 3MOSA 3KWFA 4LMRA 1Q0SA 1K8RA 4BFWA 1QVZA 1L4GA 3AESA 3HB9A 4CR8A 4RTOA 1GU1A 2A30A 2WEKA 4GUAA 5AVQA 1L4EA 3NYIA 1T1JA 2WR8A 3BZUA 4C4TA 1IHPA 1PK8A 4YCCA 4GWKA 4P92A 3ICCA 2O5CA 1OYVA 2CD9A 4GS5A 5JBQA 1CZRA 4CKWA 1FXSA 2Y6VA 3GP8A 1XU9A 1WETA 2P9ZA 1RLOA 1WCYA 2LDBA 5EZQA 3NRBA 3G5TA 1V9CA 2Z5VA 3F6SA 1WSAA 1WXEA 2E89A 5DV9A 4Q4CA 2CV1A 1DKOA 1EEHA 4HNQA 5CD1A 1IXYA 4BATA 2ZGVA 4LYGA 2DT8A 2X9NA 9LDTA 3HPQA 3LXMA 4TQUS 4FMCB 4RV5A 1KDPA 3F8SA 3BB1A 3QMMA 5DYTA 5AW2A 3G82C 3NCHA 1OY1A 3CNBA 1ZD4A 3WLSA 4OK3A 2HO5A 3GPCA 4B7CA 1IOVA 1RWXA 4DB4A 4ZOLB 3V7YA 3BE8A 2BBTA 4RKYA 3BWBA 3SJ7A 4FYWA 5DTRA 4ZVLA 3C6QA 4DGQA 5EWMA 1N2CB 2W43A 3PITA 3DZGA 3STWA 5KYUB 1P5RA 2RJ3A 3F98A 3PXXA 2VDNB 3PWKA 1Y5LA 4PTYA 4KDCA 4ARBA 4R6WA 3CE6A 9GPBA 2ZIWB 3GAAA 2DT5A 3F3YA 1SVNA 3P26A 4MP6A 4TQAA 4PCLA 1X80B 5KAPA 3TQSA 1Z4PX 2JLUA 4DUYB 3O7MA 3QKUA 5C7YA 2PH3A 3MMZA 1T29A 4O1HA 1G8SA 2I2BA 1JN0A 4RS3A 2BPOA 2G4CA 1WCIB 3A10A 3GJ8A 4KCGA 3EXIA 3UWKA 2XYHA 2ZDHA 4EABA 1TIPA 1TDJA 1HF3A 4DCGA 3A6ZA 1PYOA 4QT4A 1J2EA 3GEIA 2YXLA 3WKBA 2DFKB 4MV0A 2WA1A 2O19A 1M5RA 5EEHA 3D6FA 1W4LA 3MW8A 1SU7A 3E5RA 3OICA 4D43A 3BWXA 4M1TA 3HWX1 2QE7D 4LW8A 4OCZA 5CH5A 1BDBA 1IVYA 4Z2AA 5IZCA 1ZUD1 1OH8A 3JWHA 1P1CA 3FWPA 4MW1A 1AGXA 2B4KA 1BGVA 3L8HA 2PUBA 4HWRA 2A0FA 5IANA 3CZ5A 3X2SA 4CM8B 4N5IX 2XEXA 4K6FA 2O2DA 3QLTA 1JMVA 4F4DA 3A1NA 1BWRA 1XZDA 3A4VA 1MTZA 2AOUA 4JYPA 1UBUS 2E4AA 4N0QA 4RD3A 4S05A 4OSPA 2MR5A 1PFVA 2RK4A 4QGGA 5CLGA 1E7SA 2OYSA 4P3XA 1E3EA 4Q01A 1U3UA 4P4NA 3E8MA 4FW8A 5IAJA 5IC6A 4BZXA 3D54D 3EFBA 5F7XA 5E6RA 3UIEA 1YU9A 1EFPB 3ANLA 4TRMA 2G1JA 5EI5A 1KK1A 4JGGA 1KO4A 4M1KA 4QUHA 1XN4A 5DGTA 1G5TA 3UATA 2OCDA 2RGUA 2VVTA 2ES4A 3ZHTA 4YCLA 5CFMA 4AKHA 4UM9B 1CZLA 2B4AA 2HJVA 1VJ5A 4RMIA 5EJ8A 1PT8A 1T5LA 2HDHA 2OKGA 3EY4A 3EBOA 5IJ0B 4P0QB 4XIFA 4H35A 3SYLA 1FJXA 4G5RA 1JPUA 2XGOA 3U60B 2REQB 4TSFA 3L7IA 3NORA 1M66A 2AJTA 3D4OA 4H0FA 1SXJE 4QFMA 2R7MA 4OHMA 1FP1D 1E63A 1UC9A 1E3JA 1E6LA 3LTEA 3FRHA 3N7TA 1Q1AA 2PV7A 1OXTA 5FPKA 2D4HA 1G42A 2CVQA 4O4LA 2V4UA 1EFCA 2D1QA 4KP7A 2IU0A 2X42A 1QR6A 2F43B 4HN9A 4JJ7A 3UAGA 5IJWA 1PHRA 2QN9A 3PCRB 3HFJA 1YC5A 1N2GA 3GT0A 4QYIB 3ZW7A 3ONWA 1OYYA 5D3MB 1RYBA 1ULBA 3DKIA 7ADHA 4EIWA 4EQ6A 1VKHA 3IMEA 1CX9B 2A78A 2V7QD 3EMBA 3L4EA 2K5UA 4UHDA 4WL0A 4DQLA 5JH7F 1NSTA 1P2VA 3AG6A 3W2EA 5EP4A 3WMXA 1XAIA 3ANTA 2GPBA 5LA6F 1JJ7A 3CXUA 1KSJA 4KC0A 3PGA1 3U3DA 1T5HX 2JRLA 3BK1A 2Y67A 4F2WA 4RETA 1NNSA 3VO2A 3TVTA 4D9IA 2WUVA 3B2QA 1NQ5A 3THSA 5A7HA 1ZVMA 1QHGA 4NMXB 2ISQA 1KIMA 5U1PA 3EQZA 3A04A 5AXAA 3VU1A 2HNAA 2Y0DA 4EEZA 2RHOA 3OQ6A 3OP1A 2PUJA 4HWKA 5AVXA 3RVKA 4B6FA 4NZPA 4HAZA 2RHDA 4GLBA 4BNVA 4BJ6A 1JEYA 3AR5A 1KI6B 1RTTA 2REXB 2V7QA 4E11A 3ZGNA 2ZROA 4HLQB 2BBWA 4B3TB 1TXGA 2IYXA 4G5YA 4IO0A 1ZCZA 4N0MA 1EEXB 2EW1A 2YWJA 1FS6A 2ZE8A 4L4XA 4BO7A 4HAXA 2R68A 3BA1A 5KB3A 3UICA 4OYHA 3ZN2A 2ABWA 3Q8WA 3OCYA 4S3MA 4J0QA 4DR2B 4DR6B 1VG8A 3VVCA 1YMQA 2I4IA 3ZNNA 3N2NA 3NVMB 1D8AA 5BMVF 1T1IA 1U4OA 3OIUA 3Q3HA 4IDNA 4PY2A 3OJWA 5FI0B 1FW6A 2VNSA 2XGMA 2Z0MA 5BOVA 5C1PA 3QIVA 2XNCA 3ZNPA 1KMQA 2JFQA 4X45A 4Z8XA 5EHQA 3UEOA 2PBRA 2XOEA 5KNBD 3NDPA 5L6LB 4HQOA 4IYJA 2Q8NA 3DBLA 1PZHA 3R6WA 1UBRS 1SA0A 3ZVNA 1Q6YA 2UUOA 1RLIA 4Z0PA 4MW6A 5FEMA 2AFVA 3RT1A 3S0JA 2IYUA 2GDZA 3AKEA 2NXWA 5EMNA 4DPKA 3K2EA 3HB4X 4C3UA 4FQ8A 4IDOA 1BS2A 2WU1A 3BKWA 3DEAA 3GCGA 4K8RB 3TOSA 4A03A 1HO3A 1T15A 4H9GA 2H9AA 2YJNA 3BK2A 4GQAA 2QWXA 4JA0A 3TD6A 1RM3A 3OCXA 1QANA 4BMNA 1SKMA 2IHZA 3L46A 4ZCIA 4I5FA 1TKAA 2ORED 3CW9A 1AUQA 4BP1A 1PLLA 3BSFA 2FPOA 4NU6A 3VR0A 5TPWB 4EVSA 4MA4A 4PG7A 3H5TA 1ULZA 4FXPA 4C0AC 2GFHA 4IWNA 1TTPB 2YN4A 1E60A 2FHSA 2W2KA 1THGA 3BMNA 3MTBA 3HSSA 1EKXA 3C1TA 2GRUA 5F7JA 3QV2A 1IOLA 3LWZA 4M2LA 2FZKA 4ZYYA 3OIGA 1WXDA 1A76A 3QLUA 4F6LA 4L8LA 4EKEA 1BN6A 2D59A 2GPNA 3SLKA 5KJ1A 2C4WA 1XA0A 4BFLA 1CF4A 3HJGA 2R8BA 2FGJA 3E22B 3GYGA 3W05A 3GLGE 3A32A 4IEFB 2EFDB 2XYPA 1F4LA 3HVIA 3UJAA 1ISPA 2B1JA 3N5CA 2XBLA 3LZ6A 3F0TA 3OX1A 5FNVF 1KOLA 4IVPA 2G4VA 4MGEA 2VBIA 4BOYA 3M34A 1R6VA 2LR0A 2I7XA 3OPXA 5AI0A 4CTNA 5K0FA 1MEEA 1S89A 3KYCA 5JYBA 4BB0A 1MVNA 1SVKA 1ZIXA 4PX2A 4H1HA 3T4EA 3KIPA 2R79A 4CL8A 2HA0A 1U2RA 1RKXA 4IIHA 3E9DA 5FP0A 4JT2A 2FUG1 3D8RA 5EKUA 3TOCA 1VE5A 3KFXA 4BN0A 1BEEA 1JEEA 2KJQA 1DCFA 4FFOA 5COQA 3ZCTA 3CGGA 2JAQA 1YR7A 3REQA 4N03A 1O9BA 1L4HA 3KD2A 4HB3A 4AZVA 3T1HB 1ZJWA 3A1SA 2OP0A 3ZGXA 3V4FA 3WXBA 1KAGA 4H7FA 4LDAA 3OZ7A 1XELA 1HGXA 5KTTA 2P75A 2A9VA 2P3LA 3R6GA 1VRWA 4XX1A 2G72A 1LB1B 1BQ3A 3HXTA 4XX0A 2WB4A 5AJYA 3KQVA 1MNAA 2OLJA 3COSA 3KV1A 1QM5A 2ZI6A 1NF2A 4LSZA 1YQDA 4G1CA 4OL9A 1NMSA 1RKBA 4YONB 2A67A 4RACA 3SBEA 4BQNA 2X15A 4BEBA 1Y8ZA 2JEYA 4MKFA 1K8ZB 4ND6A 4B46A 3QX9A 1W1UA 3D1JA 4W1RA 3RJMA 1GYRA 1PUIA 3AVVA 3NTOA 3CSSA 4AMVA 3DFZA 2EVWX 2X0DA 3L06A 3U61B 3WBJA 5MDHA 2JLVA 3O9VA 1BG6A 2DQ4A 5T3YA 2UZ1B 2VNAA 4CF7A 5DHQA 3UJ8A 1NF9A 1EWYA 3DW3X 1GN9A 3ITEA 1ETUA 3M33A 4MCJA 4BFXA 4I8DA 2YXDA 2EWMA 1JDSA 1I01A 3H4VA 1RSZA 2VHXA 1WPGA 2CNNA 4UE3S