1KEPA

The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-xylose bound
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
346
structure length
346
Chain Sequence
QFKNIIVTGGAGFIGSNFVHYVYNNHPDVHVTVLDKLTYAGNKANLEAILGDRVELVVGDIADAELVDKLAAKADAIVHYAAESHNDNSLNDPSPFIHTNFIGTYTLLEAARKYDIRFHHVSTDEVYGDLPLREDLPGHGEGPGEKFTAETNYNPSSPYSSTKAASDLIVKAWVRSFGVKATISNCSNNYGPYQHIEKFIPRQITNILAGIKPKLYGEGKNVRDWIHTNDHSTGVWAILTKGRMGETYLIGADGEKNNKEVLELILEKMGQPKDAYDHVTDRAGHDLRYAIDASKLRDELGWTPQFTDFSEGLEETIQWYTDNQDWWKAEKEAVEANYAKTQEVIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Toward a structural understanding of the dehydratase mechanism.
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Lyase
molecule keywords dTDP-D-glucose 4,6-dehydratase
total genus 145
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 4.2.1.46: dTDP-glucose 4,6-dehydratase.
pdb deposition date 2001-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1kepA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1kepA02
4ALMA 3RFVA 4BKRA 1Z75A 1ADCA 3DMTA 1NQOA 1RM3A 5L7TA 4LK3A 4H15A 1IYZA 1ULUA 3W6ZA 1V35A 5IDQA 4A10A 1R66A 4FFOA 5IXYA 4OKNA 1BXGB 3RC9A 4DLAA 4ZN6A 3PHGA 5HRUA 1KOLA 5HTOA 5HS6A 1RYDA 4NBTA 3K96A 4NBVA 1A9ZA 1SCUA 1U2DA 1H94A 3D3WA 3GLQA 4J0EA 5CG2A 3MOIA 1ZNQO 1EE9A 4L76A 2IZ1A 2YQ5A 4K26A 4BO4A 4YDRA 3TN7A 3DONA 3C1TA 1CQIA 3W8DA 1SPXA 1GYPA 4DA9A 3K6JA 1N1GA 1E7YA 2HJRA 4CMHA 2BD0A 5HWSA 4IS2A 3UW3A 4CV0A 4BO6A 1O94A 5KJ6A 3TPCA 1LSOA 3MZ0A 5FEUA 1YQGA 4GL4A 4JP3A 4R51A 1KS9A 2C5EA 4O1MA 4RZIA 2H1SA 4ZQGA 5L7WA 1GPJA 3TRIA 3L07A 3UXYA 5JY1A 5L40A 5JO0A 1HL3A 4ALIA 1BSVA 1A7AA 2PWZA 2PY6A 3BHIA 4PRKA 1WNTA 1ONOA 1LDEA 3K2BA 3P5SA 3LDHA 2JKVA 3PJGA 4WNIA 4R1SA 1WMBA 5TC4A 1E1NA 3KYDA 5B4VA 3D3EA 1IZ0A 1HZZA 3IS3A 2VYND 4CMCA 4N18A 5A1TA 1H9AA 1SOWA 2H6EA 5BNIA 4FFNA 1U8FO 4PG8A 1UZNA 2GGSA 1GL3A 4O5OA 5I7EA 1JTVA 3R3SA 4NH4A 4CM3A 4DIBA 1EUDA 2PZKA 1E3JA 1R12A 1YBVA 1LDGA 1EUCA 1I2BA 1WAMA 2QRKA 3JYOA 1LDBA 3C24A 5DBFA 3WICA 4QEDA 2GZ3A 3DAPA 2ZTUA 4JLWA 1PL6A 5KJCA 3HE3A 7MDHA 4TROA 1U7HA 1UJMA 1GUYA 1ZH8A 2J3JA 1ZMOA 3UKOA 4NJMA 4RPKA 4CR7A 1BDBA 1T4DA 1ONNA 3W4IA 1PJ4A 1ZEJA 2PZJA 3NT4A 4HFMA 1NHGA 2I5PO 4U8GA 2CUKA 4IJKA 4YWJA 4I5GA 4WEQA 4LCJA 3M1LA 3OQ6A 4YCAA 1C3VA 2YQ4A 4Z9FA 4BV9A 4F45A 5KWEA 1JQBA 2DTDA 3LC7O 1B14A 1QYDA 2PFGA 4LVCA 4EI2A 5TJ9A 5DN9A 4MOWA 3GC6A 3GVPA 4D0RA 4YTEA 3FTNA 4YQYA 1FDSA 1QXSA 4PG7A 4IIUA 4IY1A 2IEBA 2DU8A 1JN0A 5JAIA 1X13A 2FOIA 2DM6A 4AJJA 5T8KC 1P3DA 5U1PA 3TZCA 4CMGA 1X15A 3SBOA 2YHIB 3TOZA 3VAZA 1E92A 1E7RA 1DC6A 2D3TA 1X7DA 2A94A 3BTOA 3TQHA 5JYEA 5JFOA 2POQX 4UVHA 4RPLA 1YB4A 2WMDA 4FBGA 2YHIA 4OIMA 3IP3A 1U8XX 3JYLA 2B37A 3JQFA 4PG6A 2IE0A 4ND5A 3RU9A 1ORRA 1TXGA 4OO3A 5L4SA 1X7GA 1T2FA 4FPXA 5ES3A 3KOUA 3WYEA 1KERA 4NNJA 1QG6A 4RF3A 3TZKA 4D45A 3MTGA 1ML3A 5AQ1A 3AOEA 4R41A 4BS9A 3CZMA 3MTJA 5K6AA 1DIHA 3FR8A 4WLUA 3G17A 4G65A 5DDIP 1QRRA 2NSDA 4R54A 4BNKA 2W2KB 4Q39A 4J1TA 4KQXA 3C3XA 4M86A 1GAEO 2IZ0A 4LRTB 4EUEA 2VNSA 4OOFA 3GAFA 4B7CA 4NFSA 3L9XA 2BKAA 4M89A 1PWZA 2P9EA 1ENOA 2E49A 1PGOA 3NYWA 4J2OA 1ZK2A 1WW8A 4DLBA 4EW6A 5ILOA 2Q2VA 3ZU4A 1R37A 2QHXA 3QWIA 3DZGA 4G5HA 4ILKA 4E5YA 1VJ1A 4BMNA 5KVQA 1XU7A 3RKRA 3KSDO 1H6DA 4UEJA 4G2NA 1HRDA 3JQ6A 4JJFA 4L0QA 2D5AA 1CRWG 2Y0CA 2CSUA 4CM8B 4PLVA 5K0ZA 1ZK3A 1NPTO 4AJIA 4JROA 2Y1FA 1YRLA 4IDEA 3DTTA 3QHAA 2ZB3A 3OM9A 1Q7BA 3ON5A 4W7HA 4XD2A 3VZPA 2WE8A 1AXGA 1W4ZA 1EDZA 2QW8A 5AOVA 1ZUD1 1O8CA 1JKFA 1X14A 1CJCA 1IPEA 1FDTA 1WP4A 2C54A 4FR5A 5JPIA 4DVJA 5TJHA 1DFIA 1EFKA 3UCFA 3VTFA 4OXYA 1R4MA 2Q4BA 3MCVA 5KJEA 1PGJA 4YJGA 3NGXA 4L73A 4R9RA 3E1KA 4BB5A 4FFMA 3C7AA 3BTVA 3V5NA 3K8ZA 3RUCA 3NGLA 4DGSA 2X23A 5A02A 1HSZA 3ABIA 2G76A 1VRWA 3AY7A 2EWMA 3NV9A 3TZQA 1DC4A 1EZ4A 1UZMA 1ISJA 2NU8A 3OSUA 1DLIA 1G0OA 5EESA 4Z0HO 3AUTA 3W8EA 1F8FA 1E7QA 2B4QA 3DO5A 4OJNA 4MINA 1HDYA 5A9RA 2X9NA 5L51A 3N74A 3ZWAA 4DYDA 1I24A 1FDWA 5U4QA 3ZV4A 3O8QB 4J1QA 1RWBA 3GPDG 4UVDA 4F6CA 4JCOA 3AOEC 3DZIA 2RHRA 2EHDA 2O3TA 3DOCA 4CLDA 4ONEA 4KWIA 4A2CA 3IUPA 1E7MA 3GN2A 1LNQA 5B12A 3D0OA 5A5FA 3ZWYA 2YDYA 4XDYA 1YS4A 5LDGA 5A9SB 3RUAA 4B3JA 1G1AA 5TQVA 1YDWA 2P4QA 1GU7A 3RU7A 2ZYDA 4U0KA 2ZQZA 1HXHA 2H5LA 4OHUA 5LCXA 4BNYA 3S2FA 2VZ8A 2YY7A 5IZCC 3ADPA 3O03A 1U9JA 3ZU5A 3L6EA 1UXKA 1PGQA 2VOJA 2GSDA 4MVJG 4CV1A 4EITA 4IDFA 2B83A 2QIOA 5F5LA 3SEFA 2W98A 1PQPA 1YJQA 1QP8A 3FI9A 2V6MA 4NJMB 4GMFA 2AEJA 1NPYA 4XJSA 2WYVA 1RKXA 3ETGA 3RUFA 3VH2A 2WM3A 2VTDA 2ZATA 1CYDA 3ZW9A 5HM8A 2AG8A 2YW9A 4XIYA 3I9OA 4IIVA 1E3IA 1XDWA 2HDHA 1QYXA 4IUYA 4LSWA 5A5EA 2O3SA 3DBRA 3FR7A 5G4LA 2ZJ0A 1N9GA 4ND2A 4YAGA 3GVHA 1TVEA 3UVEA 4O0LA 4BNMA 3DBHA 1F14A 3I9NA 1P1KA 1ZIDA 3H9EO 3QRWA 2WYWA 2ZYAA 4A26A 4XYLA 1GR0A 2O4CA 4NIMA 1ISFA 4F6LA 2JD0A 2TMDA 2GF2A 3DOOA 3HDHA 3GPIA 1DOHA 3AU9A 4PLYA 3BXXA 4CLOA 4R16A 4MIEA 4BNNA 4IXWA 1LLUA 1O6ZA 1DC3A 1NPDA 4IJWA 5G0WA 4BKQA 2EGHA 3GK3A 4K6CA 3QVWA 1GEGA 2CVQA 4BV8A 1CEQA 5MDHA 2PV7A 3BA1A 4E33A 4WCDA 1U4SA 3C1AA 1LXCA 4MKZA 3LVFO 4XEHA 3WFIA 4FC7A 4UVEA 3AK4A 2BGLA 3KRTA 5A05A 3FBTA 2HCTA 3D4NA 3JYNA 3TF5A 1D1SA 2W2KA 4WPGA 2A92A 1K3TA 4XR4A 3JQAD 5A3VA 5G0SA 2PD3A 1QLHA 3B1JA 2RAFA 2DT5A 2GZ2A 4BNJA 4FDAA 1E77A 2NUAA 3STHA 3PHHA 3TZ6A 2R00A 1Z82A 3GNQA 4MP3A 4AICA 2RCYA 4CM4B 4C4OA 1UP6A 5IAAA 2JCXA 3L4SO 1EBUA 3DOJA 3K30A 4HX5A 4KTVE 4E32A 4YAKA 2ZB8A 2O7SA 4Q3DA 2B4TO 4B4UA 4R5MA 3PRJA 1MLDA 3JD4A 3I83A 2B5VA 3OJOA 4LMRA 5JCJA 4QFDA 4RQUA 1VL0A 4J43A 3V2HA 1CIVA 1E3WB 1B3RA 4WEOA 3ITDA 3WNVA 3LF2A 1Z7EA 4L4SA 4I9NA 1PGPA 5EIOA 1I3KA 3U09A 3OJLA 2DBQA 3FCOA 2VNAA 1L7EA 1M6HA 4RLSA 2JFFA 1HDGO 3A06A 3HADA 1TT7A 2IODA 4NBRA 1WVGA 3GOHA 5KIAA 3TWOA 3LC1O 1XIVA 2NTVA 5JSFA 1T2AA 2BRUA 1XA0A 3UOGA 1PS0A 5AXCA 3PDUA 4JNKA 1PS8A 2Y0DA 3OA0A 1IHYA 4Q9NA 3AY3A 3E5MA 4QX6A 4R68A 4BGUA 2NADA 2Q2QA 4PLWA 1XU9A 1LSJA 1M6WA 2QG4A 3ZNNA 5IDXA 1VL8A 2UV8A 4E3ZA 3NT5A 2YDXA 4BL5A 1NWHA 4D3FA 2BHLA 2YUTA 3B1KA 5FYDA 1A4IA 3H3JA 1O0SA 3GRKA 4IINA 5JAMA 3ENKA 2C0CA 2GN9A 1E1LA 4RORA 1UXGA 4ZU3A 4LGVA 4YT5A 3DL2A 1BMDA 4U0JA 4HP8A 1WPQA 3E9NA 5FFFA 5ENVA 4CM4A 1BWSA 3I1JA 4FFPA 1YB5A 2J3IA 3I5MA 4B8WA 4BKUA 1GY8A 1J0XO 3DHEA 3NTRA 1MG0A 1GCUA 1BW9A 3OJ0A 3P2YA 3OIGA 3WGQA 2RH4A 5F1KA 4JJIA 1GQYA 1JA9A 4S3MA 2NVUB 1WLYA 1VI2A 1WDKA 4WOKA 3ZU3A 5K9ZA 1KETA 1KY4A 3JQ7B 3OICA 3ONEA 3NEPX 2HQ1A 4CM5A 4ZD6A 4NQZA 3IQDB 3U49A 4E5PA 3EMKA 1H6CA 3PVZA 4CLEA 4Z3KA 1YGYA 3A9WA 3JQBA 4BOYA 4WK6A 1V3UA 3L4BC 1MX3A 3B20A 4N5NA 3ZZNA 3M6IA 3RWBA 1YBMA 1KEVA 2DBZA 3C1OA 3DZKA 4PGFA 2JHGA 3NAQA 2AQKA 1HYHA 3HDQA 4EDFA 1I0ZA 3B6ZA 4D42A 4DMLA 2PD4A 2SCUA 2X6TA 5I9MA 1K5HA 5I8WA 4ITUA 4HV4A 4IM7A 4M1QA 4BKPA 4CV2A 3IKTA 2QZZA 3LLSA 1U1IA 3U4HA 4DPKA 1WXDA 3PWZA 1ISMA 3TOXA 4E2ZA 2VUSA 3L9WA 3LK7A 4UUPA 4CM6A 1RM4A 1BXGA 3GVIA 3NX4A 3WWYA 3ZN2A 4PLZA 3U3XA 3KEOA 1JU9A 1UH5A 3Q0EA 4J4BA 4E5MA 4ZA2A 2VCYA 4BNLA 4O63O 1EDOA 4FSHA 3GVXA 3QWFA 2FR0A 5HA5A 4ROSA 4MP6A 1XWFA 4DIOA 3RASA 1YONA 1EQ2A 5TRTA 2ZTVA 3FNFA 1N1EA 4GGOA 3WYBA 3ZHBA 2HRZA 4FGSA 4DWVA 1R16A 1PJTA 2GUGA 3E48A 3TJRA 2Y99A 4HUJA 3ANLA 4XRGA 2DTXA 3X2FA 3K31A 1IL0A 1T25A 2IZZA 3EZLA 1LLCA 4IGFA 5DBIA 4K28A 5THQA 3TSCA 4R69A 4YJHA 3PQFA 1B0AA 3WFJA 1MP0A 1LUAA 3C7CB 1TB4A 4NK4A 3EVNA 1WMAA 1UZLA 2BLLA 3QE3A 4DREA 1B16A 2A35A 1BRMA 3OFSA 3K9QO 4TRNA 1K2WA 1BXKA 4BVAA 1P1IA 5IFLA 3PHIA 3DC2A 3ENNA 4I9HA 1EQUA 3HJAA 3PZBA 3KYBA 2Y1EA 4PLFA 5IZCA 3OJEA 2PKQP 1P33A 4KOAA 1TI7A 4QO7A 1DB3A 4XX0A 1XYGA 3IC5A 1X0XA 3ICCA 1XSEA 1WWKA 2GN6A 2JD1A 2PTGA 2GR9A 1ADGA 5G4KA 1VKOA 3RAJA 1RPNA 1F0YA 2ET6A 5AXAA 1I2CA 1U5CA 1I36A 1PU2A 1ENZA 4GGPA 2XOXA 3W1VA 4BMSA 1RM0A 1ZMTA 2WYUA 4GLLA 4R1UA 3RSHA 1MFZA 3BAZA 4P4LA 2I99A 5I7FA 4BO3A 4DIFA 4CM1A 5COBA 2UDPA 1NVGA 2X9VA 1J4AA 1R4NB 3G49A 3DBLA 4LN1A 4QXMA 4IJVA 4YT4A 4FJ1A 3AM5A 2WD8A 1CF2O 4RVGA 1I3NA 2OBYA 1KC3A 3CZRA 2OL4A 3FNHA 1XGKA 3AI1A 3RCBA 4AJLA 1N2SA 2NTNA 3W4KA 2YHUA 3G1UA 4FW8A 1DIAA 1LLQA 3WBBA 4IPTA 4IQ0A 1Z7BA 1GADO 1HLDA 4CQLA 4JJGA 2CFCA 2O3JA 4FFLA 4OQZA 3K5PA 3H5AA 4MVJE 2IEDA 3IDSA 4TQGA 3WQSB 3PIDA 3FSRA 3PWSA 5FF9A 3T4EA 3Q9UA 3UF0A 2V6GA 1DIBA 5F1OA 2DUWA 1XCBA 2B36A 1I2ZA 4AJHA 1E0DA 1B15A 1DFHA 2CVOA 5MGBA 1SNYA 4I5DA 1PZHA 3GDGA 3JD0A 1QV7A 2D2IA 3ZV3A 5KCZA 4L9RA 5JC1A 3D4PA 1VC2A 4MVJH 1W0CA 3UCXA 4EJMA 1UXIA 1H93A 2UAGA 5H83A 2J6IA 3UCEA 4CMKA 1A5ZA 4FOSA 1LDMA 2J3KA 5IDWA 4OSPA 2EJWA 2Z95A 4IXTA 1HLPA 4U6QA 5JY6A 1VJTA 2ZIZA 2UYYA 3O38A 3WGHA 4BGEA 3VH4A 2D0IA 4YAEA 4J16A 4YB8A 2AEFA 3WWZA 1YVEI 3OF2A 3CMCO 1CQJA 2C7GA 3CH6A 4RLHA 1B8VA 4BHTA 2HUNA 5AVOA 3ROKA 1AE1A 5DP1A 3SXPA 3OQ1A 4YVFA 3T7EA 4GVLA 1ISGA 1T1RA 3CTMA 5TNXA 3I4CA 1ISIA 2B35A 3H7AA 3GUCA 3IL2A 3GDFA 2E82A 3KXDA 3F46A 5A03A 3JQ9C 1T2EA 1KYQA 2EP5A 4CLRA 2D5CA 3U0BA 4OGWA 1Q7GA 3D5TA 3DWFA 4HKTA 1NQAO 1ZK4A 3RROA 3KZVA 1ENYA 3Q9NA 5BSGA 1HDRA 3I6IA 1Y5RA 5JXWA 2Q50A 1N7GA 4N7RA 1KC1A 4BNFA 1GZ3A 3GZ4A 3QJ5A 1Z45A 5G2OA 3SLGA 2CY0A 1FDVA 2VRBA 4CODB 4NR0A 4PFJA 3UUWA 4RV9A 3AI3A 1MC5A 1VSVA 1YXMA 1N7HA 4HFNA 4W6ZA 3KSZO 3ZV6A 1S7CA 4WLOA 2YV2A 4YJFB 5JE8A 2VRCA 1ID1A 3D5QA 4KMSA 1UDAA 3AWDA 3KV3O 4MVJD 1FMCA 2ILTA 4CQMB 5KNLA 1B2LA 3BTSA 4AJ1A 1AGNA 3FBGA 4AJEA 2P2SA 2EXXA 1P1RA 3NDIA 4JGBA 2VHZA 1JKIA 1FJHA 1RM5A 4Z3DA 5TSDA 2P4HX 3M2TA 4I8XA 4BKOA 1U3UA 1B8PA 3JD1A 4YT8A 1PQUA 5T64A 2FZEA 3AM4A 2X0RA 4U7WA 4PZEA 1AXEA 4W7IA 5DZSA 3BMOA 1F12A 3KVOA 3ST7A 1ZSNA 5JNLA 1BVUA 4XGNA 3G0OA 4R1NA 2YFHA 5IZ4A 4FIZA 5TGDA 1E3LA 3GNSA 4ALLA 1O89A 4OKIA 3FTPA 4BNUA 5F1PA 1Q0HA 4MVJP 1YKFA 3O9ZA 5CDYA 2W4QA 1HYEA 3RUDA 3I9JA 1YWGO 1E3EA 3T7CA 1LSUA 2CDBA 3KB6A 3L77A 4ZHSA 3KM0A 5A9SA 3F6YA 4DQVA 4CR6A 1GQ2A 4MP8A 2VHXA 3U4CA 3WIEA 4XJTA 1ARZA 4IZHA 1J49A 1QLJA 3QLJA 2HKIA 3JQGB 4ALKA 2VYNA 1Y81A 1I10A 1HE5A 4IDCA 4EEZA 1O9BA 1S6YA 3OQBA 4E0BA 3DBVO 4JBHA 4D7AA 3IJRA 4CMIA 1M66A 4J7CA 1DBVO 5COAA 4IQ8A 2VT3A 4AL4A 4YXFA 4NMHA 4YA6A 5BT9A 3F4BA 4KWHA 2OHXA 2YYYA 2R6JA 4ZQFA 2UVDA 2CDCA 3QWHA 4Q3NA 1HF3A 1ZO8A 1HDOA 3EK2A 1JLLA 1ZSVA 2C2XA 3JQAB 4GPD1 4GI2A 4IMRA 4XRRA 4OAQA 2XF8A 1MXFA 2CD9A 4IDBA 1PJCA 4UUOA 2Y1DA 1Q1NA 3AUUA 1FDUA 1IE3A 3TFQA 4GKBA 1GV1A 5F21A 5U9CA 3I3OA 5BNTA 3L6DA 1P1HA 5DBGA 2CNBA 3JTMA 2Q45A 1JKJA 4J4HA 3LQFA 4W82A 3GA0A 3Q6IA 1GUZA 3ETDA 2OP0A 3KBOA 1EK5A 2VZ0A 1C0LA 3RUHA 5IF3A 3WLEA 1ULSA 5CPFA 4J0FA 5A4DA 4EEXA 2QZ9A 4CL3A 3GHHA 4DQUA 1KVSA 1PSDA 4A03A 3NDJA 1EUZA 3DZFA 4E4YA 1PWXA 4WECA 4JK3A 3UFXA 2FSSA 4P4NA 1RJWA 4PG4A 2VWQA 4FGWA 1HE4A 1E6WA 1M2WA 2PZLA 1NAIA 4FD3A 2GPTA 1N5DA 4WE3A 4AJNA 3ZWMA 4FOOA 3H9UA 1I3LA 3QIVA 4C7KA 5CG1A 4OH1A 4IMPA 4D3SA 1I30A 2BI7A 2P9GA 2X4GA 1NAHA 3FNEA 3IAHA 1YL7A 4UVIA 2QYTA 5DOVA 2EW2A 3DB2A 1EVZA 4WJZA 1E7SA 1UP7A 2Y93A 3WXBA 4W9NC 3QWBA 2X86A 2OXIA 1J6UA 3RBVA 2Q46A 5IN4A 3RC1A 4FQ8A 4R1TA 1Z73A 2O50A 3ONDA 3QY9A 3WG9A 4HNHA 4F3YA 2BH9A 3WGYA 4R5HA 3PYLA 1Y1PA 4RJTA 1OBFO 1K89A 2PK3A 3BIOA 4FN4A 4Q3CA 3VPGA 3RC7A 1KIFA 2HAEA 2X22A 2NM0A 4D0SA 4EJ6A 3ZNOA 1GTMA 4HBGA 2BGMA 3EC7A 4BNTA 1U28A 1NVTA 4BIIA 2IDZA 4ALJA 4RPHA 4OXNA 4GX5A 3JYQA 2DBVO 1Q0QA 4Z0PA 4JP2A 4MIOA 4UREA 3PDJA 1QV6A 1PJLA 4Y6SA 3EUWA 3LT4A 4BQRA 4XIJA 4LSMA 4Y9DA 3VZQA 3O4RA 3U62A 2AQ8A 4YQZA 5BNFA 2C5AA 1D7OA 5EQFA 3FD8A 3S2EA 2RHCA 2GDZA 3V1TC 1HETA 5JMWA 5B4UA 2HMTA 3K2EA 3GEMA 3RIHA 1IZ9A 9LDTA 2DC1A 4MDHA 5C37A 3ASUA 1JVBA 1OC2A 5I9LA 1VSUA 2IXAA 5DF1A 1PZFA 1MB4A 2NQTA 2ZB4A 3RJ9A 4D44A 3GG9A 3INGA 2AG5A 4FJ2A 4G81A 1V6AA 4P38A 4TZTA 1HDZA 3KLPX 3WJ7A 3RUIA 3GHYA 5GZ6A 1Y5MA 3DBHB 1EMDA 1AUPA 1E1MA 4UUNA 1YO6A 2JHFA 1IOLA 3NDRA 2BFMA 1Y9AA 2FR1A 1ZFNA 3ZWBA 4TKLA 3R0IA 5ITWA 2V65A 5CHEA 5L9AA 1EVJA 2QRLA 2DQ4A 1I8TA 3QVXA 2E4AA 3JSAA 1N92A 1M76A 2EV9A 5T6BA 4DBVO 2NACA 3F47A 3WQQA 5ICSA 1EK6A 3BMNA 5L4LA 4J90A 1M75A 1V3TA 1DLJA 2DLDA 1DAPA 3FWZA 3GT0A 2DVMA 2YV1A 2EGGA 4YACA 4D3DA 4XZ3A 2ZJ1A 4KDEA 4BMVA 4OQYA 1SO8A 5T8KA 4INAA 2HK7A 3H4VA 4EUFA 1T1SA 1AN9A 1C0KA 2EERA 1J5PA 1BDMA 2VTEA 2Q3EA 3MJVA 3GN1A 1MG5A 5A9TA 3CXRA 4BNZA 4CMIB 2GYYA 2AMFA 3IMFA 3MWEB 1CWUA 2BELA 3NKLA 3JQ8B 3NJ4A 3EZYA 3I6QA 4FC6A 4D46A 2I9PA 1PX0A 1NYTA 1H0KA 1NP3A 2JCVA 2NU7A 2W2LA 2JFHA 3F1KA 1C0IA 1L1FA 4PN3A 2NLOA 4J91A 3LLVA 5TT1A 3OJFA 3VOSA 2FPIA 4U5QA 1PR9A 2Y0EA 3PGJA 1E5LA 4E5NA 4E31A 3OA2A 1O5IA 4WCFB 4B8ZA 1GZ6A 1ZK0A 5FI3A 4E5KA 1QYWA 2X7HA 2P5YA 1BW9B 3QW2A 2GO1A 1UXHA 4RF4A 1I33A 3BHMA 2QYSA 4RVHA 2OBNA 4LCEA 4U6SA 3EW7A 2B4RO 5L3ZA 3OEWA 2DTEA 3WTBA 5CEEA 3JQ7A 1IHXA 3HB4X 3ZHYA 1W6UA 3M1AA 3ZHZA 2HRBA 4W4TA 1X0VA 4WLVA 2VUTA 2X5JO 3LC2O 3LSYA 5GZ3A 1K6JA 5JCXA 2LDBA 3QVOA 4N5LA 5CEFA 3DFZA 1TA4A 4D41A 1DHTA 1ZXLA 2Q4EA 4JXKA 3H2ZA 4P22A 3D4OA 5GY7A 1H2HA 5BQFA 3C8MA 4ZJUA 3JV7A 2AE1A 3PLRA 4XB1A 3KO8A 3V2UA 5TS3A 1DSSG 3GQVA 2FPGA 4ZQHA 1IY8A 3F5QA 3AJRA 3EDMA 4NFYA 2OORA 3JQAA 1Y7TA 2WSBA 3PK0A 2Z1NA 4QTZA 5F3RA 4Y67A 1P31A 3HDYA 4B4OA 1DIGA 2VHWA 3N58A 3WGGA 5H81A 2NTJA 2FR8A 1PL8A 1F06A 2O23A 1JAXA 3DQPA 1I3MA 1Q2XA 2VRCD 3HWRA 1V3VA 4M49A 3IJPA 5DT9A 4YAIA 1KEUA 1GUFA 4AG3A 4GX2A 1DRUA 2JD2A 2P68A 3WGOA 4J1SA 2PH5A 3LU1A 3WTCA 1IULA 4YJHB 4GH5A 4WOJA 2FRDA 5DCYA 3GAZA 3I9MA 2FWMX 4WCFA 4PVCA 1HE3A 2YV3A 2PGDA 2QX7A 1ONPA 4YPOA 3A28A 5GZ1A 2NQ8A 1NFFA 3PFFA 3IOYA 3EHEA 1XELA 4OXKA 4A7PA 3P7MA 1EEHA 2OZPA 1UDCA 5ER6A 4NI5A 2DPGA 6ADHA 1P44A 1QYVA 4J7UA 3AW9A 3ZNQA 4DTIA 5L53A 2PKQO 3H6KA 4GVXA 3SJ7A 3ZNPA 2VHVA 4BUCA 5IG2A 2WD7B 1OAAA 3ITKA 1P0CA 1FXSA 4PLPA 4BO1A 1HTBA 1GZ4A 1T4BA 2HMVA 4CMJA 4MJLA 3HB5X 2O2SA 1DHRA 4AJPA 2Y1GA 1NFRA 2FPPA 1VLLA 1LSSA 2HO5A 2PKRA 2X0IA 3ZGYA 4PZDA 3WOHA 1O95A 3L4BA 5L45A 1OMOA 1R4NA 5JDIA 1SBYA 3AM3A 2OOSA 4A5OA 5KJFA 1Y8QA 1DJQA 1SOVA 2ZTMA 4GMGA 4CUJA 2F00A 3SC4A 3ANNA 2NWQA 2IYOA 1Z74A 4P8RA 3RKUA 4TMFA 4YRAA 4XR9A 4WLEA 2CF6A 1GD1O 2HU2A 4J49A 2HMSA 3WMWA 2GZ1A 3FRJA 3MJCA 4CPDA 3RBXA 2O2YA 2OO5A 3AOGA 3HN7A 2D4AA 3WQRA 4EUHA 4HADA 4CLHA 2NV6A 3QVSA 4Y6PA 2GD1O 1P9LA 1SZJG 5JMPA 4BO5A 2Q1TA 1SEVA 1XHLA 2R00C 4OM8A 2FZWA 4JN6B 3AUSA 4BO0A 1ZCJA 4PLTA 1KVTA 3JD3A 4ZICA 4RVFA 1H6AA 3FNGA 1LEHA 5DNAA 3VHRA 4BO2A 4HWKA 4NZ9A 5TX7A 3BMCB 3DZHA 3MEQA 3O26A 3ROMA 4CQMD 3QA9A 5JYDA 5I7VA 1PJBA 4XYEA 1ZJZA 3ANMA 3I23A 1KY5A 4CMBA 1EVIA 4Z6KA 2B5WA 2D59A 3HN2A 2DPHA 1XG5A 4TWRA 3RFTA 5CAEA 1P77A 3DXFA 2JL1A 5ER9A 5HBRA 1Y8RA 2PZMA 4B3IA 2NVBA 1YBAA 3H8VA 2GERA 3D7LA 3BTUA 2G1UA 1LDNA 4PIVA 3GEDA 2H9IA 4UEKA 3VTZA 3ZWWA 4PLGA 1NR1A 5G4KB 2VWPA 3H2SA 1C1XB 1V0JA 4I1IA 5ADHA 1KEWA 3WSVA 3GNTA 1CDOA 2O3UA 3P2OA 4YRDA 3RI3A 4DPLA 5COQA 3PHLA 1UAYA 3VPFA 1ADFA 5BSFA 4IBOA 2AA3A 1QKIA 4RF2A 2C7VA 2Q2WA 4CMEC 5B1YA 4R3NA 3R6DA 5I7SA 1IB6A 2CMDA 3DEYX 4WGGA 4UVGA 1P1JA 4ND1A 5EQDA 3MJSA 3CEAA 5CEJA 3D64A 2HLPA 1E5QA 4KP7A 5BSHA 1U7TA 2E37A 3AFMA 5GMOA 2W2LD 3PHJA 1BGVA 2PGLA 5CFZA 3E6AA 4J9VA 3OETA 1YQDA 4NDNE 2I65A 2C29D 5B4TA 2LDXA 3F9IA 3ONFA 1V9LA 1W73A 3U4DA 4BB6A 2UUPA 4TKMA 3PIIA 2HK9A 2OMEA 4RPJA 3ZW8A 2BFPA 2O3QA 1I01A 1MC4A 3QVTA 4YR9A 4AVYA 1U3WA 4QQRA 3VH3A 1B7GO 1BXZA 2BFOA 5HS4A 5IDYA 3CINA 3IKVA 3RJ5A 1ZXBA 1PJQA 2O3RA 3GDOA 3SC6A 3OMLA 4J7XA 4RF5A 5ENDA 3GZNB 5A3JA 1T24A 1IPFA 1VPDA 1NR7A 2G17A 2EG9A 2VN8A 4IQGA 4OYRA 5G0UA 3KUXA 3VPSA 1LA2A 1F17A 1PZEA 3ROPA 1T26A 3NTOA 2Q1SA 1NXQA 4B7XA 4CMEA 1KVQA 4QFCA 4NHEA 5CPBA 1PL7A 1G6KA 3VDRA 3WGIA 5AYVA 2X5KO 4KTTE 2NVUA 1OC4A 2UUOA 3WYCA 4XWYA 2Q99A 4MKXA 4QUKA 3KYCA 4XQCA 1NNUA 4CM8A 2YFQA 4A73A 2YJZA 1X1EA 1C1XA 1YB1A 2VYVA 4E2WA 2HJSA 2ZK7A 4H7PA 4QECA 3Q11A 1EE2A 3Q1LA 3Q2KA 2JCYA 4BNIA 1A71A 1UXJA 1NX6A 3KHUA 4YBZA 1Q7CA 3ETEA 4ZRMA 4WCFC 1TLTA 2O7QA 5F5NA 3PYXA 4CLXA 2EEZA 4XGKA 1QR6A 2VZ9A 4L74A 4YT2A 3TZHA 4BNHA 4XCVA 5K6AC 3INRA 2D1YA 4B4VA 1BG6A 1XR3A 2PD6A 3MOGA 4L4RA 3PTZA 3OBBA 5JBIA 2BFAA 1H2BA 3C7DB 3ULKA 3F5SA 3QQPA 3ICPA 4FB5A 3DZBA 3E9QA 3ZWNA 7ADHA 3PLNA 1SAYA 3E03A 1N9GB 4GX1A 3E9MA 3WJAA 5ILGA 4DC0A 2I66A 1T2DA 1Y8QB 2I76A 4JX8A 3ROQA 5FWNA 2PLAA 5AXBA 1JVSA 1C1DB 1LC3A 2OFPA 1GPDG 1E6UA 4HY3A 4XYGA 4M55A 3VKVA 3WIDA 2Z5LA 3PP8A 3QP9A 3LZ6A 1PS9A 3LF1A 3ZDFA 3DMYA 1ZW1A 3BMCA 4KQWA 4I08A 3MJEA 2XXBA 5EMHA 4TRRA 4OSOA 2QQ5A 3ZH2A 1YQXA 1SB9A 1ZK1A 3GGOA 1NM5A 2NNLD 1YL6A 3KETA 1NBOA 4E13A 3BZUA 4NPCA 1U5AA 4MVJI 1NTOA 3I9KA 4B7UA 4E2YA 4PG5A 1RYEA 3WGTA 1MA0A 4DQXA 3PGXA 2WJPA 3LT2A 3IP1A 2JFGA 1SC6A 1LLDA 4K6FA 3GY0A 3WGZA 5C7LO 4CM7A 4K9DA 5KTKA 4IJUA 3UN1A 4CMAA 2DBRA 1YOVA 2I3GA 1HE2A 3GMDA 4OOEA 3L6OO 3G79A 4QSMA 1JDJA 2J5QA 2XPCA 1XKQA 4Z0TA 4B4WA 2RBEA 3F3SA 1PQWA 4Q3BA 4PCVA 4AJ4A 3GMSA 5C5IA 1HZJA 4J9UE 4R9SA 1AHHA 4GAEA 5JS6A 3GUYA 1M67A 3DDNA 1WDLA 1MXHA 1ZBQA 3PJEA 4BNWA 4IDDA 4PLHA 2J5RA 3Q2IA 1TT5A 3ZWCA 3JD2A 5I9NA 5EERA 5DOZA 1DAOA 4XQEA 3CUKA 2AXQA 4CR8A 2ZQYA 1LRKA 1JAYA 3ASVA 4PLCA 1PJ2A 3D1LA 1LQUA 4XYMA 3JQ8A 2X0NA 4S1VA 3HFSA 4B79A 2I67A 1DRWA 3K92A 2DAPA 2OUIA 2B69A 3DR3A 1GEEA 2WDZA 4EBFA 2AQIA 5B37A 1P74A 1H6BA 1WZIA 1DDOA 4NG5A 2XXJA 1HKUA 4ZRNA 1SB8A 2FMUA 3U5TA 3TNLA 4BGVA 3KEQA 3HUDA 2PA3A 4W9NA 3WDSA 2C59A 2C2YA 3DBRB 3JQGA 3DAGA 2NU9A 5JDIC 3T4XA 3OH8A 2NU6A 3LYLA 3VVCA 4WUVA 1Y8RB 2R2GA 3U9LA 4E12A 4RPGA 3RUEA 1HSOA 1NASA 1LRJA 2GASA 3RQSA 1OOEA 4XB2A 3VDQA 2ZB7A 1VM6A 2GN8A 4TSKA 3A14A 4DBZA 3DHYA 2X9GA 3OECA 2E6UX 2X5OA 5TT0A 1MV8A 3PFWO 5DULA 1KEPA 3GFGA 3TL2A 2WWRA 1KVRA 3AUAA 4UUMA 3OHSX 4CM9D 1QSGA 1Y9EA 5L7YA 1LRLA 2BGKA 1XQ1A 4O6VA 1AHIA 4YJDA 1T2CA 4KUHA 1PJSA 3GG2A 4H16A 1UP4A 4NBWA 2TMGA 4GBJA 3EVTA 1Z6ZA 1B3BA 2Q49A 2VT2A 2HMWA 3PYMA 3FPLA 3X2EA 3W6UA 4M8SA 3DTYA 4TVOA 3V1YA 4RCVA 5IN5A 3VZRA 1UDBA 1ZSYA 2NVWA 3GEGA 4BO9A 1VE9A 3VVBA 4P4GA 1FK8A 4NFHA 1DO8A 5EL0A 1YDEA 4FJ0A 4MVJA 4PZCA 5TF4A 3S1LA 1B26A 1CERA 3JQFC 2YZ7A 1LQTA 5JCJD 3KYDB 4ESOA 4YEDA 3VPXA 4NBUA 5KVSA 3BYZA 4EYEA 3AFNA 1PTJA 1U3TA 2BI8A 3HSKA 4NK5A 4D43A 1LDYA 1NWCA 4OMUA 1LI4A 1E6EA 2WD7A 4TRJA 4Z9YA 1A27A 1DFGA 1ZZEA 1ZVMA 4J4TA 4XGIA 3A1NA 4I9UA 1P45A 2JAHA 3FPCA 4MVJF 1DEHA 1GFSA 4TVBA 4OL9A 1MFPA 1NQ5A 3GGGA 4YRBA 2O48X 4GSLA 3ZV5A 4NU5A 5A04A 2IXBA 4WNCA 8ADHA 1UUFA 3KYCB 1GV0A 3QWAA 4BQPA 5JAZA 1ENPA 1HT0A 3JQEA 4DL9A 3K73O 4WLFA 1Y6JA 1CETA 3KSUA 2VWHA 4MKRA 3E5RA 4R3WA 2PGJA 3SX2A 4CUZA 4URFA 4R4JA 3MJTA 3JQ9A 2X8LA 4MPDA 1FF9A 4BGIA 5EINA 1NHWA 4E6PA 3AY6A 2G82A 4QO8A 3RD5A 3GVCA 3L0DA 1C1DA 2X0JA 3WMXA 1DJNA 1PEDA 2EF1A 2E48A 3PJFA 4K1LA 1LU9A 1YJ8A 4GSKA 5KOIA 5CDSA 3GR6A 2VQ3A 3AU8A 3DMTC 3H3FA 5LDHA 3JQCA 4JQCA 3EYWA 2FY8A 3PJDA 4DPMA 4FCCA 4II2A 1OZAA 3NTQA 3W4JA 5EN4A 2VUUA 1LTHR 1R4MB 3JCZA 4NJOA 2GRAA 4ND4A 2FN7A 1R0LA 3GZNA 4BNGA 5JO9A 4C7JA 4XA8A 2HK8A 4KZPA 5CP8A 1WDMA 2H63A 4ID9A 2IRWA 1TT5B 4BO7A 5C3MA 1DRVA 1UAGA 3CMMA 3ZI0A 3HHPA 1PZGA 3F4LA 4D79A 3PWKA 1A72A 4XDZA 4LRSB 5C7IO 3S8MA 2A4KA 3DBLB 1DXYA 5JDCC 3SVTA 5BSEA 3H65A 2V7PA 2EKPA 1PJ3A 1V8BA 4ZQEA 3ZWXA 3N7UA 1GYQA 4EJ0A 1YOVB 3EAGA 1EBFA 3H9QA 1PR3A 3E18A 5BR7A 1GCOA 1LBEA 4LW8A 4J1NA 3JQDA 5L4NA 2DFVA 1C14A 2C20A 2OP1A 4LISA 2EW8A 4RDIA 1DIRA 1I5RA 2C07A 1HEUA 4TRMA 3NRCA 4YAJA 3V1UA 3IUSA 3TL3A 2GN4A 3RVDA 1R15A 4A0SA 2OGUA 1BVRA 8LDHA 4R01A 3PEFA 3VKUA 4DXHA 4N54A 1BTOA 2A9FA 2JJYA 5AXDA 1HYGA 1GDHA 2CDAA 1A4UA 4DYVA 1QYCA 4GWKA 2ZKLA 3PI7A 5ITVA 2DFDA 3GF4A 4Z9XA 4CUKA 4H3VA 2O4UX 3OIFA 2PR2A 4KUGA 3OP4A 1A7KA 2HSDA 1E7WA 1OFGA 3CKYA 1KBZA 2J5KA 1WZEA 4BNVA 5JDCA 5TIIA 4LVUA 1LJ8A 2WTBA 4MO2A 3HQ4O 2Q1UA 4RDHA 3FF4A 1G0NA 3WBFA 3G1TA 3UHAA 4E2XA 3R3JA 2VWGA 5A06A 4IDGA 9LDBA 1R0KA 3VZSA 3H5RA 3WSWA 3MWDB 2F1KA 2P9CA 3E82A 5LC1A 4E30A 5J23A 4KDFA 1U3VA 3D3WB 4RO0A 5IXSA 2CZCA 3WX0A 3ZCXA 5IJZA 2EKLA 6LDHA 5FI5A 3PQDA 3HNPA 3ZWOA 3IIEA 1PIWA 2Y66A 5G0VA 3BHJA 3S2IA 3F1LA 5T5QA 2XAAA 2X58A 3HG7A 1E3SA 3QV1A 4I5EA 3NJ8A 4KUEA 2J8ZA 2G0TA 4RZHA 4GWGA 2DKNA 3OEYA 4IS3A 1H5QA 1K0UA 3QSGA 3ADOA 5EPOA 4XQ9A 5KVCA 1U4OA 4L4XA 3DAFA 4JIGA 4ZQBA 1KVUA 2PNFA 2DUUA 2G5CA 3JQBC 3C85A 4DMMA 4N5MA 5DCWA 3S2GA 4YYZA 3G3EA 1MUUA 4CQMA 2Z1MA 4MIYA 3VC7A 1SMKA 1HDXA 2AQHA 3VH1A 1YH3A 3H9JA 3U4IA 4RVDA 3ZWVA 1JWBB 5ICMA 1NFQA 3W8FA 4ALNA 5C7OO 4GQAA 1K6XA 4NU6A 3WNQA 2HMUA 3DHNA 4RVUA 4Q3EA 5DCUA 2RIRA 3BMQB 4AJ2A 4X54A 2V6FA 2Y68A 1JW9B 3LT0A 4B3HA 1C0PA 4CQLB 1DPGA 1TEHA 3GH3A 4QT0A 4CJXA 5G0TA 1YL5A 2IYPA 4ZVVA 1XEAA 1LX6A 3O8QA 3ORFA 4CV3A 3TFOA 1ZKMA 5JC8A 4YJFA 2BMAA 1ISHA 4DC1A 2CF5A 4Q3AA 2VOEA 1A9YA 2W90A 1QMGA 1VKNA 1D4FA 3CPSA 3ZWPA 2Y05A 3GFBA 4ND3A 3ZU2A 3Q3CA 3PZRA 3JYPA 1VL6A 2Y1CA 4CL8A 1QORA 2EIHA 3PPIA 1BHSA 2P5UA 4GKVA 2V6BA 4XKJA 1F8GA 4AFNA 3RFXA 3NT2A 2CVZA 2AEMA 5JW6A 3EGOA 3FN4A 3H9GA 3H5NA 1E3WA 4YJGB 4J2HA 4BNXA 3WR5A 5H82A 1XQ6A 5KVVA 3I9LA 4O59O 2ZCUA 3RBZA 2FP4A 2AHRA 4RVSA 3S55A 4XQGA 1L7DA 2FHSA 4GLOA 4BO8A 4F46A 4RQTA 5CDGA 1U2GA 4PRLA 4FFRA 4TZKA 2J3HA 1N8KA 3VPHA 4EZBA 1SEPA 2PH3A 3MJ4A 4IZIA 2WEKA 4HFRA 4HNGA 2Y67A 5T57A 4CLRB 3PXXA 1GQQA 3SLKA 4Y6RA 1EFLA 3HFGA 2P91A 4PVDA 3CSDA 4MVJM 3I52A 3OIDA 3M2PA 4M54A 2RH8A 2JAPA 5T67A 1D1TA 2VHYA 2I6TA 2WE7A 2AE2A 3A4VA 4DRYA 4LMPA 5KKCA 4RGBA 4HXYA 3FWNA 3INTA 4JBGA 2X1HA 2FSVA 4E21A 3P19A 1X1TA 3I4FA 5I8ZA 4UEOA 4WLNA 3WLFA 3TDKA 3KTDA 4WKGA 4J3FA 3E8XA 3B70A 3ZHXA 2EJVA 2GNAA 3HDJA 4UULA 3PQEA 1ADBA 3DZJA 5CDUA 1D8AA 3BMQA 1MGOA 4W99A 2Q1WA 1PGNA 1E1KA 3R1IA 2GLXA 1H9BA 1ZEMA 3WB9A 4HFJA 3UH1A 3COSA 4AJKA 4AJOA 3LT1A 2Y1OA 1UR5A 3RC2A 1K6IA 1LC0A 5KJ1A 1P1FA 3AI2A 3GRPA 5L95A 5JLAA 4DLLA 1EVYA 4A27A 4CM9A 5KKAA 4IDAA 1VJ0A 4EGFA 1XLTA 3CIFA 4XYBA 3UICA 1OI7A 2BF7A 1DC5A 4L75A 4CLOB 5TLSA 2QRJA 2W8ZA 4J6FA 1Q0LA 5JAQA 2AW5A 3SJUA 4GX0A 3CE6A 3B1FA 2VYVD 4RL6A 2I3AA 2D8AA 2ZYGA 3GGPA 1X7HA 3V2GA 3HZZA 3V8BA 2C82A 3NUGA 2B0JA 4L8VA 4IGEA 4I5FA 1ZJYA 2ZCVA 5EJ2A 3UAGA 3DFUA 1YE3A 3UGKA 3EY4A 2GCGA 4II3A 4Y98A 5DP2A 4WASA 3FHLA 1W8DA 4DUPA 1GYRA 3KLMX 3WS7A 1R0SA 1IUKA 4UAGA 1HDCA 2ZTLA 3BMNB 1B8UA 1NQTA 5THKA 4ZGWA 1D3AA 1JWAB 1I32A 4M87A 5CDTA 4Y8VA 1R6DA 1NVMB 1P0FA 2EP7A 4FS3A 4JBIA 1HWYA 3BMOB 2EKQA
chains in the Genus database with same CATH superfamily
1P2TA 5JZVA 4ZPXA 1ADCA 3GJ0A 3KKMA 3NOXA 4JWTA 1RM3A 4DQDA 5HXAA 4TVKA 1O6BA 3SICE 3T52A 1H8EA 1RHMA 4GR9A 1XCGB 4HDMA 2DFPA 4ZZIA 3EAFA 4DLAA 3KC2A 3ME5A 3M83A 1UFQA 5HRUA 4PANA 4A2QA 2BFFB 2CCKA 1KOLA 3WL6A 1WLSA 3L8FA 3AVUA 4NBTA 3T94A 4RAOA 4IZ6A 1UBFA 3K96A 3I53A 1A9ZA 4RL4A 3OLCX 4DSZA 3O90A 2P0AA 1RWWA 1ZIYA 1U2DA 2IPLA 3D3WA 3PLAE 3UH0A 3G7SA 1QH8A 3ACCA 3VYSB 5ARBA 2ZUEA 2QRMA 1ZNQO 3HI6A 1WZNA 2H65A 1S8NA 1ODFA 3T95A 2IZ1A 2ZYIA 4K26A 4NMMA 4YDRA 4BO4A 1TYZA 2W0SA 2PX2A 2XRFA 3DONA 1ESZA 2FRXA 5LLSA 2OAQ1 2A5DA 3UT6A 4KR2A 4RHCA 1Z0KA 1GYPA 1H0SA 4MUEA 4RTLA 1SKQA 3C8ZA 1KI8A 1CQXA 2CLSA 4OB7A 4PYKA 3TQCA 4B34A 2MYPA 2ORIA 5HWSA 4XWWA 3AB3A 4UTRA 2WB2A 1O94A 2I4OA 5DJ5A 1LSOA 3MZ0A 5EKTA 1YQGA 4R51A 5E6RB 5C1OA 1LJUA 4RZIA 4ARZA 1XTVA 4ZQGA 1Q19A 3G2MA 1GPJA 2J85A 1J9GA 2Q3JA 3FCEA 3FVVA 2NNWB 5KCMA 3CLSC 4PHGA 3EGDB 5CBPA 1ZH0A 1ESEA 1NL3A 3BHIA 3MN1A 3FJYA 1WOYA 2XZDA 1MJ5A 1VHDA 1LDEA 3PTLA 3UB2A 2JKVA 4WX2B 3FDIA 4ZPJA 3UV7A 2G83A 2A1TR 1XB2A 4R1SA 5JWOA 4L9AA 5HKLA 1Q7EA 1GLGA 3MT7A 1NRJB 4RXTA 5L6LB 2P65A 4MCJA 5A7GA 4B7ZA 2ZS9A 3D3EA 4R83A 1EFRD 1G20E 3DDOA 5EKDA 1I7NA 2VYND 2C96A 3PPVA 4XLLA 5FX2A 5F2NA 2RB5A 4ZI5A 4EKIA 2C2KA 3A9UA 4Q93A 4FFNA 3LD9A 2VDKB 3BM5A 1OJ7A 1UZNA 5AW9A 2G9NA 3KB2A 4RENA 4D8YA 2W42A 2O8DA 2BMFA 4CTNA 1GDTA 3D6UA 1LFDB 3R3SA 3W79A 5K5EA 4NAVA 5CDFE 3WWOA 1EWTA 1E2LA 1E3JA 1H42A 1R8SA 1KQPA 3FM9A 4MRRA 2PO7A 4N9WA 1XVAA 2D2FA 1DV1A 3RTBA 1RT9A 3K0CA 1OREA 4QASA 5EGNA 4DXDA 1N5MA 2RH9B 2N42A 4OSEA 1K27A 5DBFA 5SZKB 4DNQA 1R5OA 4JC4A 5KJCA 3VC3A 2I4TA 1GUYA 2EBWA 3P9ZA 2J3JA 3GJ6A 4Q7JB 4U2CA 1VE5A 1AG9A 3E3AA 3GRVA 4XSVA 5I7OA 4EENA 2HLNA 3QLUC 5FLXA 2XMQA 1WCIA 4ENSA 2QRPA 3QKSA 2BSQA 4TXJA 5IULC 3R6WA 2F9FA 4QG7A 4XIGS 1NHGA 1KZ9A 2I5PO 2CUKA 2XSZD 4YLGA 4G5RA 1H9CA 2C4TA 4CKBA 3OQ6A 4Z9FA 1C3VA 5KWEA 4LQLA 3TTVA 3I92A 1RS0A 3ZIAD 4ZZ3A 2QMYA 1SCUB 4LVCA 1H66A 5LQRA 4MOWA 4BLQA 4EMTA 4D0RA 3QKTA 5HQTA 4XQ0A 4DUGD 3WC4A 3SYKA 3ZYCA 4PE5B 5CVCA 2YOGA 3AZOA 2CXOA 5KTMA 4IY1A 4RZ2A 3KUCA 4JL5A 4OJYA 1N2BA 1KAQA 4PQFA 1X13A 1WB9A 2ASEA 4JZKA 4MHSA 3UAZA 4MUIA 4PNZA 3WLMA 1VRCA 4K5QA 4CMGA 3RYCA 2QUHA 3TOZA 3VAZA 5CDSA 1E92A 1DC6A 1JALA 1ZDMA 1Y5LA 1TVKB 2POQX 1YB4A 3U60B 4OHZA 3GJ7A 3HGMA 5DYGA 7YASA 4OIMA 1P5RA 1YAJA 3IP3A 2RHDA 4HLDA 1WKVA 4MQBA 1DAEA 4OO3A 3TIVA 2R7MA 3FVWA 3ZLUA 5AVSA 1L7AA 2WA2A 3C3DA 4H77A 3RIEA 3NETA 4C88A 4MNTA 5LB2A 3B5EA 3MTGA 1THTA 3NMUF 2H1HA 1DEXA 4NBKA 5AQ1A 3OOHA 5KSZA 1JDUA 1Q2UA 1QGAA 1DT3A 5HX7A 4AZ0A 3NHBA 3FYUB 1VIDA 2D0DA 3FR8A 2C98A 2XKBA 4JVSB 7REQB 3RRYA 1C30A 3LRPA 4OU5A 5C81A 4R54A 1RCTE 3SIRA 4J1TA 3C3XA 4LXQA 1GAEO 2DFTA 3M6MD 4K9NA 4EUEA 3T9EA 3A1VA 3CX8A 3AC0A 3GAFA 5LA6A 1GT91 2K4MA 4Y9UA 3B82A 1ENOA 3NYWA 5BUSA 1PGOA 1JSRA 1ZK2A 3CUTA 5G02A 4EW6A 3EXHC 3ZU4A 1V8DA 2A0WA 1R37A 2YJ6A 3IVMA 5BOSA 3DZGA 1ZICA 4ILKA 4XUGB 1ZY2A 5EIHA 4WZAE 4DIDA 3RKRA 2B98A 4UEJA 4G2NA 2P1ZA 3HYTA 1HRDA 3TLEA 5JSYA 5F7OA 3T4UA 5K05A 3ZLJA 3JZAA 4XTRA 5ITZB 1WULS 2VXOA 3I73A 5CB4B 1KGSA 2DG2A 3KU4A 4CM8B 3QLUA 3DW3X 4QNRA 4UQPA 4L8YA 4JUFA 2RHMA 2Y1FA 3OTGA 3GFSA 1OTYA 4Z3OA 1QZXA 5BSKA 2ZYUX 2QIPA 2ZB3A 1NF3A 4QZVA 4GECA 3LPMA 4AQDA 3ON5A 4L6CA 3A26A 5DRTA 1RXWA 3DE4X 3AUXA 2H2FA 1AQYA 1UBHS 3ZTWA 2J4FA 2BZGA 1U2SA 1X14A 1IPEA 2IZ7A 1QVVA 3P9YA 4O4JF 1W75A 5LNK6 2C95A 4KE9A 2JLBA 2FW1A 1E2BA 4YCJA 3KFLA 1TZBA 2I1VB 1UKAA 2WJJA 3LT5A 4GVPA 1R4MA 4HTFA 1O3YA 3NTXA 3MG9A 4PO3X 3WMRA 4L73A 4FGZA 2ZWMA 4WBNF 1ZGHA 4RGYA 4FFMA 4AD8A 3C7AA 3BTVA 3K8ZA 4O2LA 1WOMA 1OYOA 2CNOA 3KWLA 4AZVA 2P8JA 4ANFA 4B46A 4C2UA 3H42B 4QGAA 4KFUA 1SHKA 1AK1A 1EAMA 3AY7A 5GJCA 5K6RA 1DC4A 4YCBA 1OA0A 1ISJA 1DMSA 3P4YA 1I4OA 2HN9A 1DELA 4PS0A 4QU0A 3T1HB 3RB8A 2HBRA 2VJMA 3PNQA 3VR6A 5JWRA 2CLFB 3PFGA 5HIMA 1NJSA 2R6AA 3BBLA 4KX3A 3IIKA 3WZLA 2WJ6A 3KOWA 3CS3A 1O0BA 2JGRA 1FDWA 3AIOA 1WZ2A 1FFHA 2V5AA 3FA2A 5AKKA 1CJTC 4F6CA 2BH2A 4JCOA 3DZIA 1NW3A 3VBCA 1E5XA 2IYWA 3KT3A 3ZBQA 3DOCA 4CLDA 4ONEA 4ZVPA 4A2CA 3ELBA 4NV1A 1WM1A 4ZCPA 2AK3A 4LWQA 1E7MA 3CO5A 3SAJA 2OAP1 3EEQA 4KAJA 3X1MA 5A5FA 3UOAB 2BFFA 1USKA 1TKAA 5IAJA 1L0BA 2ABWA 3FPBA 1G1AA 1VFNA 7GPBA 1KEKA 4C87A 5YASA 1U0GA 2QW1A 1EXMA 4PTZA 5K7SA 3TI7A 3P26A 3EFOB 3V7YA 2ZQZA 2H5LA 4QDKA 4XWAA 5LCXA 4YRNA 3NANA 3D8HA 4S1NA 5EE9A 1G98A 4OI4A 2H07A 4PR0A 5BRNA 3OFJA 1DDIA 1KP2A 2XDYA 2YY7A 3A0UA 4RIEA 4D9GA 2QY9A 5CNJA 2XCQA 1RWVA 1UXKA 1TGYA 3WRYA 4UU8A 1QH9A 2B83A 1YQQA 2QIOA 3RVLA 5B7NA 1FX0A 1KDRA 3GLIE 2GVNA 4BLVA 3K70C 1MH9A 1RYYA 4G0YA 5LMCA 1DZIA 3N2EA 2WYVA 1RKXA 3EMDA 3L7KA 3KTAB 2H5EA 4F2HA 3ETGA 4PGGA 1ATIA 2CLLB 4KR6A 1YJXA 3R0QA 5EVCA 1YULA 1CYDA 1KJWA 3R44A 3PNSA 1X1SA 3N1UA 4XIYA 1U1GA 3I9OA 1M3SA 4FONA 4EY5A 5C4IA 3FZYA 4JY7A 5GIOE 5LMUB 2I4LA 3P0IA 4K87A 4YC7A 1MB0A 1Y1TA 2HDHA 1O0CA 4X3OA 2EW1A 2O3SA 2PXCA 2YJTD 1M2NA 2ZJ0A 3GUUA 3OX4A 2J6CA 5G4LA 4N0PA 2BEUA 1G55A 2JLZA 1PV4A 3C3YA 4G1EB 2P7IA 2CL6X 1RADA 3I9NA 4KXWA 3HU5A 3TB6A 2WYWA 2F4VB 1FY2A 3H1BA 5DKFA 1HNWB 2BZ1A 2WINI 2BKEA 1SKUA 1ZI9A 3CA8A 1JNXX 3GRFA 5BQ3A 1TM3E 5ULLA 2Z9CA 4F6LA 2XGSA 2JD0A 3YASA 1I7DA 3HDHA 3GPIA 1DOHA 2YNMD 2OZVA 5J2UA 1H2WA 4B3MB 2QZPA 5J1SB 2DHEA 1ECPA 3I8XA 5A1JA 2V7TA 3OU6A 1E1RA 5I7AA 4CLOA 2F8LA 1RLOA 4N3CA 1ZD4A 3UXHA 4FYMA 5A71A 1VCIA 4ED9A 3IR5A 3KJGA 2E1PA 4E1AA 4ZVSA 2EGHA 3RG2A 2CYBA 2Z3WA 3LS2A 3QPCA 3L0CA 4K6CA 1Q57A 2OWDA 1RQNA 4EHAA 1GQRA 2H54A 5IBQA 5BN3A 5H80A 2CVQA 4BV8A 5MDHA 4PX3A 4EKDA 2R751 4WCDA 1U4SA 2O1WA 4UKDA 1D2NA 1MPXA 2NYVA 4WN9A 1WABA 4D9BA 1G7RA 1C41A 2P1DA 5J2UF 2AVNA 2PX8A 3DVRX 1QK4A 1M8PA 2VCHA 4ZMBA 2JFWA 2BGLA 2ZAMA 4JJAA 3SN6A 4O4HA 5L3QB 1M5UA 1DBQA 3MCUA 4UZSA 2IVFA 3SI7A 4XR4A 4CCSA 3JQAD 5G3ZA 4BVKA 2YS7A 1AB6A 2A5LA 3G9UA 5G0SA 1YACA 1QLHA 5EXSA 2ZW9A 1C4OA 4CE6A 3STHA 2E7ZA 4WAUA 3C0KA 2XGJA 5K3FB 2W6OA 4KODA 3VU3A 4EPVA 1MEJA 2QD5A 4L0CA 2Z2YA 3HKBA 4MP3A 2RCYA 4CM4B 3WTCA 4QGSA 1H2RS 3B6KA 4JBXA 4V3BA 4UHDA 4G4SO 1R9JA 3OX1A 5G1NA 1GKIA 4KR0A 4DIKA 4XDGA 3L8DA 3GI1A 4HX5A 1M2KA 2Z8YA 3RUPA 4YAKA 1O95C 4W5RA 2P6OA 2WWWA 4B4UA 3B6EA 4HMOA 2W4IA 4FMDF 1MLDA 4LOHA 1FYEA 5DT2A 1XJ5A 3I83A 4RKYA 2PJDA 4TMYA 4LMRA 1CIPA 4WBSA 5EWLA 1Z08A 3FJOA 3W6PA 4J43A 5DNEA 1QNFA 3R9XA 2O5EA 5JIBA 1B6TA 3B6JA 3L43A 4URZR 2PSHA 5ALPA 4WEOA 3ITDA 3THWB 1K8ZB 4TLDA 3HZOA 3TECE 3FB1A 1PGPA 4QEZA 3U09A 2BZSA 2NG1A 1X8JA 3D7KA 4RSMA 4AZTA 5FYQA 2YR0A 4MZXA 3UYKA 1UQUA 4GPBA 1GPMA 3A06A 3HCAA 3QPWA 4M38A 3HADA 2ZJ3A 4MQLA 4B9EA 1TCVA 4D0LB 1M34E 3VX3A 3EIFA 1I0IA 2JLAA 4MQEA 5KIAA 4DR1B 3MGBA 2QN8A 5ALJA 3LC1O 3H86A 1V4NA 2NTVA 1CVRA 2BRUA 1CP3A 1JYSA 5EXTA 2VDWB 4LXYA 3T0FA 4DSNA 4DDWA 2F43A 1ZD2P 3DVLA 5C35A 5AXCA 1XROA 1NDUA 3ESBA 3NZEA 1E2IA 1N78A 2GXUA 3GJ3A 1OLUA 4BGUA 5BPHA 4HATA 5JOQA 3HRKA 5JARA 2FPMA 4DQLA 1NOJA 1G21B 1RFGE 3N6XA 4MW9A 3Q0TA 3UW1A 4B40A 3ZV7A 1T10A 1NI3A 2ZUSA 3IT2A 4M0FA 5CFOA 3IMEA 2Q9AA 2AG6A 1M6WA 5IDXA 1RXVA 4FXPA 4MJ3A 5JS8A 2NSLA 3E05A 5FEMA 5C31A 4D3FA 1AF7A 4ZVKA 1OGIA 3GRKA 3O8RA 4XAQA 5JAMA 4BKMA 5FH9A 1E1LA 3R41A 1JQ5A 2PMBA 3Q88A 5TGZA 1OFUX 4ZU3A 4LGVA 4JX9A 1BMDA 1WF3A 1STOA 1Q0ZA 2NO0A 2PT9A 2ZBVA 3L06A 3ESRA 3WIOA 4KDCA 5FFFA 4D96A 1RKBA 1HT3A 3I1JA 2WHRA 1IWOA 1N8SA 4KXXA 2PL5A 4HNRA 4QU8A 4BZWA 4BKUA 3F3KA 4OLFA 4B8WA 5HKBA 1RAEA 3UQYS 3WWEA 3IDQA 1AHPA 1XJWA 5E4YA 1J0XO 1WSWA 3DHEA 3TJMA 3C45A 3NB0A 5HIAA 2J3DA 3KOXA 1GXSA 1MJHA 4NJEA 4V0RA 3WBKA 5LQJA 4CEJA 1G4AE 1H4QA 2IOHA 3HMQA 2OGWA 3BRSA 1VI2A 2YZ2A 1WDKA 4I2NA 4LK2A 2C0PA 5FB3A 2KSQA 1COWA 3MWJA 5JISA 3BD8A 2C2WA 3ZU3A 5ED0A 3RRXA 5KTPA 3QLTA 1KY4A 3CKKA 3GIDA 4EF4A 3PXAA 1REQA 4F6RB 4ZD6A 2XNKA 4WTOA 3SVZA 1E1CB 3A05A 2G9QA 3EMKA 3KSMA 4LRYA 2L0XA 4TLAA 5CFRA 2RBGA 1A9TA 3OE1A 3EC2A 4PSDA 5SY4A 3NKFA 1XU4A 3G6KA 2HMAA 2BHNA 2MYUA 1N2CE 3PQ5A 1K0FA 3TYXA 4BVGA 3K3PA 5HR5A 2JPDA 2ZZNA 3LQ2A 4N5NA 3ZZNA 1SIUA 4JP1A 4HAUA 3QX9A 3GB9A 1PNQA 1WXEA 1DAHA 1V5WA 2BGWA 3FLAA 4NOKA 2C1XA 1PVOA 4BFUA 1I0ZA 3B6ZA 4EDFA 1Z5OA 1BN7A 4X45A 3UK1A 2PD4A 2WHYA 5I8WA 2VPTA 4P86A 4NE7A 2BONA 3FUWA 4HV4A 4TN5A 4ZIRB 1IONA 1VE3A 4ML3A 2WKRA 3SHFA 1DL5A 2ZE6A 1UOPA 3I34X 2XMBA 3LHDA 2IOYA 3PCRB 3ZDXB 3SG0A 1N77A 2J0UB 1A9XB 2IYZA 3LLSA 4DPKA 2I22A 4MUMA 1WXDA 2GJ9A 1ISMA 3N2ZB 4DMGA 1AN0A 2PL9A 4EYKA 2ZXEA 1FUIA 4BMYA 3OT1A 4KK4A 1GNVA 3ONVA 1I6LA 1U3DA 3LK7A 2QDXA 3IAAA 4UUPA 1BXGA 4WXPA 5EIBD 3GVIA 3PG5A 3VQTA 4DCVA 1KQNA 4DIMA 1TKCA 1E9SA 4W1PA 3OX2A 1L7PA 4QSHA 2HJVA 3E8MA 1JU9A 3Q0EA 4J4BA 2XTMA 3HA7A 2GB4A 3GBPA 4X61A 1TRHA 1YZLA 3G59A 4PPFA 1O54A 1BMQA 3RT7A 1XPUA 4PFSA 3QWFA 3OMXA 1Z0AA 2XLBA 3F0TA 5HA5A 1DC8A 3TR6A 1XWFA 3VC1A 4DIOA 1G5QA 3P9CA 1TFUA 1YONA 3GQBB 2VBGA 3QE2A 4MB2A 3U1TA 1V39A 3ZDRA 5KYXB 4N7MA 3DVAB 1MT0A 4OU4A 2JJ2A 2WJZB 2HRZA 1XMIA 2XUQA 4DWVA 1R16A 5JROA 2OILA 3V8NA 1MO5A 2PMCA 3ZDDA 1Y3IA 2J9GA 4FD2A 3ANLA 4HUJA 4XRGA 2O2HA 5FOQA 4LFBB 3ZHSA 4AKHA 3LCVB 2OECA 1WUIS 2GETA 4TKVA 2W83A 1MAUA 4IGFA 5IP5A 1JDBC 5A6SA 3P9XA 3HS3A 4DR3B 2E3JA 3PQFA 3KD3A 2PLWA 4K2AA 3PGVA 3FCSB 5KINB 2HHHB 3ZY3A 1UBNA 1O1YA 5KHLB 2JAUA 2WPNA 1ELOA 1THZA 2PUHA 4FI3C 1TB4A 4KQ1A 4PZPA 3Q8KA 3CNNA 1OLXA 2XTAA 3TG8A 4JGIA 4YYEA 5IM4A 2BM9A 2G06A 2WNIA 4F0JA 2A35A 2JLUA 3OFSA 4RK6A 1FVHA 4G4GA 1JG7A 1JXMA 4QVKA 2PGXA 5BWLA 4BVAA 3FNRA 4NPHA 1OXTA 4TLEA 1HFWA 4AWXA 3RADC 2RK6A 4KH0A 3BGDA 2PH7A 2XMRA 4O4HB 4DJFC 1FOEB 2Y1EA 4P53A 2B4YA 4C22A 1WZCA 2GBPA 2ORED 5DM4A 2DB3A 1TI7A 4QO7A 1BFUA 2QL9A 1A8UA 3ZJUA 4XX0A 1MH1A 1WHTB 1D2HA 4YQEA 3NONA 1GZ5A 3ICCA 3VR6H 1XSEA 4K9PA 4AN1A 1F51E 1JIVA 2PTGA 4TZ6A 1ADGA 5C53B 1JZTA 4ZOLF 5G4KA 2C9BA 4UXIA 1EVLA 3HY3A 1CS0A 2WMOB 1I2CA 4BMSA 1ENZA 1V5FA 2XOXA 3HB9A 3JU3A 4BJHB 3ZPXA 3D8TA 4OMDA 4R1UA 3QENA 4D8XA 2W6QA 3L0ZA 2ZS7A 5LD2B 1NZJA 3CF6R 1CY6A 4NQRA 1MFZA 1ZOLA 3GMIA 2OFOA 4OD0A 1DXHA 1Y0BA 4BAUA 3U61B 2R68A 3PT9A 1NW7A 4BO3A 4E7OA 3ABQB 3C3CA 2UDPA 4B3XA 3KE8A 3EASA 1JQ3A 4I8DA 3DBLA 3KT8A 1V71A 5ECDA 2FFJA 5BQPA 4W5WA 1QHFA 2YWCA 3E4DA 4UAJA 5HUJA 3E23A 2BGJA 2P5SA 4CKZA 2O54A 2OBYA 4ZOLA 1T15A 3FNHA 4JLVA 6ABPA 1F48A 1QFZA 1ZIOA 4ZTBA 1YJ5A 4X95A 3K5HA 1IM2A 3W04A 3NM4A 1RIIA 3G1UA 3HDVA 4UNPA 3O4GA 3UJBA 1HLFA 3WBBA 4L4UA 3PWTA 3HLYA 1Z7BA 4KGXA 4CQLA 4JJGA 5J4VA 1S3GA 2GYUA 4PGMA 2RAPA 3UF0A 4BMXA 2WUWE 3DEFA 3LHKA 5F1OA 1G59A 4ZOLB 3WIBA 5LZ8A 4AJHA 2BTOA 4ENPA 4OHOA 3VVLA 3ZKWB 3ZS9A 3PKJA 4I5DA 5C0OE 3AWIA 4MI3A 2X14A 3KUDA 1PZHA 3GDGA 5JCOA 1ZOOA 4FNMA 4P83A 2BBTA 2ZWAA 5KCZA 1MDBA 1G18A 1OV6A 2G0AA 2VI5A 2XVYA 2YRFA 2YY5A 1J97A 3LLMA 4WZBB 5KTRA 3D4PA 3AUYA 1L5NA 2EATA 1AQIA 5EKSA 4D4JA 4EJMA 1UXIA 1W36D 1H93A 1IXYA 3TTTA 2O8BB 5FNZA 3UCEA 2H9YA 1TZCA 4FOSA 2AG0A 1K8XB 3BCUA 1LDMA 5IDWA 1TPZA 1NV8A 2Z95A 4U6QA 5A5VA 4HB2A 2Q27A 4NCHA 3EPRA 3LGAA 3KD2A 3FOFC 3JSXA 3O38A 1VZ3A 4MDFA 2WU1A 1Y4UA 3T7KA 3AR4A 3CB4A 3Q10A 2C00A 1XPJA 4J16A 4OQEA 1FP4B 3ZH9B 3WWZA 3RE1A 2ZE8A 3OF2A 5C8DA 2QW0X 5MFZA 2C7GA 2WTUA 1CTQA 2JIZD 4HYEA 5HGJA 5AVOA 1JSLA 2I0FA 1NR5A 3QU9A 3OQ1A 3T7EA 1XDGA 2RHOA 5KOYA 1ZNZA 1DCKA 1W36C 1TCUA 3W1WA 4EVSA 3GUCA 3M49A 3U6BA 3KXDA 4D0NA 3EEIA 1S9DA 4CLRA 2D5CA 3EDRA 1Q7GA 3IR7A 3HUFA 4TQ9A 4HKTA 3HB1A 1Z37A 3ITEA 4IEFB 1GVNB 2OB2A 4RD1A 3RROA 4MDEA 2IZ5A 4EHLA 1XEWX 3VTAA 4BUJA 1KAEA 1N7GA 4N7RA 2YJ3A 5G2OA 1T6YA 1NF2A 1ZIPA 3IVGA 1B0ZA 1IUPA 2VRBA 5BXYA 1UJNA 2GZDA 1WHSB 4PFJA 1ZXXA 5G41A 3AI3A 5EQTA 3V9PA 3VR4D 3KE9A 2D62A 4EFKA 2NUAB 4QIHA 3WGUA 2J9RA 2ZWPA 1XZCA 1PNRA 4MS4A 4RVCA 4K9QA 3P2EA 4H1VA 3AWDA 2D4HA 5HRAA 3IDAA 1MOQA 1OWMA 4YV1A 1FMCA 5CNKA 1U63A 4ARIA 3F6BX 3BTSA 3K1AA 3B3QA 5EKUA 2Z6UA 1SVLA 4Q9LA 3BWYA 4B6EA 1AY0A 2AWNA 3QGMA 3EZ7A 4E15A 3WIVA 1A69A 2I3BA 3QNUA 2VHZA 1FJHA 4FR0A 4RQBA 4Z3DA 5TSDA 3LKVA 2P4HX 3N3AC 4BNDB 1Y9DA 1UK9A 1TIPA 3M6UA 3CC8A 4MZDA 1OYVA 1WTCA 3UUEA 5DM0A 4WADA 4MRVA 3HJUA 1EK2A 2FCRA 3ZCUA 1JHZA 3AM4A 3KAQA 2N1MA 1NJGA 4PWYA 3LUKA 2NO1A 8ABPA 1FRVA 2OO3A 2X4IA 2QX9A 3ICEA 1H2FA 4PBRA 3R7WA 3ST7A 2YBDA 1ZGGA 4XGNA 1TUBA 2V45A 4DIUA 2R8PA 2QP4A 1NW5A 4DCPA 2GKOA 5FD8A 1CPYA 3L8HA 5B2FA 5HKKA 3IRVA 2C04A 2M6RA 3N8GA 4MYTA 3EISA 4GC5A 5CDYA 1HYEA 4ISBA 3M4NA 4W9RA 5ESWA 4A6EA 1FCJA 5JJCA 2W6MA 1IQRA 2CHUA 4FGUA 1QH0A 4R8VA 2RDMA 1AUXA 1AH2A 5I9TA 3I12A 3P9SA 2DEUA 4XJTA 4B2LA 4IZHA 2A4MA 3QLJA 3PUZA 1PNOA 4YPFA 3P0HA 3MWLA 4RVNA 3JQGB 4ALKA 4BWFB 2VYNA 5CBKA 3KQSA 3LO8A 2E5LB 1O9BA 4E2ZA 4R40A 1JI0A 4NHOA 4QHYA 1GTJ1 1VA4A 1KE1A 1QGUB 1FA9A 4MPJA 1FLNA 4JBHA 3IJRA 4LWOA 3D59A 4QU5A 2Z6AA 3MRXA 5DIFA 4CMIA 1M66A 1B8OA 1AKTA 1L5QA 3Q7PA 1AC5A 2VT3A 4Q12A 4ZXFA 1CUEA 3CZ5A 3B1YA 1QDEA 1M1YB 4FSDA 1MB9A 1NVDA 3S2SA 3V7NA 2EBFX 2H3EA 3F4BA 2NYUA 2ZDHA 5EJMA 1ECCA 5FBQB 1L4LA 2YWHA 2PAFA 2R6JA 4ZQFA 4EAQA 4MS1B 5IWAB 4AO8A 3IAS6 4P7KA 1HDOA 2OGSA 1ZSVA 4GPD1 3ZCSA 4CM3A 5AW0A 3BEOA 2Q28A 2XF8A 1KMIY 2Q5EA 4OAQA 4EY3A 3LP5A 3EY9A 2FK8A 3F96A 3FOBA 1SCQA 3G9XA 4UUOA 2OFFA 4QGFA 2E6KA 3TFQA 4BY9E 4GKBA 4Y2PA 1NI4B 2DQYA 3MXTA 1LVGA 1BE6A 1F2TA 1KYTA 1A5AB 5DBGA 2EC5A 5TS2A 3GCDA 5F73A 1IZYA 4J4HA 4QRIA 4W82A 4CEIA 2Z2JA 1XMOB 3O31A 5K8LA 1E9BA 3HU3A 1L7MA 2OP0A 2GEUA 4P81A 4PWZA 1L8XA 2DPLA 3CGWA 3S4YA 1W0KA 2R6ZA 4KR3A 1ZUNB 1PSZA 1VPWA 3FZEA 4FMBB 2QZ9A 3HJHA 4L5YA 1W5TA 3KK0A 3MFYA 1H23A 4CL3A 2GBFA 2PL1A 3N2GB 1PSDA 4A03A 5IHPA 3BWMA 3ABRB 5AMXA 1EYZA 1KPHA 2D1TA 3DZFA 1PKXA 3M70A 4TYPA 4CCYB 5KTSA 1YI1A 4JK3A 4ACBA 4GPTA 3WKBA 2FSSA 3GUVA 4P4NA 1MZVA 3ACBA 3SC2B 1RJWA 1QHYA 2O7RA 4FGWA 4PG4A 5E6SA 1Z6AA 2PZLA 3C3AA 3K8OE 2QD3A 1KO4A 1ACLA 5B3JA 2DH6A 2H1LA 2HU5A 4A0QA 4EQZA 2O14A 1HMPA 4KG7A 1CHNA 3H9UA 4KXNA 3QIVA 3AKZA 4P0TA 1T5IA 3HHEA 4OH1A 4MWOA 2WIFA 2MYTA 1C7QA 2N1BA 1I30A 3KPUA 4XUDA 3C6BA 4KOEC 3ZI4A 5HKOA 1M8JA 4FMDB 4UVIA 2QYTA 4WI1A 2C4NA 3ZLTA 4WJZA 1E7SA 1UP7A 2Y93A 1EAYA 1W5SA 4OJTA 2ZBQA 4LE1A 1SKYB 2WSSA 3QWBA 4QGBA 1VMAA 3BDVA 2GCOB 3ZEAA 3EGIA 3KP1A 3RC1A 4BE7B 3G5MA 4R1TA 3ZD9A 4D4LA 3ONDA 4UHHA 1UMCA 4OJQA 4F3YA 2BH9A 3OTWA 5LIPA 4CTMA 2NO4A 4R5HA 3PYLA 2IA5A 4TLMB 4RJTA 4A1FA 5FP0A 3WGJA 3R9XB 1C50A 1G8PA 1XRMA 2DCMA 2GEBA 3BIOA 3AT1A 3VPGA 3RC7A 2Q3DA 1RC8A 3A10A 1JUDA 1CUBA 3HL4A 4YH1A 4D0SA 4LCBA 5GJBA 2VP9A 2OY0A 1SULA 4GM4A 4I1YA 1DQYA 3ZCVA 2Z09A 4BNTA 1U28A 1NVTA 2I3DA 4G0WA 1EJBA 2TMYA 2P2YA 2VP0A 2DHRA 3AO0B 2BKVA 1AKQA 1UPTA 2V7VA 4EJSB 4WVLA 2DBVO 1RQ7A 2OG2A 2CB9A 2ISSD 4UREA 1ADJA 2PKWA 1QV6A 2IXFA 3ILVA 3RJZA 4DCSA 3EUWA 2F3RA 4Y1GA 2BGRA 3VGPA 4ENTA 1QGZA 2F43B 3WP1B 3GJQA 2DHCA 2GWRA 1PF7E 1PLKA 1BH6A 1WJGA 1D7OA 1ICEA 2W8BB 3GCZA 1N5OX 2BWJA 2RHCA 2GDZA 2Z58A 4GRIA 5E0KB 4N48A 5LL6P 1NUPA 3L04A 1OBVA 1VBMA 2WKWA 3M6FA 3E9DA 4QOHA 1XMJA 1IZ9A 3EGVA 1REQB 4QOIA 9LDTA 5K09A 1R8QA 1BXRB 1DG3A 1G20A 2JRCA 2R8EA 3CRNA 4RY9A 2BBSA 3S99A 1IM8A 4K88A 5SICE 1W9MA 3S81A 1UIMA 3ETNA 3DE3X 5D3ZA 1Z6XA 5DF1A 5J63A 4P5DA 2NU8B 1M1XB 3ICQB 2WZCA 2Q5JA 1Q0TA 2IW3A 2J30A 2G80A 4FDVA 3NIGB 5LN1A 1HBJA 1Z68A 4D6PA 1IDOA 4FJ2A 4MGEA 4P38A 3VNQA 3W5HA 3WJ7A 4DGQA 5KU7A 2H0AA 4XD7D 2G7MC 3RUIA 3U4MA 1EGHA 4CCYA 1CUIA 1TPYA 1Y5MA 1SUIA 2IEIA 1AUPA 1E1MA 4YO7A 1LV8A 3QFSA 1YIAA 1GRNA 1DT5A 1TQHA 1XZQA 2GS9A 2OK8A 1IOLA 3N6RA 3R8XA 3WYAA 2BFMA 3EIHA 3SCZA 4L7VA 4NABA 4U2KA 3UJ9A 1UADA 4MQFA 5KOIA 1N4AA 5F2EA 2Z56A 5CHEA 4KPGA 3ELUA 1TVMA 1X87A 2QRLA 3OZEA 4LX8A 1L8LA 4AY6A 4YQFA 4MV6A 4TTQA 1N92A 1M76A 2PMKA 3DE0X 3M34A 3O2NA 4AYXA 2YZGA 4DBVO 2ZRAA 3PTAA 3KLBA 3HWX1 1BEEA 3BMNA 3RODA 5CA0A 3TZBA 4CRWB 1UJBA 4BQIA 3KALA 1SBIA 2B6NA 3FWZA 1DAPA 2O2DA 2DVMA 1GG8A 3DKVA 4D3DA 5AQEA 2I4MA 1JPUA 4O3FA 4ZAFA 1HY3A 3Q7IA 4BBPA 1E8NA 9ABPA 1SO8A 3I30X 3NH9A 5T8KA 4R8KA 3T1VA 2HK7A 5EXXA 2JFQA 2EARA 3KDAA 4EUFA 1S3SA 3NBUA 4RHYA 1C0KA 4C43A 2NU7B 2EERA 1J5PA 2IW1A 1BDMA 4EUSA 2VTEA 3F73A 2BMJA 1VI5A 1IDN1 4S24A 4CMIB 3VPBA 4IVQA 2GYYA 2IDJA 2AMFA 2QM3A 4FZ5A 4DAEA 2JLYA 3MWEB 2FRVA 2BELA 3MLAA 4OMCA 1DP4A 1U9IC 4RH3A 1MC1A 3DDUA 2I9PA 1PX0A 1NYTA 3C7KA 4ZYYA 2GPJA 3GCXA 2SICE 5KAPA 2NU7A 3MOSA 2B0CA 2W2LA 5FPHA 1E62A 1L1FA 1AKUA 1P0IA 1Z7YA 2NLOA 2W6IA 3LLVA 1UFOA 4J91A 1P0MA 5CURA 3MQ4A 4OATA 4OI2A 3KZXA 5DIZA 1XTSA 2VQFB 1KJYA 1PR9A 1A98A 3PGJA 1E5LA 2WV7A 3VPCA 3OA2A 1UEXC 4P4SB 1O5IA 3M89A 3OG9A 3O5AA 3NHAA 1ZK0A 3G2NA 3L18A 4E1BA 4E5KA 2X7HA 4R9UC 3U40A 4FOPA 4ARSA 2KM1A 1MEEA 2P5YA 1BW9B 2W0MA 3QW2A 1MO3A 5JSZB 1E63A 4V0SA 5AI0A 1GVHA 1Z33A 5KOHA 1UXHA 4C05A 3GLSA 4A8TA 4X00A 3BH7A 4Q05A 1N36B 4TGLA 3GOQA 2K2WA 4LCEA 3GWGA 1QPZA 1FP4A 2YWRA 2CBXA 2DTEA 4RIGA 3HB4X 3ZHYA 1ZQ9A 3M1AA 1Y6FA 4PNEA 1PK9A 3PGLA 3QPAA 1UQRA 4FCWA 3UC5A 5MF6A 3RAFC 1Q0SA 5AJXA 1H1TA 5GZ3A 3F90A 3RIYA 2VUHB 5DTJA 1QQBA 3QVOA 2LVBA 3H8WA 4G86A 4N5LA 1RQLA 5KYUA 2VQEB 5DHPA 4ZOEA 2Q4EA 1F60A 4JXKA 3F9RA 3H2ZA 5DLEA 4DDKA 1QB7A 3ELYA 4RMIA 1H2HA 1DUSA 1TKBA 3AP2A 5IMBA 3BEDA 3C8MA 3NRJA 3VU0A 1Z56C 3KO8A 3QKWA 5FFNA 4BFCA 3N8IA 5BV0A 4FBLA 1AMNA 4GD3Q 1DSSG 2JIQA 4BCCA 4IJSA 1IY8A 1NXSA 4EK9A 4UW9A 3KQOA 4XVUA 3GRYA 4NFYA 1Y7TA 4WXMA 3KHSA 3KAJA 4Z5XA 5K3CA 2V97A 1FP1D 4FUTA 5EMNA 1P31A 1J25A 3RVQA 3NHYA 2GAJA 3FTCA 2H4JA 2JBAB 1DIGA 1U80A 2VHWA 3N58A 3P9NA 3N7TA 2P27A 4US2R 3INNA 3PR1A 1VDZA 3SEAA 1U8CB 1I3MA 4LF5B 1NQXA 2RCNA 3U4AA 4PC2A 2D00A 2F1HA 3IJPA 3IPCA 1IU9A 2G8NA 1CB7A 3GFTA 4M49A 3GX1A 5DT9A 5IJAA 4Q82A 4Z49A 4GX2A 5GOTA 5J4YA 1WMSA 4DA4A 2C9ZA 4J1SA 2Z4TA 3T9CA 1TLLA 4XPIB 1QP0A 3LHSA 2YVLA 5F76A 3QBTA 4LWPA 2IITA 2QZ4A 1MRSA 3EGCA 2G25A 3K0AB 3GNLA 3LUAA 1TAGA 2YV3A 2A0YA 3PFNA 5K51A 4RA9A 4RTJA 4G9EA 2F1RA 3EHEA 3B7GA 4OXKA 4A7PA 1C3OA 3KDPA 3PNYA 3P7MA 721PA 2AJ8A 2YNMA 4Z1MA 3KOYA 5BNZA 3QMPA 6ADHA 1AQLA 4E5SA 2PJRA 1Z63A 4PFQA 5D3KA 1QYVA 2XCUA 2I2AA 2YC2C 5EUCA 1FSGA 1I14A 4KVFA 1T8SA 4EYGA 3JASA 3OWXA 3SQLA 1T9AA 4GVXA 4C06A 5KOJA 1V5GA 5IG2A 1DC7A 1ZJJA 5JD6A 2V1UA 1FXSA 4I14A 1DEOA 5KNDD 3FYUA 5EP3A 4J76A 1VXRA 2R1TA 3G8DA 3VKFA 2O8DB 3HB5X 2PCJA 4PS1A 3DP7A 1DHRA 1E9FA 2NT4A 1NFRA 1URPA 2F7SA 2Y1GA 5E2IA 3USES 2R6R1 3S8EA 4JOBA 3U4QA 2XUJA 4UNSA 2JIRA 3MS4A 5ALHA 3WB1A 3ZE8A 3WOHA 1R4NA 2AN9A 3D1JA 3AM3A 1QU2A 1Y8QA 1SOVA 1XCLA 1VMEA 1W35A 1WXWA 1QZUA 3RARA 2O2EA 2ZRGA 4G8JA 4CUJA 2A9RA 3SC4A 2OG1A 3W5CA 2NWQA 4PEVA 4EY8A 4G8BA 2QZSA 4RAQA 4XR9A 1VP9A 4GEKA 2CF6A 3A11A 2CMGA 2IYTA 1AA6A 4FWIB 4K6OA 1EDDA 2HU2A 2OQRA 3LOPA 4J49A 5E3HA 3U0VA 4F56A 3CG4A 2XRYA 3WMWA 2WDPA 3JAWA 5A6SB 3E15A 2YIMA 3HCWA 4XVRA 4CPDA 2IL1A 4R8MA 2ZM5A 3UEOA 4LC1A 3HN7A 2WF6A 5H5JA 1WNFA 3D6VA 1JLLB 1LBQA 1P9LA 2PUVA 3FPJA 5JMPA 4V0QA 2REXB 2WRZA 1SEVA 4MLDA 2XYGA 4EELA 2XTNA 1PQ4A 1XDSA 4BMOB 1JV2B 5ECGC 3AUSA 3MF4A 4LBZA 5HFAA 4J0CA 3GU3A 1HOTA 3B9PA 4RVFA 1J33A 1VDMA 1LEHA 3FNGA 4YRKA 4I1PA 1IM5A 5ALKA 5TX7A 2CZGA 4Q4CA 2J6BA 1QTRA 1XKLA 3KLNA 1LNSA 3DFKA 4XYEA 1M0TA 3ANMA 1IBSA 3I23A 3FCCA 1GUDA 2ZBFA 1PFVA 1Z4LA 3BF7A 3JYHA 4P3NA 2P4EA 2B5WA 2AS0A 4UNNA 4DNXA 3LPNA 3GA5A 3N0WA 5IUJC 1ZM7A 4ZCMA 3ORYA 4TWRA 3RFTA 4NBNA 3BXEA 1QHGA 2ASVA 4H9GA 2NUPA 3LQKA 1AQ6A 1QR2A 5AVJA 1U1DA 1QCCA 4MV8A 5LZ2A 4RBNA 1YCHA 1C81A 1V43A 1N2CB 1WBBA 4R0NA 2VHJA 4AMZA 4DG8A 3C70A 2GF9A 4DOMA 4U00A 3L7CA 3MJHA 1GP2A 1HDEA 2QMEA 1L7OA 3EXEA 1DIOB 4KGDA 5CGQB 5AKZA 3BXHA 4QQFA 4ZGBA 2P9FA 5I5GA 5FA8A 1D09A 5FOWA 5AKJA 4R0MA 1FYDA 3GNTA 2OCAA 2O3UA 3P2OA 1NP6A 1A8SA 2VJQA 3PHLA 4KBYA 4Q9DA 1UAYA