1KEVA

Structure of nadp-dependent alcohol dehydrogenase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
351
structure length
351
Chain Sequence
MKGFAMLGINKLGWIEKERPVAGSYDAIVRPLAVSPCTSDIHTVFEGALGDRKNMILGHEAVGEVVEVGSEVKDFKPGDRVIVPCTTPDWRSLEVQAGFQQHSNGMLAGWKFSNFKDGVFGEYFHVNDADMNLAILPKDMPLENAVMITDMMTTGFHGAELADIQMGSSVVVIGIGAVGLMGIAGAKLRGAGRIIGVGSRPICVEAAKFYGATDILNYKNGHIVDQVMKLTNGKGVDRVIMAGGGSETLSQAVSMVKPGGIISNINYHGSGDALLIPRVEWGCGMAHKTIKGGLCPGGRLRAEMLRDMVVYNRVDLSKLVTHVYHGFDHIEEALLLMKDKPKDLIKAVVIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystalline alcohol dehydrogenases from the mesophilic bacterium Clostridium beijerinckii and the thermophilic bacterium Thermoanaerobium brockii: preparation, characterization and molecular symmetry.
pubmed doi rcsb
source organism Clostridium beijerinckii
molecule tags Oxidoreductase
molecule keywords NADP-DEPENDENT ALCOHOL DEHYDROGENASE
total genus 110
structure length 351
sequence length 351
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 1996-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1kevA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1kevA01
1Q0LA 5KWEA 4BKUA 1CF2O 1TEHA 1FK8A 2GZ1A 4N54A 5EN4A 1E1LA 4EBFA 1Q0HA 3OMLA 4GGOA 4YTEA 5KVQA 4OKNA 3ZWAA 3TZ6A 3UHAA 1GY8A 2HAEA 2HRZA 2I65A 3DOOA 4TVOA 5ER6A 4BO5A 3AY3A 3C8MA 4BNFA 1HDCA 1U5CA 2GN6A 4FIZA 5G2OA 3LLSA 4E13A 1I5RA 2ZCUA 3FSRA 4H16A 2PKQO 4JCOA 3RQSA 4CMCA 4G2NA 4IMPA 1QR6A 3ITKA 2VUTA 2NWQA 1U8FO 4ALJA 3L6EA 4GX0A 1LLUA 1XWFA 3I83A 4XA8A 3F5SA 1I01A 3WBBA 3RKRA 1R12A 3L6DA 3OP4A 1DJQA 2NU7A 2VUUA 3ST7A 4LVUA 2PZLA 3RI3A 3UCEA 3QE3A 2J6IA 1Y8QB 3O4RA 3KOUA 1GZ3A 4MVJH 4GI2A 5A02A 4MIYA 2BHLA 3AY7A 1ZEJA 5EQDA 2AG5A 2SCUA 1LTHR 4L4XA 5BSEA 4QUKA 4U8GA 2Y0CA 3DR3A 2OBNA 2G17A 4Y6RA 2FY8A 2ZYDA 4YCAA 4OOEA 4BIIA 4OHUA 2PFGA 5KJ1A 5DZSA 2C82A 1EVJA 4IQGA 5JDIA 2Q1TA 4YT5A 1MLDA 3PZRA 1Z75A 4LCEA 5B1YA 2B4QA 3PDUA 2X9NA 5L7TA 1DIAA 3SEFA 4XGIA 1LQTA 3BMQB 4DVJA 4CLRA 1RKXA 3CIFA 3L4SO 3EW7A 1L7EA 4IDEA 2BELA 4BMNA 5CEFA 1YQDA 4A7PA 5EL0A 4CM5A 4R01A 3PYXA 4WE3A 3GVIA 4D42A 4FGWA 3W6UA 2Q1UA 4Z3KA 5TGDA 2DTEA 1A4IA 5FI5A 1AHHA 3LF1A 4F6LA 1Y8RB 3RJ5A 5F5NA 4C7JA 3BTUA 2W2LA 1OI7A 3VKUA 3DTTA 5ITWA 1U3WA 3RBVA 1GUFA 3RFXA 1PJQA 3D3WB 3F5QA 4NZ9A 4RPLA 4Q3EA 2VOJA 4L75A 3IJRA 4YQYA 1TA4A 4D0SA 4NI5A 4WLOA 4YWJA 5AYVA 5KVVA 3IL2A 3VZRA 4YVFA 1Q0QA 1T2CA 3GVXA 1S6YA 4CL3A 1WZIA 3GZNB 5HM8A 5KTKA 4R54A 4I5GA 2FSVA 3HG7A 4BMSA 2NQTA 1Q7CA 2EJWA 4OMUA 4D45A 2AQIA 2B35A 1ORRA 4KUGA 3RFVA 1Y5MA 4GH5A 5ES3A 5CDUA 1GPDG 4EW6A 3DOCA 1E1KA 2FN7A 4B79A 1ZSNA 4D46A 5HS6A 4MVJD 3UN1A 1H94A 1R16A 5ER9A 2IE0A 1WVGA 4O5OA 4Y67A 4MPDA 1ADBA 4XDZA 3TQHA 1O89A 4OQYA 2YQ5A 5L4SA 2E6UX 3ZN2A 5I7FA 4G81A 5G4KB 4AJHA 2ZATA 3WYCA 4ZU3A 3EY4A 4QX6A 2DC1A 4U0JA 1BMDA 4AJ4A 4Q39A 2PLAA 1E5LA 3OF2A 4D79A 4J4BA 4M54A 1M75A 2NU8A 3STHA 4DWVA 3DHYA 4I8XA 3P7MA 2GRAA 4KMSA 4RLHA 5CDSA 4N5LA 5G0TA 3H5AA 4ZRMA 3KUXA 5ICSA 4D43A 1PGOA 3EDMA 2P9CA 2W2KA 1WDMA 2YJZA 3ON5A 4FCCA 1I32A 3DMTC 5HTOA 1HKUA 3R3SA 5ADHA 2CF6A 2UAGA 4M49A 1UAGA 1D7OA 3X2EA 5J23A 1UR5A 2DBVO 3L4BC 3OJLA 5GY7A 1GCUA 3GT0A 2WJPA 2BGLA 2BKAA 3UUWA 2NVWA 4Q3AA 3FI9A 3RC1A 1EK5A 3WR5A 5KJ6A 2Z1NA 4B3IA 4YBZA 2HUNA 4KUEA 5JE8A 1DJNA 5T6BA 3KZVA 4XB2A 1X0XA 5HRUA 1A7AA 1EVYA 3QVTA 1WDKA 2OL4A 2A9FA 2WWRA 3GPIA 1ADCA 5BQFA 2EIHA 5JMWA 5U9CA 1T4DA 2PZJA 3GLQA 4DPLA 3CTMA 3TL3A 2VN8A 1GZ6A 4E2XA 3C3XA 3WQSB 1UP6A 2QW8A 1B16A 5I9NA 4EEZA 1VRWA 2JCYA 2PWZA 3DHNA 3WWYA 3CZMA 3A9WA 1VJ1A 4NHEA 5KKCA 1ZK3A 2BGMA 4GKBA 4TKMA 3AOGA 1ISMA 1XYGA 4K1LA 1I30A 4CM6A 4RDIA 1DLIA 1Y8RA 3HSKA 2HK7A 1P9LA 2I99A 3UVEA 1IPEA 5HA5A 3ICPA 2PD3A 1KVTA 4DC1A 1UZNA 2BLLA 3NRCA 4BNLA 4A73A 4MVJP 3U62A 3DC2A 3WMWA 4G5HA 3IC5A 1A9YA 4J1NA 4UULA 3V2HA 2HMUA 1V8BA 3JQFA 3KSUA 1L1FA 1W6UA 4DQUA 3DL2A 3RC9A 2WEKA 3WB9A 3GGPA 1TVEA 3HDJA 4JXKA 1CDOA 1X15A 1U2DA 2Y93A 2ZIZA 5KCZA 4GPD1 3M1LA 4OM8A 1JN0A 3C1OA 3ITDA 1WPQA 1T24A 4CUKA 1HZZA 3UH1A 1OOEA 1VLLA 3D4NA 1E6UA 4FC7A 2EKLA 4MVJA 3R3JA 2HMSA 4ID9A 5K0ZA 3DTYA 3RUDA 2IEDA 2VNSA 2TMGA 5THKA 1U4OA 1I36A 1R6DA 1W8DA 3TF5A 3PPIA 1I10A 2NNLD 5L51A 3FTNA 1T1RA 4JBHA 1SEVA 3E82A 5I9LA 3VPSA 3C24A 5LDGA 3WBFA 4TKLA 1BRMA 1KEUA 1Z45A 3G49A 4JGBA 1RJWA 3KV3O 4NU6A 2GYYA 1NWCA 3MZ0A 4FOSA 3ETEA 4UEJA 4UUMA 3H2SA 4Z0HO 1DC4A 3BMCB 5DP1A 5EINA 4F6CA 1IHYA 1GEEA 2O2SA 2XF8A 3GN1A 2QRLA 4BGUA 2VTEA 5ILOA 3G79A 3D4PA 1YONA 5B37A 1QYDA 1DDOA 4PZDA 3V1TC 4L4SA 2Y66A 3H9QA 4P8RA 4FJ2A 4LVCA 2PR2A 2EW2A 4BQRA 4CV2A 2Q1SA 3VTFA 2X9GA 4GQAA 4GWKA 5DP2A 2YHUA 1YDWA 3WSWA 1V6AA 3M2TA 4EEXA 3DDNA 3TZKA 1DB3A 3MJSA 2A35A 4ALKA 3VDRA 1GR0A 1GPJA 3BTSA 1PL6A 1MG5A 1LRJA 2G1UA 1AE1A 2B0JA 3RAJA 1PWZA 1QV6A 4ZQEA 3BTVA 5HWSA 2IEBA 1UUFA 3BMCA 3PJGA 1QLHA 1KERA 5TF4A 3L9XA 4CR8A 3I9NA 1SC6A 3ULKA 3GDFA 4RPGA 2UV8A 2GDZA 4BHTA 1P31A 4W7IA 1X1TA 1M6WA 4PGFA 3P2YA 4KDEA 3I9JA 1HYHA 1E1NA 4J7UA 2I6TA 3PJEA 3S55A 5C37A 4TROA 5JAQA 5L7WA 3VPFA 1PJBA 1VM6A 4YEDA 2JFFA 4GL4A 3RVDA 4PLVA 3QP9A 3O9ZA 1C1DA 4XDYA 1U8XX 3QW2A 1JU9A 2ZKLA 2NVBA 4GVXA 3QVWA 3ICCA 1UXHA 4LW8A 3U3XA 4NFYA 5JDIC 4WCFB 4Y8VA 2BI8A 2GPTA 4CMAA 1LDNA 3UOGA 1T25A 2X22A 4FFPA 4HUJA 1BWSA 2QQ5A 1XHLA 3W8DA 4H3VA 1TT7A 1EE9A 4A03A 2GR9A 3JYNA 2WD8A 4J43A 3ZNOA 3LT2A 2CSUA 3NDJA 1XLTA 5IZCC 1HXHA 4IIVA 2X7HA 1T4BA 1EEHA 3WGZA 4CMBA 3VPGA 3ZWYA 3GAZA 1H6CA 4FJ0A 3MEQA 2JKVA 5JFOA 1E6WA 4EJMA 1N7GA 4PLHA 4PZEA 3ETDA 3BHJA 1P77A 2DU8A 1I2ZA 4RPHA 3OJOA 4TSKA 3H9JA 6ADHA 1E5QA 3MWDB 4RVGA 3VC7A 2FWMX 4NK5A 3U4HA 1PJSA 3GZNA 1PZEA 4II3A 4GX1A 3DZBA 4I9HA 3UF0A 3ROPA 4Q9NA 3JQBC 4KTTE 3SXPA 1HL3A 1LDMA 4BO3A 1JKJA 1XELA 3VH4A 3W1VA 2IDZA 3MJ4A 3LDHA 3B1KA 5B4TA 3E8XA 5LC1A 4OIMA 4ALIA 3DFUA 3DZGA 3QJ5A 4BNZA 1PJTA 4ZD6A 2YFQA 3WFIA 1FDTA 3JQAA 4AJNA 2JHGA 4KUHA 1CRWG 4DQVA 2YZ7A 4AVYA 1VI2A 4P4NA 4W9NC 5CPBA 4OO3A 4K9DA 5HS4A 3INRA 4RV9A 3KEQA 4PG7A 3U49A 4QO7A 1ONNA 2IYOA 1NBOA 2G76A 3I5MA 3GR6A 1WZEA 3JD0A 1LBEA 2DBRA 4RZIA 2IYPA 3BMQA 5TJ9A 4E32A 1OC2A 2X0RA 5A5FA 4XX0A 1W0CA 2AA3A 4MKZA 4J91A 4UUPA 4BGIA 4D41A 4OOFA 2WDZA 5TNXA 1B3RA 1EQ2A 1EBFA 1PU2A 5CP8A 2B37A 1YO6A 5JDCC 3E5RA 1B14A 3GEMA 3LC2O 3OJFA 4AJLA 2X5OA 2NVUB 4DPKA 3B1FA 4GX5A 3GGGA 3E9QA 4MINA 2VUSA 3VZPA 3W4JA 3RIHA 3MCVA 4QFCA 2JD2A 3MOIA 4BNVA 4BNMA 3O38A 3D3WA 3C7AA 2AHRA 4F3YA 2R6JA 1Z82A 4G65A 1HF3A 1ISJA 2QHXA 1AHIA 4JN6B 4MVJM 4P4GA 3WQQA 3FNEA 3FR7A 1XA0A 3F1LA 4QSMA 4E31A 1CIVA 3P19A 4XR4A 3QWBA 2VYVA 3OJEA 3MOGA 4RO0A 3TJRA 3WGOA 5TS3A 3RROA 3L4BA 2J5QA 1YQGA 4PVCA 1T2EA 5EPOA 1HE3A 1JWBB 4TRMA 3JQAD 5T8KA 2X6TA 2UDPA 3PYMA 3AFNA 4A5OA 2D4AA 1J4AA 2G5CA 3DO5A 2A94A 3HWRA 2ZB4A 3PHIA 4KWHA 4MP8A 1G0NA 2QX7A 4CV0A 2AQHA 3JD4A 2JCXA 3JCZA 4FR5A 3DZKA 2EEZA 1CWUA 1UDAA 2RHCA 4ZQGA 3WGIA 1NAIA 5C7LO 3N74A 3AW9A 3U0BA 1BDMA 1C0PA 4DBVO 4ALLA 3AUSA 1HT0A 1A72A 1I3LA 2XXBA 4R5MA 3K8ZA 3TPCA 3ZH2A 3PIIA 5TT0A 1DXYA 3BHIA 3FN4A 3ROKA 3GFBA 4UVDA 2EGHA 3PWKA 1A7KA 2JHFA 3AU8A 3LK7A 3DBVO 4XKJA 5JPIA 3F47A 1YVEI 1DLJA 3GG9A 4NBRA 4CLDA 4EDFA 2R00C 4IDGA 1YB4A 4YJGB 2E37A 4HP8A 1YL5A 4J2OA 4Z6KA 4PG8A 3FF4A 2YHIB 3NJ4A 2DAPA 3LYLA 2HK8A 1B3BA 2D59A 1YL7A 4IS3A 4M1QA 3RD5A 1E7RA 4AICA 1ISFA 1PS8A 3CMMA 3V1YA 4EUFA 1ONOA 1OMOA 4HY3A 1G6KA 1LLDA 5JYEA 4UVHA 2VCYA 1U28A 1GCOA 5KJEA 3ZWVA 5FEUA 2PV7A 3DXFA 3N7UA 1HYEA 3C7DB 5F5LA 3GN2A 5TQVA 3TWOA 5JC1A 3KSZO 4YJHB 1KVSA 5FI3A 3KVOA 1O8CA 3NJ8A 3C1TA 3NGLA 2Y0DA 3AWDA 3OEYA 1I3MA 4II2A 2YDYA 4AJ2A 1KVRA 2VRCA 1VC2A 3HUDA 2HKIA 2A4KA 5BSHA 3GEDA 3RUAA 5TSDA 1DBVO 3OSUA 1NPTO 4ZQHA 5GZ6A 1R37A 2NTNA 3WG9A 4PLGA 3PHJA 4IZIA 2X4GA 4BO8A 4FOOA 2EP7A 3IP1A 4KWIA 1JKFA 4AFNA 9LDTA 1W73A 4YRBA 4EI2A 1XU9A 3D5QA 4I5FA 2G0TA 3ONFA 1DRUA 1IYZA 2VHZA 4CLHA 1F8FA 2O50A 4PLCA 3GH3A 3DZFA 4WLFA 3KETA 4FFMA 1HRDA 1QP8A 1ZMTA 3AI3A 3EZLA 4WNIA 1RM3A 2GSDA 2PGJA 4R41A 4WUVA 1SEPA 3VH3A 1IPFA 5A9RA 4FDAA 2D0IA 2Z1MA 3GNQA 1TI7A 4AJOA 5GMOA 1ZXLA 2FHSA 2ZB7A 4BUCA 2C2XA 2XPCA 3L9WA 3EGOA 3K2BA 2JFHA 1SNYA 2EGGA 2AQKA 3JSAA 3KYDB 2E48A 4J1QA 1IY8A 3DZHA 3LU1A 2PKQP 3U4CA 4E2YA 3QQPA 2EF1A 1LI4A 3GVHA 2O7QA 1IL0A 5JC8A 2X1HA 4BNNA 1ZKMA 1UH5A 2C2YA 1F8GA 1HETA 3ZNNA 1UZMA 3EC7A 4Y6PA 3K73O 1O94A 3Q1LA 4DIBA 4CODB 4I08A 2GGSA 4XYGA 1YE3A 2VWGA 3RU9A 3HJAA 4DGSA 3DEYX 5L7YA 1ZEMA 3WGGA 1V35A 1BHSA 1Z73A 3NDIA 4BO7A 1YB1A 1XGKA 3HFGA 4QQRA 1BXZA 2GD1O 3DAPA 2HU2A 1GL3A 4R1TA 2H5LA 5F1PA 1LC3A 4F45A 5IDWA 1I0ZA 4BNGA 1P1FA 3ZWXA 3JQ6A 4U6SA 5F1KA 5A9SB 3AFMA 3CEAA 1N7HA 1E0DA 3U4IA 3FWZA 1AGNA 1ZJZA 3H9EO 4GSKA 3VVBA 2QZ9A 1NP3A 1SMKA 3AJRA 4IDBA 4R5HA 2E4AA 5IF3A 3HADA 2GASA 1HSZA 5G4KA 2ZB3A 4WLVA 1GADO 1X7GA 1LX6A 3PJDA 2ZTUA 1QV7A 4XGKA 3JQGB 2PA3A 3ZWMA 3AI1A 4Q3DA 1DFHA 4YJHA 1ZXBA 4XRGA 3K5PA 3D5TA 1K5HA 1B0AA 1GDHA 1L7DA 1NNUA 4UUOA 4BO4A 1FF9A 4NFSA 5DOZA 2GNAA 3EUWA 1XKQA 3WTCA 4XB1A 2WYWA 5IDQA 1HE2A 3QVOA 4YXFA 3FR8A 3JQBA 3INGA 5JY6A 5A9SA 5DULA 2V6GA 4E4YA 4CQLB 3W4IA 2GN4A 3PDJA 3PQDA 4XQGA 1YBVA 3SLGA 7ADHA 5I7VA 1AUPA 1YDEA 3H65A 2F1KA 5L4LA 3GA0A 1R4NB 4FGSA 3UFXA 4M86A 3GEGA 5H83A 1EUZA 2CF5A 4K6CA 1ZK0A 4PLZA 2Q49A 1UXKA 1HTBA 2EW8A 2FRDA 3NTQA 1KEVA 2YY7A 1S7CA 1HLPA 3IJPA 4I9NA 4LISA 1R4NA 2D5AA 5IDYA 3SLKA 4HBGA 2OHXA 1D1TA 4CM8B 1YBMA 1K89A 3PGXA 2YFHA 1DIRA 2AE2A 2Y0EA 4OGWA 1ISHA 1YKFA 2FZWA 5GZ1A 5T5QA 3AUTA 4W4TA 4QECA 1DC3A 4J2HA 2Y1DA 3UXYA 1JTVA 3PEFA 4D7AA 4FQ8A 3PP8A 4ZGWA 3H3JA 1SCUA 1R15A 4UVEA 4QTZA 1ZNQO 4Q3CA 1BW9A 5THQA 1BVRA 2TMDA 4HFRA 1HDRA 5ENVA 3KB6A 3X2FA 4ZJUA 5JS6A 4IQ0A 5DT9A 5LCXA 3AM4A 4Y6SA 2I3GA 3IDSA 3T4EA 2Y67A 2PZMA 3OQ6A 4BO9A 1YOVA 5CPFA 1CETA 4H7PA 1ZW1A 2VRBA 3BAZA 1U3UA 3PVZA 4HFMA 4NNJA 2VT3A 4D3SA 1E3SA 1KY5A 4W82A 2OOSA 1ZUD1 4R51A 4BKRA 2VYNA 3WYBA 2PGDA 3VZQA 1KVUA 4JJFA 2IODA 2AEMA 1NAHA 4N7RA 5A04A 4NQZA 2PKRA 3LC7O 3QWAA 2HK9A 2ZCVA 5COBA 4RVUA 1YXMA 3LC1O 3IIEA 1PGNA 4JQCA 2ZYGA 2I76A 1LDYA 4RF2A 3IS3A 2VT2A 2YV1A 1TXGA 3VAZA 4YPOA 2YV3A 2UUPA 1GQ2A 2FPGA 4TWRA 1UAYA 1ISIA 1P44A 5FWNA 1H5QA 4GVLA 4FSHA 1K2WA 1UXIA 1P0FA 3JQ7B 3AUAA 3ORFA 1Y7TA 3L77A 8ADHA 2ZJ1A 4RVDA 1DO8A 1B26A 4HFJA 3ZWCA 3UCFA 4CLOB 1ULSA 3F9IA 4PCVA 3S2GA 2NU9A 4MIOA 2W2KB 2QRKA 1QYWA 2OUIA 1VJTA 2X58A 1PZHA 4MKRA 3WXBA 1B7GO 3RWBA 5ICMA 1LXCA 1LDGA 4D44A 3HHPA 3H7AA 4BB6A 2VOEA 5BNIA 4TRRA 4XYEA 4PLYA 2I3AA 5K6AC 3GZ4A 2CUKA 5F3RA 5JCXA 1DAPA 3NYWA 4A0SA 3JD1A 3CUKA 3W6ZA 3W4KA 2FPPA 3DWFA 4CM4A 3S2IA 4YRDA 2GUGA 4AJPA 1PX0A 4GWGA 5IXSA 2AE1A 1HYGA 3I9LA 1H9AA 2GERA 4I5DA 5HBRA 4PVDA 4R68A 1UP7A 1ID1A 1KIFA 3RUCA 1BSVA 1MX3A 3FPCA 4BOYA 2DLDA 1VL6A 4BMVA 2UVDA 4FJ1A 5BNTA 1XIVA 4IINA 4BKPA 3GG2A 4Z0TA 4EITA 3B1JA 5L95A 2QYTA 3F4BA 4L4RA 1GZ4A 3U9LA 1PGPA 4PN3A 1RYEA 1RM0A 4DLBA 1I24A 5IG2A 4EZBA 3BMOA 1QYCA 2FPIA 1YWGO 1ISGA 2JFGA 3IKVA 4EJ6A 1NPYA 5F21A 3I4CA 3IOYA 4HWKA 1DIGA 1XSEA 4YAJA 2POQX 4ND5A 4CM4B 5EQFA 5CDYA 2HRBA 1K6IA 3EYWA 3NT5A 2FR1A 3WIEA 1C3VA 1IZ0A 4LRSB 3UW3A 2DQ4A 5DF1A 3OJ0A 3PJFA 3SJUA 2DFVA 3GPDG 2WYUA 4PLFA 1JLLA 2EKQA 3CSDA 1F0YA 2NACA 2AXQA 5A3VA 4ZA2A 2V6BA 4DYVA 1VSVA 4CLXA 4YYZA 3KM0A 1X1EA 2WD7A 3VZSA 5K6AA 2J8ZA 4J6FA 4QFDA 4YACA 4MP6A 3HDYA 1I2BA 1DIBA 5T8KC 1V9LA 3TZQA 1OFGA 3K2EA 4O1MA 5CDTA 2NV6A 1H6DA 3BYZA 4FN4A 4CR7A 1YQXA 3WX0A 3KBOA 4ZHSA 1IHXA 3ROQA 2QRJA 5LDHA 5T57A 4L9RA 1E77A 3B6ZA 2UUOA 4BQPA 3AM5A 1Q1NA 4CM9D 1KEPA 3KYBA 4WLUA 4P4LA 5DBFA 3PQEA 3RSHA 5JW6A 3CINA 3JQEA 1IUKA 1WLYA 1MB4A 7MDHA 3GVCA 3I6QA 2IZ0A 3U09A 1ENOA 3FCOA 4WASA 5JY1A 4XWYA 4WOKA 4CQMA 5BSFA 2VZ9A 3UKOA 1UXGA 2EV9A 4YJGA 4CM7A 4JBGA 3MTJA 2X8LA 4NU5A 5DCYA 5KJFA 4LMPA 1F14A 1R0SA 1V3VA 3ASUA 3O8QA 4OAQA 4R3NA 3ZV3A 4ITUA 3JYLA 3MJCA 2VTDA 1GD1O 4GBJA 5G0SA 1CEQA 2DKNA 3GDOA 5ENDA 2PNFA 3AM3A 2BRUA 3TDKA 1BXGB 3AOEA 1KS9A 1E92A 1UZLA 3BMNA 3NTOA 4Z9XA 3WDSA 3GDGA 2JAPA 3PFFA 4RZHA 5TLSA 3QVXA 1KY4A 4C7KA 1OC4A 1U7TA 4L76A 4R1SA 3V8BA 1WP4A 2W98A 4D0RA 1MC4A 1VKNA 2O3JA 1EFLA 3Q6IA 2Z95A 2FR8A 4NBVA 4RLSA 3I4FA 3RC2A 1SOWA 2O7SA 4E21A 4BO1A 3MTGA 3ANLA 1FMCA 4P22A 2O3QA 3MJTA 1PGQA 1I2CA 4JROA 2Q3EA 1U3TA 1T2FA 4GLLA 1K6JA 1C1XB 4YAGA 3A4VA 4BNYA 2V65A 2EWMA 2YHIA 1PR3A 2ZYAA 4RPJA 3PQFA 5AXDA 1NVTA 4RDHA 1H6BA 3FD8A 4YRAA 4Z9FA 5DN9A 3ZHZA 4ZQFA 4MDHA 4WLEA 5EIOA 4N18A 1FDSA 3DZIA 3VTZA 1JQBA 4K26A 4CM1A 1D1SA 3DMYA 3PI7A 1Y81A 4OQZA 1M66A 2GZ2A 2PD6A 5AVOA 1ENYA 2OP0A 3I1JA 4LSWA 1KYQA 1LDEA 2NM0A 1NM5A 4AJKA 4A27A 2IZZA 4ZN6A 1NYTA 2P9GA 5DNAA 2EJVA 4HX5A 1XDWA 4KOAA 1FDWA 1PJLA 4E30A 2CMDA 3DONA 3D7LA 1EVZA 2P4QA 4E5YA 4O0LA 4R16A 4IUYA 1E3EA 4NFHA 1ML3A 3ANNA 3ONEA 2CVOA 3ZHBA 3UCXA 2CZCA 2AG8A 3I23A 2VWQA 4BGVA 3AOEC 3M1AA 4E5KA 2O3UA 4E5NA 3F1KA 3M6IA 2PGLA 3JV7A 4BNJA 1Y8QA 1PJ2A 3LQFA 3OETA 3H9UA 3S2FA 3WJ7A 4OL9A 5JCJA 5I7SA 2ZTVA 1XR3A 2HMVA 2Y99A 4OXYA 3G1UA 4FW8A 4DRYA 1NASA 2VRCD 1XQ6A 2GCGA 1R4MB 3G3EA 2WMDA 3D64A 3ZHYA 4HV4A 3WGHA 1VL0A 3EVTA 3IUPA 5L3ZA 3V5NA 3QHAA 4R1UA 2PZKA 1P1HA 1I3NA 4EGFA 3KSDO 3R0IA 4J4TA 4B8WA 4CMGA 5IDXA 4U0KA 1DHTA 3JQ8B 3UICA 3RJ9A 5ITVA 1ZMOA 4YJFA 3NUGA 2HO5A 1HLDA 3DBHA 1QG6A 4DBZA 4RF3A 4J7XA 1XG5A 1CQIA 1H2BA 2NTVA 4YQZA 2D8AA 1SB8A 2NUAA 4M8SA 1UDCA 4E5MA 2Q2WA 3TSCA 1A9ZA 4XIJA 1BW9B 1GYRA 2WM3A 2ZQYA 3ENKA 4WNCA 5FYDA 3KYDA 5KOIA 4IDFA 4WCDA 3G0OA 1DC6A 1H2HA 2O3TA 1MGOA 1FJHA 1E1MA 4DYDA 1EZ4A 1KC3A 4PG5A 2EHDA 3PK0A 3K92A 3UGKA 5CAEA 3OECA 3L07A 1KC1A 1NX6A 1AN9A 1E7SA 1M76A 1GU7A 1WW8A 2VWPA 4J90A 4RQUA 5JXWA 2B4TO 5I9MA 3FBGA 1D4FA 5I8ZA 8LDHA 1IULA 3S8MA 2NQ8A 3HB5X 3T4XA 1LSOA 2D1YA 1YS4A 3LVFO 1GYPA 4WK6A 4XYLA 3I9KA 5JBIA 2OFPA 1C1DB 3JQDA 5L53A 2R2GA 2HMWA 3NGXA 5CFZA 3A28A 3NV9A 3A06A 1JA9A 4CMKA 1K0UA 2C5EA 1NPDA 1RM5A 4B4UA 2Q1WA 1SB9A 1J0XO 2YDXA 3WSVA 3C85A 1O6ZA 3TL2A 4NH4A 3OFSA 3OH8A 1LC0A 1N5DA 4JBIA 2VHVA 4NR0A 1PEDA 4YT8A 4DA9A 4E3ZA 1HDZA 4JNKA 4QXMA 4BNUA 1J5PA 4GAEA 4MVJG 5DBIA 3C7CB 1JVSA 2CY0A 3ZWOA 4CLRB 3EMKA 1CYDA 1I33A 3NT4A 4ALMA 4M55A 4I5EA 1R0LA 3LT0A 4L0QA 2O2YA 1DEHA 1PL8A 1PS9A 1NFQA 3PHGA 4OSOA 4URFA 1PSDA 2B5WA 4YT2A 4CV3A 3GOHA 1NQAO 2Q45A 3G17A 5JO0A 4UREA 4PLWA 1WXDA 2OXIA 3TN7A 5L9AA 2H6EA 3SJ7A 1SAYA 3D4OA 3HZZA 3PYLA 3ZGYA 4UUNA 1ZK2A 1P0CA 1SBYA 3IUSA 4ZRNA 2Y1GA 3LT4A 4AJJA 3EZYA 3WLEA 3COSA 3ZNQA 4NJMA 3KHUA 3BA1A 4IBOA 4E5PA 4YR9A 1GEGA 2HLPA 4UEKA 4FFRA 1PTJA 3E6AA 4JLWA 1GUYA 1ZSYA 3F3SA 4Z3DA 1H6AA 3FHLA 1CERA 5IJZA 3E9NA 1FXSA 4KTVE 3BIOA 1M6HA 1SPXA 3P2OA 4Z9YA 1E7YA 2IXAA 1NVGA 1VSUA 1DRVA 1WDLA 1I8TA 4PFJA 4XEHA 3WTBA 1Q7GA 4B7UA 3RUFA 3VDQA 3B70A 4DMLA 3O26A 1F12A 3WIDA 3S2EA 1OZAA 3CKYA 4AJIA 2XOXA 5A05A 1PS0A 2NSDA 1KOLA 2IRWA 1EE2A 4S1VA 3QA9A 2VYVD 1PGJA 4ILKA 2CVQA 3DBRA 3H5RA 2YYYA 5JYDA 3OQBA 3OA2A 4NDNE 2D5CA 1DFIA 4ROSA 2Q4EA 1MFZA 3RUEA 5A5EA 2RHRA 4WPGA 4BO0A 4J0FA 5FFFA 4IPTA 3ZW8A 5A4DA 4DIFA 1HSOA 4YB8A 3JQCA 3E18A 1YJQA 3T7CA 5JAMA 3RU7A 3AUUA 3ZWNA 4LMRA 4B4OA 5I8WA 4BS9A 4FPXA 4INAA 4NBUA 3M2PA 1KEWA 4YAKA 1GV0A 3ABIA 4B3HA 4OXNA 2RH8A 2P2SA 4YJFB 2BFPA 4OKIA 4L74A 3WICA 2C5AA 1P45A 4BNKA 4RQTA 3VKVA 2IXBA 3IP3A 3OHSX 5IFLA 3H3FA 3HDHA 5KVSA 4FC6A 1U2GA 4J16A 1J6UA 4EYEA 1N8KA 2LDBA 3NT2A 4BL5A 1TT5A 4R4JA 1P74A 4KQWA 2VYND 3HQ4O 1LLCA 1RWBA 2YUTA 3KLMX 3ONDA 3QSGA 2BD0A 1PWXA 3OEWA 2X0JA 3PRJA 3ETGA 1T1SA 1G0OA 5FF9A 3U5TA 3Q2IA 1DIHA 1G1AA 4DLAA 1LEHA 2DTDA 2OMEA 4OJNA 4YA6A 1RYDA 3PIDA 3QV1A 1UJMA 3IMFA 4ZQBA 2CDBA 4B4WA 1O5IA 2Y1FA 1U1IA 4FBGA 2EXXA 5IAAA 2VHWA 1VPDA 1IB6A 2DFDA 3F6YA 4JP3A 1Y9EA 2BF7A 2JCVA 5JCJD 4UEOA 1PJ4A 1N92A 1Z7BA 5AXBA 2BGKA 4QT0A 4I9UA 2IZ1A 1ZCJA 2LDXA 2YV2A 4S3MA 2BMAA 2RAFA 5L40A 2AQ8A 2JAHA 1TT5B 3KTDA 4ND1A 4WCFA 1LSJA 4JX8A 1EBUA 4MOWA 3FRJA 3FNFA 6LDHA 1LLQA 4AJ1A 5B12A 2W4QA 4XIYA 4CMHA 5H82A 2W2LD 3D0OA 3KO8A 2W90A 2DPHA 3JQ7A 2OP1A 2EERA 1KBZA 5A06A 4IJVA 2GN9A 3RBXA 3SBOA 4XYMA 1SZJG 4E2ZA 4IY1A 1UP4A 5B4UA 2J3JA 4WEOA 1LQUA 3QVSA 2C7VA 4J3FA 1QYXA 4M89A 4XRRA 1QLJA 4KQXA 5U1PA 2H9IA 1YGYA 3CH6A 3UAGA 1P1IA 2VZ0A 2WE7A 1X14A 3ZWWA 2BH9A 4XYBA 3K30A 4NJOA 1P1JA 2X5JO 2JJYA 1N9GB 1E7QA 2WSBA 5COAA 4BNIA 3KEOA 1E3LA 3JQ8A 3FWNA 2DUUA 3WWZA 3TNLA 1JDJA 1ZIDA 4UVIA 5EJ2A 4RORA 1UDBA 1ENPA 1A4UA 1YL6A 1MA0A 2HSDA 1HWYA 1E3IA 1RM4A 3NAQA 4Y9DA 3ZV6A 1CJCA 3NKLA 3PLNA 1PZGA 5TIIA 3ZCXA 3N58A 1X7HA 5L4NA 3OQ1A 2EG9A 3H9GA 2HQ1A 1GQYA 3MWEB 1LRLA 1IE3A 2RH4A 3BXXA 3FNHA 1NFFA 5CEEA 2PK3A 2Q46A 1PL7A 1F06A 1Y9AA 1A5ZA 4RVHA 4BGEA 1TLTA 4WEQA 4WJZA 1LA2A 3DAGA 4XQEA 2DBQA 4XQCA 1ONPA 2X23A 3ZWPA 4XJTA 2J3HA 2ZJ0A 3LF2A 1LNQA 2D2IA 2CNBA 4RPKA 3H5NA 4NJMB 1V3TA 2CVZA 3OIDA 3K96A 3W8FA 2P91A 3JYPA 4ZVVA 4XJSA 1X13A 2AW5A 2GLXA 5G0VA 5C7IO 3DZJA 4CUJA 3H4VA 5TRTA 4J1SA 3SC6A 2Q50A 4ALNA 1WWKA 4BO6A 1IZ9A 3OIGA 2P5YA 4ESOA 3FBTA 3HDQA 2O48X 3GMDA 4BO2A 5BT9A 4DREA 5EERA 1MP0A 4ND2A 5EMHA 2WD7B 3ZU4A 5TT1A 4R9RA 5A3JA 1HE5A 3ZV4A 4IDDA 4WKGA 4L8VA 1I3KA 4RF5A 4L73A 4DUPA 1GQQA 3GC6A 4CM9A 1DPGA 4JIGA 1H93A 1E6EA 1P1KA 2I5PO 3F4LA 4XR9A 4R3WA 3Q11A 1ZBQA 2FMUA 1XEAA 4B4VA 2HJSA 4CL8A 4W9NA 2AEFA 2P68A 1R66A 4RVSA 1XQ1A 2FP4A 4NIMA 4QO8A 4RF4A 4TRNA 2Y68A 4XZ3A 4BV9A 2I66A 5ILGA 2PD4A 1JAXA 3KLPX 5IN4A 1QYVA 1HDXA 4DTIA 5JAIA 4P38A 2C0CA 4IJWA 4Q3NA 3ADOA 2V7PA 4WOJA 1C0LA 3IKTA 3EAGA 3L0DA 1EMDA 3QY9A 4RJTA 2WE8A 1LDBA 3IAHA 3NX4A 1VE9A 2YW9A 2DBZA 4IJUA 3DBLA 1Q7BA 4IDCA 1XU7A 3EK2A 2ET6A 3BZUA 4M87A 1KETA 2NADA 3JYQA 3T7EA 3WGYA 3ZHXA 5CEJA 1U3VA 4TZKA 4AJEA 2O4CA 1VJ0A 4BKQA 2B69A 3ZU2A 3QWFA 3TOXA 2JD1A 2BI7A 1V0JA 1MUUA 4CM8A 2P4HX 3JTMA 1BTOA 4J49A 1R0KA 1B15A 3ADPA 3R6DA 1MXHA 1U4SA 5H81A 2VZ8A 4OXKA 1T2AA 4FS3A 4CR6A 4IMRA 4MVJF 3DHEA 1RPNA 1MXFA 4NPCA 1H9BA 2CDAA 1T2DA 4B3JA 4JJGA 1GFSA 4GMGA 3ZV5A 3K31A 4CLEA 4Q3BA 4J0EA 3RUHA 1X0VA 1BDBA 2NVUA 5GZ3A 1P1RA 2ZK7A 3JD3A 2DM6A 1Y5RA 2X86A 2EKPA 5TJHA 3V1UA 3I9MA 4GX2A 3ZDFA 1K3TA 2Y1OA 3GMSA 4JJIA 5L45A 3DBRB 4FD3A 3U4DA 4A26A 1X7DA 4PRKA 4W99A 1YOVB 4MVJE 4XCVA 3ASVA 4CMJA 1DOHA 1E7MA 2OO5A 2O3RA 4MJLA 4O59O 2NLOA 1Y6JA 4X54A 1Q2XA 4FFOA 4WCFC 4NMHA 4DLLA 1N1EA 1B8UA 2X9VA 5F1OA 1NWHA 1ADFA 3PZBA 4R1NA 1ADGA 3AY6A 3PWSA 4Y98A 5T67A 1B8VA 4PLPA 4MP3A 5DDIP 2R00A 1F17A 1LSSA 3BTOA 3QRWA 3TFQA 1YRLA 4GGPA 3ZNPA 2I9PA 4FFLA 1ZO8A 2W8ZA 3K6JA 3OICA 3W8EA 5DOVA 3ZU5A 1U5AA 4B7XA 5C5IA 4DC0A 2VHYA 3H6KA 1LJ8A 4ZICA 3PTZA 1QSGA 3Q2KA 2E82A 2O4UX 1LU9A 1PZFA 4J9UE 4J1TA 2Q99A 2RIRA 4RGBA 2QG4A 1JAYA 4H15A 2QYSA 3TRIA 2Q2VA 5MGBA 1MG0A 1P33A 1YBAA 2FZEA 1BVUA 4WECA 3L6OO 4EUHA 2OZPA 2DPGA 3VVCA 3NTRA 4CQLA 1YH3A 4RL6A 1U9JA 2O23A 3ZW9A 2B4RO 3AK4A 1LRKA 4WLNA 3QWHA 4CMIB 1GV1A 4CLOA 1Z7EA 4LK3A 4CMEC 3E9MA 1U7HA 4JP2A 2CD9A 2ILTA 2BFMA 3I6IA 3ZZNA 2D3TA 3WGTA 4J9VA 1EQUA 4IQ8A 4PZCA 3Q9UA 3HE3A 5A9TA 2EP5A 3CMCO 4BNWA 2VQ3A 3I9OA 3HN2A 3O8QB 4A2CA 1DAOA 1BXKA 3WQRA 2PH5A 1M67A 2GF2A 4E33A 3LSYA 3WNVA 1DHRA 2CFCA 4CQMB 3MJVA 1C14A 1E3WB 1PQPA 1J49A 1LUAA 3JQFC 4B7CA 5IZ4A 4HKTA 3V2GA 4E0BA 4JK3A 1AXGA 4D3FA 2OBYA 2WYVA 5CDGA 4IZHA 4KZPA 3DMTA 1GUZA 1PJ3A 1PJCA 2B36A 2DT5A 3GRPA 4YAEA 4GMFA 3P5SA 4LGVA 5G4LA 5BNFA 2VHXA 3QWIA 3LLVA 1JW9B 3WJAA 3RCBA 3E5MA 1WNTA 1SOVA 4MVJI 4E6PA 5AXCA 3GQVA 4U5QA 1NVMB 4OYRA 5DCUA 4TVBA 2RBEA 4O63O 1PIWA 2ZTMA 4ONEA 4E12A 4CM3A 1NR7A 1ZK4A 1NXQA 1A71A 4MO2A 4NK4A 4TQGA 3QIVA 1QXSA 4ND3A 4EJ0A 5MDHA 3OA0A 3H8VA 4U6QA 5G0WA 4GSLA 4HFNA 5CG1A 4K6FA 1MFPA 3ANMA 2UYYA 3RUIA 2J3IA 2XXJA 3JQGA 3GHYA 3DBLB 1D8AA 3AU9A 3GK3A 4CMEA 2G82A 3BMNB 4R9SA 1JWAB 3GGOA 4TMFA 2P9EA 5EESA 2ZTLA 1HZJA 5CHEA 3LT1A 2XAAA 3OBBA 4KDFA 1FDVA 1A27A 1DC5A 2Q4BA 3ROMA 2I67A 1E3WA 1NFRA 1ZZEA 1B2LA 5JSFA 3Q9NA 1ZK1A 5JDCA 1EUCA 2E49A 2WTBA 3EVNA 5KJCA 3GUYA 4DPMA 3ZU3A 2DTXA 3A1NA 4N5MA 3TZCA 3WOHA 4E2WA 2H63A 3OIFA 4B8ZA 3SX2A 4W7HA 1E7WA 2X0NA 1EUDA 4RVFA 4CQMD 4DIOA 4YDRA 3VPHA 1Z74A 1B8PA 1HEUA 1M2WA 1XCBA 4DL9A 5A03A 2C54A 5KIAA 1NQTA 2NTJA 4CMIA 3DAFA 2DUWA 4IXTA 3E03A 4BNTA 2JD0A 4QEDA 1C1XA 5BSGA 3GHHA 4IGEA 4TZTA 1YJ8A 2O3SA 5AOVA 4WGGA 4BNHA 4BNXA 2FOIA 2C59A 1E3JA 1HDOA 1BXGA 3PXXA 4PG6A 1C0KA 3KRTA 1EDOA 4W6ZA 5BR7A 1D3AA 2X0IA 1VL8A 3KYCA 3E48A 4CV1A 1WMAA 4Z0PA 2QZZA 1V3UA 3PFWO 1NHGA 2PH3A 3GNTA 4FFNA 3JYOA 3DFZA 1NQ5A 4PRLA 4DXHA 1UXJA 1GYQA 2C20A 4XD2A 3R1IA 2NU6A 3E1KA 3SC4A 2Y1CA 1JVBA 1DRWA 3JD2A 3JQ9A 3PHHA 2AMFA 5IN5A 3VHRA 3WMXA 1KVQA 3VPXA 2HCTA 3FNGA 5AQ1A 3A14A 1LSUA 3BHMA 3GVPA 1DSSG 1PR9A 4EUEA 3F46A 4IM7A 3V2UA 2OORA 1O9BA 4LCJA 5A1TA 2Y1EA 4NG5A 3K9QO 4IDAA 2JL1A 5IZCA 3GUCA 1EFKA 5U4QA 4F46A 4IJKA 4OSPA 5JLAA 3PHLA 2AEJA 3MJEA 4HADA 4BV8A 4D3DA 3CXRA 1ZSVA 1N2SA 1FDUA 3KYCB 4YT4A 5AXAA 3INTA 3WLFA 4BB5A 2OGUA 3HB4X 4HNHA 4IIUA 4DMMA 3FPLA 4LN1A 1MV8A 5C7OO 1SO8A 3PLRA 1CQJA 3DOJA 1K6XA 4J7CA 1N9GA 3TZHA 2Y05A 4BKOA 3DQPA 5B4VA 2VNAA 3TOZA 1DFGA 1YB5A 2VWHA 9LDBA 2HJRA 4N5NA 5JO9A 4NBTA 3PWZA 1WAMA 3SVTA 2CDCA 1HDYA 3HNPA 3WYEA 1H0KA 1QMGA 4ND4A 4UAGA 3S1LA 1ZJYA 5TX7A 1QRRA 3HFSA 2J3KA 2J5KA 3OM9A 1WMBA 1IOLA 3CZRA 4HNGA 4C4OA 3DBHB 2X5KO 2BFOA 3FTPA 3C1AA 3IQDB 2GZ3A 3RKUA 1ARZA 2C29D 3AI2A 3H2ZA 5T64A 1Y1PA 3RBZA 1BG6A 4RCVA 2A92A 1ULUA 5K9ZA 5TC4A 3D3EA 3WFJA 4UVGA 2FSSA 4MKXA 1NR1A 3GY0A 1OAAA 2PTGA 3VH2A 4A10A 3WS7A 2DVMA 2J5RA 3QLJA 4HXYA 1GAEO 3RC7A 3VOSA 3GFGA 1R4MA 3DB2A 4GKVA 4U7WA 1NHWA 2HDHA 2FR0A 3JQ9C 4IS2A 1QKIA 1ZVMA 1Z6ZA 5I7EA 4J4HA 2GN8A 3NEPX 2H1SA 4LRTB 1VKOA 1HE4A 1OBFO 5KKAA 5JMPA 3KXDA 2PY6A 3HN7A 1O95A 3I3OA 4CJXA 2B83A 4DQXA 2C07A 3ZI0A 4LSMA 1BGVA 3PGJA 4XQ9A 3JQAB 2ZB8A 3D1LA 2RCYA 3CE6A 4GLOA 2QIOA 3EHEA 1P3DA 2F00A 2HMTA 4KP7A 4YJDA 5G0UA 2B5VA 4AG3A 4CPDA 4MIEA 1PQWA 2YQ4A 2Q2QA 1C0IA 3WNQA 3I52A 2BFAA 4YAIA 3Q3CA 4TRJA 4AL4A 1EDZA 1W4ZA 4NBWA 1NTOA 1O0SA 1N1GA 3GRKA 5C3MA 2Z5LA 3GF4A 4I1IA 3ZWBA 3VH1A 5JNLA 1GTMA 5KNLA 1ENZA 1MC5A 4PG4A 3RFTA 5JAZA 2GO1A 3G1TA 3RASA 1T26A 3CPSA 1EK6A 1JKIA 2V6FA 3GNSA 1TB4A 5CG2A 5KVCA 4O6VA 4FB5A 4PLTA 1QORA 4IXWA 2V6MA 2C7GA 2ZQZA 3NDRA 1NQOA 5DBGA 3LZ6A 3ENNA 4K28A 5DCWA 4OH1A 3BMOB 1EVIA 3B20A 4BVAA 1HDGO 4CUZA 4R69A 5IXYA 5K1SA 1ZH8A 3O03A 4IGFA 5COQA 1ZFNA 3GAFA 2P5UA 4PIVA 3Q0EA 1AXEA 3TFOA 4XGNA 1PQUA 3WGQA
chains in the Genus database with same CATH superfamily
5KWEA 3U1VA 3TZEA 1KDTA 3ENQA 4QHSA 6ABPA 1TEHA 2HF2A 4UU7A 5ALJA 3SZUA 1XRMA 4P35A 1CR6A 1O03A 4YMHA 3C3WA 4N54A 5EN4A 4EBFA 4DR4B 2EDCA 3OMLA 4OKNA 4DJ5X 1KDVA 3OZ7A 3DVSX 5DMXA 4RJ2A 3TZ6A 2IF2A 3UHAA 2A5JA 1LF5A 1FNDA 1NE7A 5H02A 1WL8A 4EB3A 4YRGA 2I65A 4G5OA 2BPOA 3FAZA 4BO5A 1DCFA 3AY3A 1YR6A 2PBFA 2PX2A 3KJQA 3WMGA 5T7BA 2R4QA 5CLIA 2CLOB 3IPCA 2C8LA 2QJWA 4K6KA 1K7SN 1UT6A 2PKQO 1TL7C 3MN1A 4YNBA 1H1TA 5D84A 4JP5A 4RXUA 3WLRA 5IJXA 3UPTA 2MCFA 3W04A 2MWMA 2QR5A 4LCBA 2A0YA 2MHCA 2PX0A 4AYWA 4LRXA 3D7SA 3Q7TA 1CEEA 5LNK6 1CW2B 4H7JA 4HH3C 4ALJA 4XTCS 1XWFA 3I83A 4RPIA 3Q98A 4MR8A 3SXUA 1VFNA 1JQKA 1VI6A 2E85A 3ONVA 2CZGA 2YY5A 4GXRA 4MPJA 3RKRA 4X95A 2NU7A 3SFZA 3AHDA 4EVSA 4EB6A 3GJYA 4LVUA 4ABTA 1QQAA 4LPKA 3STXA 1M6EX 2ZGVA 3CNOA 3KFXA 3NDPA 4RVOA 5D5PA 4H3HB 3DNMA 3LUPA 3TD6A 1GZ3A 4MVJH 1P5RA 4LJ4A 1E4YA 2XBLA 3AVWA 4FHZA 1ZEJA 3UKJA 1UWLA 1LTHR 5IJ0B 4Q6WA 3VBEA 4MPTA 5FV7A 2UYCA 4QUKA 4OHYA 2Y0CA 2BKLA 1N0IA 1XHFA 2G17A 5K2OA 3KZXA 2XE8A 4LNHA 4UM7A 4R1QA 2IEZA 1TFUA 4NLLA 4YCAA 3GT4A 3WWCA 2PFGA 4BIIA 3IT3A 3A27A 4U2CA 4GM1A 5CH5A 3UYKA 5IUJC 2BFNA 4IQGA 1EVJA 4L22A 4QT4A 5AKGA 1Y80A 2QR3A 3FDZB 3V4PB 4EFNA 4OMDA 2DJIA 2H7YA 4QUHA 4D9GA 2WM9B 1ZU4A 1BAPA 2WM8A 4G0PA 4LCEA 4C30A 4ZOQI 2B4QA 4RSMA 1AGXA 3PDUA 4NDAA 5AJHA 3NFYA 2FG5A 5FWDA 4H7KA 3LA8A 1DIAA 3L8EA 1JQAA 3EXG2 4PYMA 5CDHA 1NQVA 1FDIA 1U7PA 1Q1EA 2BFBB 2QSYA 2ZIEA 2QTVB 4JD5A 4IZOA 2E7ZA 3LX5A 4FDMA 1RKXA 4TXMA 5LOVB 3CIFA 3IVGA 3EW7A 4DCSA 2NYVA 4EL0A 4F86A 4ZYVA 4DHWA 1YQDA 4A7PA 1XVTA 1VIYA 4Y2HA 5E4YA 4G4GA 3K1AA 4OMFG 5FTKA 2GTHA 5B53A 1VLZA 5C1BA 5JHGB 2Q4DA 4FGWA 3W6UA 2HW8A 5H7XA 1HOTA 1DUVG 1DWOA 1CUJA 1UJ4A 5K01A 3KJXA 2YXLA 1DP4A 4HXEB 5TGDA 2B1IA 2AVDA 1AHHA 2QTNA 5K20A 3M82A 1Y37A 4QUIA 3RJ5A 3X0DA 2N47A 4R7ZA 4YDQA 2Q6OA 4JL8A 3EH1A 1H1DA 3LL7A 3RBVA 1GPUA 3QLVC 1PJQA 4NZ9A 3PR2B 1XZQA 1N5MA 1TA4A 1W1UA 1HT1E 3L6BA 1CLUA 3I5UA 2VF5X 4WLOA 4YWJA 2XQKA 4BQNA 3WIUA 2Q62A 2ODEA 3DEHA 3INYA 4YVFA 1Q0QA 2FPUA 1TJ3A 1T2CA 1BCSB 1Q6ZA 2ODAA 3LNCA 4I50F 4N65A 3UJ6A 2ADMA 4Z7NB 3WLAA 1WZCA 4HX9A 1GNLA 3DLCA 4REOA 3NV7A 4MCHA 3MJFA 4M36A 1A2OA 3FPBA 1L9XA 4HAXA 3S3TA 4Q6BA 3VR0A 2ZS7A 4D45A 3RFVA 3QFRA 5CDUA 2OBLA 1S3SA 2Y9MB 3ND5A 1E1KA 1RLIA 5KMGA 1RRVA 1ZD2P 4EY5A 4D46A 1GAXA 2ZBFA 4M0CA 4MVJD 3V2IA 1HTTA 4Q4JA 3QSYA 4A8PA 2QVCA 1JI3A 2JAWA 4M7RA 5LP6C 1KPGA 3ZIAD 4O5OA 4R84A 4DT1B 1ADBA 3TQHA 4TL8A 1F4VA 1E2PA 3PXEA 4OQYA 2J1LA 5TMPA 1NN1A 1OFVA 3PDHA 4JKOA 1Y3FE 2Q4RA 3HYTA 2P9QA 3ZN2A 5I7FA 2WA2A 4AJHA 2ZATA 4EA8A 4IXMA 1UPXA 4P58A 1NVDA 1XLTC 3D6TB 3HRHA 4WXHA 4XIFA 4WBNF 4M1YA 2AD5A 1XXHE 1BMDA 2NU7B 4U0JA 5E9AA 4BMYA 4LHSA 3EIQA 3OTWA 3JZFA 5DWDA 1NJGA 3R6LA 4N3GA 1HFEL 1C2YA 4M54A 4DWVA 4ENSA 3R3HA 1HM5A 2LTAA 2MSEB 4I8XA 3W77A 5LYJF 2AOTA 2GCEA 4HXGA 3TE7A 4Z4IA 1D5WA 4ZRMA 2ZIXA 3IUYA 3UOAB 4D43A 4DCCA 2A7QA 5BN5B 4K40A 1FSSA 3KVVA 5AJWA 3DMTC 1BDJA 2X8WA 2CF6A 2QTBA 3O8OB 2HREA 1KKUA 3V1KA 5DNCA 3L4BC 3OJLA 4AO6A 2ZBUA 1OYVA 2E4UA 1VJCA 2BKAA 4WZBE 3C3AA 2NVWA 1E9VA 2FTKE 3C6MA 4JLMA 1KH3A 4Q3AA 3N5KA 4G0YA 5DXJA 2PNJA 3DE0X 5KJ6A 3I5AA 4B3IA 1NYRA 3KSRA 3GA7A 4LF5B 2WUFA 1DJNA 4KX5A 3KZVA 3T3HA 3AEKA 4BLUA 1AIPA 2QVBA 3V7YA 2W42A 4O25A 1QIJA 1DQPA 1EVYA 1DEOA 2OL4A 3DFIA 4WESA 1ADCA 5BQFA 2EIHA 1YF3A 4QEZA 1KSJA 2BM8A 3GLQA 3CTMA 4IX1A 4HNVA 4OQMA 5CNJA 2EWVA 1D2HA 3EVAA 3U40A 1RHJA 1WSWA 4MSUA 1IVSA 1JXOA 2WFZA 3C3XA 5G3YA 2F3PA 3LV8A 1UP6A 4OY3A 1BN6A 2DKOA 2PSFA 1XZDA 2RG1A 3D6HA 4KNWA 5I01A 3S81A 1B16A 2QAGB 4BQIA 3ZWKA 3HJBA 2QMEA 3LUCA 2PWZA 3CS3A 4YCBA 3AZPA 4BLRA 4EEZA 2DHQA 1RBZA 3A9WA 4RA6B 4JI7B 1ZK3A 2BGMA 3WADA 3L7JA 3RYFA 1DZ3A 3AOGA 3W3ZB 1XYGA 1HPLA 2NPOA 4CM6A 2ONKA 1Y8RA 4KPUB 4ZMBA 1KOGA 4D25A 4MAAA 1P9LA 2ZAOA 1RBMA 1TKCA 1GQSA 1IPEA 2AMJA 2CYAA 3AFHA 1IBCA 3KE9A 1UZNA 3TIIA 4UHKA 4X00A 2ZR7A 3JSXA 3DC2A 4JDPA 3OLCX 1AN0A 5E3HA 1Q7TA 1U8TA 3I42A 2G9RA 3JQFA 1Z2DA 3KJZA 1ESMA 4DQUA 5SICE 3WB9A 3ABOB 4KWCA 4MQMA 4ZVLA 3AF1A 2AFIA 3K1ZA 3ZC3A 3B1VA 1DT3A 1T9KA 3G2KA 3MQFA 1O08A 2DSNA 4G5QA 1GVNB 3TX6A 1OROA 4RX1A 4JT9A 5DNYB 1L8AA 1Z83A 3BGIA 2R6GA 3T5BA 2YIDA 3HXKA 4PYLA 2HHHB 1JN0A 1R0XA 4GUAA 4AF8A 1EH5A 1XZFA 5C3UA 1RYYA 5LLTA 3GQBA 2YV5A 4HDKB 1PR6A 1WMDA 3BGDA 2Q0QA 4ZVQA 1CUUA 4YONB 4F5YA 1OOEA 5C4IA 1KZ6A 4OCZA 5GV7A 1E6UA 4OLFA 1BVHA 3OPYI 3D0RA 4M98A 4DDHA 1ZWLA 3DTYA 3EG9A 2IEDA 2VNSA 1CQIB 3IP8A 1G8KA 1QDUA 4DY6A 2ZT6A 2LNDA 1JH9A 2P78A 3GFFA 3HLKA 1NW4A 3U39A 1MAWA 4JB3A 3FTCA 4C0JA 2NNLD 1EGAA 2PXHA 3AJ8A 4JFRA 4JBHA 4ZP1A 2WU3A 5L51A 3NONA 3LRPA 5I9LA 4A0QA 2OBXA 3EDRA 3PGKA 3IR6A 2YWDA 4GO1A 4M0KA 5AUOB 5LN1A 1A7JA 2ACEA 1TQDA 1KEUA 4Z9BA 5CB4A 3NVMB 3VR6D 2FLVA 3SR0A 2IEAA 4BEBA 4NU6A 4FOSA 2HA5A 2JGAA 4HNUA 2RE8A 1JQ5A 3LHIA 4UEJA 8ATCA 3H2SA 1YD7A 1YT5A 3PKJA 3Q41A 4Z0HO 2R7KA 3BL8A 4QXPA 1IHYA 3C8ZA 4AM8A 4A8HA 5DN6A 2PWAA 1GEEA 3GN1A 1GUDA 2XWSA 3H2GA 1T6ZA 2VTEA 3FHJA 3ONWA 5ECWA 4FGJA 3S70A 1QU2A 3LGAA 3QVKA 2HR1A 4BBPA 3T5MA 1G16A 2BZ1A 2F3SA 2DKFA 2PXAA 2QVGA 3N9IA 4KQCA 1QE5A 2Y66A 3WL3A 4P8RA 1BFKA 3D43A 4IZ6A 1D6NA 3H5OA 1B00A 1OXVA 1TZBA 4F84A 4KITB 4GQAA 4N0PA 5DP2A 2I3BA 3IULA 4M22A 1ANKA 2YYZA 2C7BA 4B2LA 3C6KA 3LYAA 4ERXA 4YMVA 3WSWA 3HCWA 3M2TA 5DIZA 1WB4A 3DDNA 1RAIA 3K9LA 1VHDA 2OV8A 2PSEA 5KQLA 5B5SA 1CV2A 2ZE6A 1ODLA 4BQFA 5KNBD 3CLTD 2IYWA 1GR0A 1U28C 3VYWA 3A2KA 2B1GA 3QXSA 2I4OA 2JIBA 1JDPA 3KQNA 5FUWA 1LRJA 5JG7A 2DQKA 1VBFA 3FLMA 2IXEA 4JITA 1QV6A 3RAJA 4D6XA 1E0KA 2IEBA 1B23P 1OBHA 1G6HA 3BMCA 3HBMA 4RIFA 5ALXA 3L9XA 3SJBA 2BBSA 3QXJA 4LUCA 1SC6A 4BHTA 1B1AA 1P31A 5ITZB 4PGFA 3VOTA 1ZRNA 5LD2B 5C31A 3VQTA 1E1NA 1UOQA 3RFCA 3VNRA 2G08A 4OAOA 4W8HA 2QM8A 5EXSA 13PKA 1TU4A 2ZRDA 4N0EA 5CRIA 5JAQA 1NQWA 3CRZA 3VPFA 3BXZA 4C4YA 2BP7A 3RVDA 3JX9A 1PBTA 2H1IA 2RJ3A 1KYIA 3O9ZA 3QP9A 3WK5A 4HDNB 4GDFA 2YHAA 1SGWA 3KPVA 3FGOA 2K4MA 2ZKLA 5L3SB 1D2RA 2QTTA 1UXHA 2JA1A 4C03A 3E3NA 3QY0A 1JHQA 5JDIC 2HK6A 3L7KA 1XTSA 4NQRA 1ZQ1A 3HM9A 4S04A 2GPTA 4FW9A 5AT1A 3SJAA 4CMAA 3QM1A 5ESRA 4MEJA 1IH8A 3URMA 2V0NA 4XSGA 4LYGA 2QQ5A 4ZJYA 5K3FA 2ZULA 1LI7A 1MX5A 1S1CA 1TT7A 1I80A 1RAAA 1RMYA 4H3VA 2G3YA 4NEQA 3LT5A 5IC5A 2JZCA 4DJAA 1FRNA 1WXIA 2CSUA 4EGJA 1G60A 1FFYA 5D00A 3ZHTA 3ZD9A 4EHHA 2GJAA 1T4BA 3WGZA 4PAMA 1MC1A 1O5OA 3R4VA 1M73E 4FJ0A 4GR5A 5EJGA 3FWPA 2REBA 2F3UA 4DR7B 4EJMA 1G9XA 4PLHA 1EDBA 1U9CA 1NE2A 3I2JA 3ECCA 2HWYA 5KMGB 2ZUSA 3HN6A 4NPAA 2D3WA 4PZUA 3H9JA 2AR0A 3GLFB 6ADHA 3HM2A 4NEGA 4RVGA 1WHSA 3WHKA 2BMEA 1VLHA 4WNAB 4NK5A 2XCQA 4HAIA 3LUFA 2BI4A 3GZNA 1PZEA 3EEFA 4UFNA 3ZY2A 4ETNA 4I9HA 3UF0A 2AMLA 3BHNA 3GFPA 4LAFA 4NMXB 3WNQA 1HL3A 1QOPB 5I4CA 1ZIYA 3I0NA 2A9JA 3LG2A 2IDZA 4HLUA 4JL5A 3UW1A 3LDHA 5B4TA 5ALHA 4UCWA 3JAWB 4PX5A 3AR6A 1O6FA 2RHTA 1FMLA 2E21A 3B1ZA 3DZGA 3UJPA 3R3UA 4YLYA 5BOSA 4CN9A 3LKBA 2G0AA 5JZ9A 4AJNA 2J0QA 1X6VA 1EJ6A 1WXFA 4KUHA 3T61A 3M89A 3QU9A 5EUMA 3E2MA 3KOXA 3ZGLA 4DQVA 2KS6A 5KTTA 1BQ3A 1I0IA 5JISA 3NTVA 1VHLA 3INRA 4IJMA 5E2IA 4EFKA 2JDIA 3QI7A 3FYHA 2FX3A 4XX0B 2IYOA 3I5MA 1EU1A 2ZRGA 3GR6A 2ZJBA 1KORA 3JD0A 3BK7A 1TAUA 2PQMA 1KYWA 2IYPA 3BMQA 4BV3A 4CDRA 4E32A 2X0RA 5CIYA 1Z12A 4TVKA 4GPBA 4OFXA 4XX0A 4L3OA 4LHWA 2AA3A 4MKZA 2JEOA 4J91A 3C8DA 3FBWA 1IIRA 2VJDA 3E9EA 5TNXA 2IH5A 1PE0A 1PFQA 1VRVA 5LYYA 2P77A 5CP8A 2B37A 3NCHA 5EIFA 3ER6A 4AJLA 2NVUB 4O2AB 4V1CI 4G5FA 5AK4A 3E9QA 1BKDR 4KO3S 2VUSA 3OY2A 3W4JA 2BM1A 3BD8A 4HN4B 4JUDX 5JPCA 3KAKA 2F9FA 7GPBA 1Q17A 2D54A 4RHFA 3T5PA 1GN8A 3RVMA 2AX3A 3D3WA 1R9NA 3H8SA 4MVJM 1H0HA 2JJ2D 4BVGA 5I7WA 2C2ZA 4GPIB 2A9RA 4CKBA 4Z7OB 2WMNB 3EGDA 1GPBA 2X2PA 3DAOA 4K86A 3V3TA 3P19A 2OC9A 2NXWA 2I6GA 3K8YA 3T1OA 4RO0A 3TJRA 3WGOA 3BKWA 1ZXXA 3LUAA 1NNLA 3PVSA 4L57A 3RROA 1YQGA 5IARA 1D4AA 2RFLA 3QK7A 4RTKA 4YMUA 3IIJA 1HE3A 1E6LA 1MB3A 1E5VA 4TRMA 1Y6ZA 2QPAA 1FNSA 1J21A 2X6TA 4JB8A 3CVWA 1I7NA 2EKDA 3AFNA 3PYMA 2D4AA 4HLUC 4DV5B 1J4AA 2G5CA 4OATA 1NIPA 3HWRA 3PHIA 2EW1A 2VHTA 5KOHA 1G0NA 5AVKA 2C2MA 3PEYA 3JD4A 1WCV1 4ACBA 3G8YA 1EZ1A 1XMPA 1CZHA 1DTWB 5A3SA 1PVVA 4HSEA 3JWGA 1LI5A 3Q3HA 4ZQGA 5PNTA 1QIIA 5KTYA 3DT8A 3UB2A 1Z3IX 2GEDA 1BDMA 4PNHA 4TS3A 1F2DA 4DBVO 2O8FB 3FCCA 1O3YA 1TM5E 1A72A 2WJAA 3CX8A 4ITRC 2C31A 2H4ZA 4TT3D 2XXBA 4AWXA 3K8ZA 1JLSA 2ATVA 1DEAA 1Z16A 1SXHA 2ECKA 1K6EA 1PLLA 3GLSA 4AW9A 1REQB 3PVCA 2GT1A 2Q5FA 5M7EA 1TECE 2BFCB 3GZJA 2BMVA 1OIVA 1PEAA 1Z4PX 5IKXA 1YA4A 3RHFA 1FW6A 1A9XA 2IUEA 1ZM4A 1SFRA 1V43A 1QAQA 2P75A 5DYIA 1QPGA 2VLIA 2C5BA 3V97A 4BP3A 2ZSDA 1KJQA 2OBFA 2W8BA 4EDFA 1AKVA 4CIWA 3N8HA 1YB4A 2G7MC 2WOOA 5CCBA 2E37A 3N28A 1YL5A 3GBVA 1ODTC 3TINA 5AVZA 1I3OA 4WZBA 3T9BA 2HFKA 5GPBA 3BSSA 1QVZA 3NUQA 2YW2A 1CLEA 5FB3A 1T9AA 1A76A 2C94A 4OK6A 4RGYA 1V7QA 3OU6A 2D59A 1S8NA 1YK1A 4IS3A 3PD7A 4C0WA 1E7RA 3HJFA 1ISFA 4CNBA 2WQ7A 2F55A 3V1YA 4CTJA 4PRYA 3SJZA 4PO1A 3AXTA 2B8WA 4MQEA 4MDYA 5EXXA 2VCYA 2W37A 5KC9A 1T5TA 4LJ8A 1GCOA 5E6UB 5KJEA 4JI0B 3G89A 5FEUA 4ZC8A 3QNUA 1OF1A 1JH8A 3QPAA 5TQVA 4IFIA 2NP7A 2Z3ZA 3TWOA 6PFKA 4UCFA 2CDRA 4M0MA 1BO6A 4G0MA 4YJHB 4AP9A 2BUCA 3PRYA 4MWTA 4MMYB 2EKZA 5AKHA 4C88A 3V7WA 4NH0A 1MVLA 4PYIA 2VH5R 3TM5A 1DG1G 3OEYA 4II2A 4EG7A 3OX3A 4EJSC 1CRZA 4YCSA 2L42A 4I46A 1CZRA 1HGXA 2HKIA 4P6VF 3FHTA 4ZQHA 1TQ8A 2DWPA 1L5YA 2H1FA 1PUIA 1KI1A 1LTQA 2WWFA 2H1RA 2PGIA 4M1MA 3M6MD 4KQIA 1F51E 1BQEA 1SVMA 4ZAGA 2EP7A 2J9YB 3IP1A 3LPNA 3UT6A 2EKBA 3WWEA 1W73A 3SAJA 3RAGA 2NTYC 3Q10A 3UT0A 1JDZA 3M4JA 3F5DA 3WLKX 2VHZA 3I76A 4A0GA 3VNVA 4PLCA 3LDFA 4PQRA 2I71A 2QVLA 3GH3A 4WLFA 3ZZTA 1GGFA 5JV5A 4FFMA 1AU9A 1FP4B 3AIKA 2FYTA 4N6OA 4WFJA 1RM3A 1EFCA 4LA4A 5F77A 5J58A 3VH3A 2GPSA 2OMKA 2I9KA 1NBWB 3MW8A 4FT2A 3AVUA 1BJRE 1P8JA 4HRXA 3AIOA 3W7VA 1XN4A 1KO1A 4AJOA 2PL5A 2A5GA 5AW5A 1TAGA 2I4MA 4LJ9A 1DJLA 5IM5A 1IM8A 5JXJA 1ZXLA 2XHEA 1YVUA 3PNOA 2QSJA 2C2XA 3PITA 3UFBA 1UEIA 2X13A 2XPCA 4MLCA 3WK4A 4TVSA 4Z2YA 2XCOA 3K2BA 3DF9A 3OKFA 1QO9A 1Q12A 5EMNA 1YZKA 4L16A 5K6RA 3JVDA 5LXTA 1XMOB 3SZGA 1HEYA 1XI2A 4GW3A 1V5GA 5B3JC 4YJKA 2E48A 2J07A 2JGKA 1C8BA 4J94A 1F9AA 2BHSA 1V11A 2RBKA 5G41A 4E2YA 2WM2A 2DERA 1QUFA 2WB4A 1UK7A 5KX5F 1L7QA 2E3JA 2O7QA 3M4NA 1U02A 1CG6A 1MRNA 5SZIA 3T06B 5EHZA 1F8GA 2OGWA 1W5SA 3UXEA 1X7ZA 1A9PA 1A4RA 5IMBA 1UZMA 2XSZD 2J41A 1WCWA 5KU1A 2JAOA 3BDVA 3ZUGA 3PCRB 1UZAA 2GGSA 1NVWQ 1WCXA 3HJAA 3OT1B 5L7YA 5BR8B 1ZEMA 2AHOA 3WGGA 1U2PA 1S2NA 2ZDQA 3K9GA 3NDIA 4WA8A 3ELWA 2M6KA 4CKXA 1A4XA 2B30A 3BDIA 2D7CA 4JQZA 4UAJA 1J97A 4BGDA 1WTAA 2ERYA 3DAPA 1CCWA 3IUEA 5E3IA 5EPEA 4XCXA 4A16A 4O4JF 4EJSA 1Y6GA 1QRDA 3DWEX 2BTQA 3H7IA 5F1PA 3FPJA 2WFMA 1GGVA 2PBLA 3EPPA 4RY0A 4F7WA 5IDWA 1NUHA 5DK4A 4RD3A 4HJRA 3KXPA 2DT8A 1P1FA 3SQDA 3VO1A 4U6SA 3ZWXA 4A0HA 4BNGA 2XTZA 3U4IA 1F0PA 4U1RA 2WSMA 4Y2TA 1DV2A 1ZJZA 1JZQA 4BX2A 4DMRA 2PEYA 4GSKA 4JYCA 5C8XA 4AUEA 4CDMA 3L93A 1YOBA 1NBME 3CEMA 2QZ9A 1NP3A 3TMKA 2NYAA 1D04A 1XO1A 2HC9A 2HIMA 3HADA 4FSXA 4RD0A 2H4YA 1AM4D 2A9OA 1U3DA 2XADA 3FWHA 3G6KA 4KFRA 1HTWA 1JHOA 2ZTUA 3LOUA 4XGKA 4PSUA 2PRIA 4NOLA 4XRGA 5AI4A 3VZBA 2W6IA 3D5TA 4AU1A 1KRXA 4ZDKA 5KYYA 3TXXA 4XXHA 4N1AA 4NCHA 1KNXA 1GDHA 2VHEA 4AY3A 4ED9A 1L7DA 2AN3A 4HJXA 2NX2A 2IDJA 3T7RA 3FNBA 1CBUA 4FMBB 1OH7A 2XKAA 1NA5A 1VL2A 1MDBA 3WLJA 3IP5A 2GNAA 3O7MA 1K4YA 1G41A 1GRQA 4M8NE 1XMSA 4XB1A 3KDPA 3TQTA 5IDQA 1P81A 2FR8C 4L8LA 1XROA 4HUQB 3E7DA 4JELA 3TJMA 4IO0A 2BZSA 3PSAA 2G9QA 1NG9A 2EL9A 4G0VA 5JY6A 4C2AA 1I2AA 3DE4X 4X62B 2CXUA 1AQUA 2BGNA 2NZ2A 4J6EA 2WINI 3PDJA 2VDUE 2Q0XA 2YV4A 4LJYA 2LIVA 4AZ0B 2ZWVA 3B52X 5HVNA 4GR4A 1YR2A 1GRVA 4C4ZA 1MAUA 2XECA 3H65A 4EGSA 1AMNA 4HEJA 4MS3A 1R4NB 5KTNA 3UFXA 5BMOA 2R7MA 2XTAA 3EQ8A 3LY7A 3NAGA 1QV9A 2AF3C 4K6CA 2HLNA 1D5CA 1T2NA 2PH1A 4R7TA 2C9MA 2EW8A 2FRDA 1X70A 2V3VA 2VZLA 3BICA 3NTQA 4YV7A 2WU1A 1HNWB 5IDYA 4LXGA 1R4NA 3CEPB 3CUWA 4TXLA 3SLKA 1WB6A 5ERXA 4CM8B 4C5BA 2O8VA 1DIRA 4KB5A 2AE2A 2C2OA 4OVKA 1AGPA 4HQ0A 4AULA 1ISHA 1YKFA 2AK2A 4ZT5A 2FZWA 2ZROA 3GGJA 5TMDA 3AB7A 4BRUA 1J1UA 4UZEA 4RETA 1X80B 3NC0C 4W4TA 4X93A 1ECPA 3I37X 4XW2A 1QX4A 4Q1EA 2ZYUX 1TLFA 3FDZA 3H17A 3HACA 2F3TA 3RU2A 4JDUA 4KHZA 3PP8A 4WI1A 1SVSA 1HG1A 1ZNQO 3PNVA 4YP1A 3TKAA 3D7MA 1CY4A 5JBNA 3B78A 4HFRA 1HDRA 1A98A 5AOAA 5HUJA 3X2FA 3CVOA 3HP1A 4WZAE 4DY4A 3SZMA 3AM4A 3RB8A 3SPXA 3TDNA 2CN1A 1J2TA 2FRXA 2JBWA 2D5IA 3DUFA 5I5GA 4DSOA 1FFDA 2GWHA 1WHTA 2QNIA 3GXBA 3RV3A 4B35A 1RMTA 1E3DA 3L41A 3A7DA 1ZN2A 3GD7A 4BMCA 1X9IA 1EP1B 1YOVA 4NICA 1L7OA 3RKSA 3GLRA 2DPLA 4AZSA 4BWVA 3N0VA 4ZCIA 1RXVA 1CETA 3KUKA 1GTG1 1ZW1A 2VRBA 1HZZC 3A6JA 4M1EA 4EPYA 5HP4A 3AKDA 1OKKA 2O1XA 1DWQA 1JXQA 1CUZA 2VJOA 3PVZA 1RXWA 1M1XB 3KQQA 2TMYA 4Q19A 2GXUA 3SMQA 1Z2NX 1UMBB 4MGYR 2WKPA 5HM6A 1OCEA 1ZUD1 4JOBA 1XMJA 2EVWX 3AETB 3EXHC 2J33A 3DEJA 5ALUA 1NBAA 2VYNA 3PQ8A 4ENVA 3WYBA 1ZD1A 5G1PA 1WY7A 5DNUA 3W0LB 4JLKA 1V4NA 3G8CA 2PL1A 2AEMA 4N7RA 2VEDA 4U2BA 3VBCA 1IQPA 4BVHA 2XIQA 5HE8A 1PYDA 2WG1A 2B9VA 2C1ZA 1J9ZA 1HORA 1CR0A 1RMQA 2HK9A 3IXQA 2BTOA 2CXTA 1GZSA 4FKBA 5BUSA 4DV4B 4YJ2B 4O2RA 3C3YA 4F3CA 3IIEA 4QU9A 5C8DA 2A1UA 1MC8A 1QIFA 3CISA 1LDYA 1GAQA 5CB6A 1IJFA 2VIIA 3CLUD 5ALPA 1D07A 2YV1A 1IN6A 3PPXA 3VAZA 3IQFA 5CGZA 4WKPA 4K9QA 1OXKB 4F97A 4IYRA 1GQ2A 5KYWA 2A5LA 3SHTA 4E7PA 4HEQA 3LWZA 4OQLA 3O6VA 1UXIA 3VO8A 1CHNA 3L77A 4FFVA 1HL7A 1Q0ZA 3T7IA 1YRHA 3D3KA 3L7CA 2N42A 3FY4A 4DVGA 2QX6A 4PCVA 5FTMA 5C4GB 1UBLS 3CX7A 3DKRA 4V0RA 2NOAA 4YROA 1ZR4A 4FIDA 1VYUA 3P32A 5TVGA 2P41A 3ROEA 5ICMA 4P7KA 3MELA 2WUWE 1LXCA 1LDGA 3REQA 3HJTA 3RNLA 3SBDA 1SHTX 5EP3A 4BB6A 4ZKDA 2B9EA 4TRRA 1BE0A 3WAJA 4N49A 2VP4A 3QFHA 3MD9A 4AMUA 4ZCMA 4GZMA 2UYHA 1ZJWA 1C9DB 2AXPA 2C2BA 2DPMA 3K4QA 1RZ3A 3R41A 4WK4B 5F3RA 1WB5A 5P21A 1KE2A 4POOA 4EKIA 1O94D 2O0KA 4UQLA 4E3WA 3EPJA 3CUKA 1VZ2A 2FPPA 3A1UA 1YDMA 3K9BA 4EY3A 5LDDC 4LXUA 3DWFA 1GM5A 3DOIA 4ZU1X 3RHTA 1RJ9A 4F9GA 4G5GA 3TMAA 1AV6A 2XI4A 1YVPA 1IHDA 2BAGA 3CLRD 1NSYA 2AE1A 5LOVF 2IHTA 1ZI8A 2VDPB 1OV6A 1AKQA 2HPZA 4FFWA 3DE6X 1A9RA 3NOVA 3NG1A 1QTIA 3LPDA 4G01B 2M6RA 1S8FA 5D8DA 2D5LA 5AP9A 5HIMA 4ZCTA 3UJ3X 4N39A 2PXCA 3S1AA 1ND5A 1AF7A 4RNCA 2OXTA 4UOEA 5IJWA 4Z0TA 3SHVA 1IZ8A 1NMEA 2QE7D 1Z5PA 3IVXA 2Q9AA 2QYTA 3F4BA 4PO3X 4L4RA 1NRXA 1GTZA 4HWPA 3KOWA 4JQOA 1PGPA 2GBCA 4XTRA 3TEMA 2G63A 3TCNA 3V00A 4CT0A 5KTOA 2O2IA 4LWOA 2YKGA 4KV7A 3AEXA 5IG2A 3DDWA 1SUCA 2KX7A 2O7RA 3VI4B 1ZCZA 2WTNA 3HLTA 2V9PA 1ISGA 1SKMA 4WXYB 1K7XB 4EJ6A 2YL2A 3BWMA 3I4CA 3IOYA 4HWKA 1XSEA 5AK3A 1E89A 3LFUA 1PFVA 4Q18A 1QU3A 4CM4B 3K1YA 2WOJA 1W4CA 5EQFA 2HRBA 2FCAA 1ORWA 3EYWA 3HFJA 3HSSA 3LH5A 5CNKA 3PT9A 4AS3A 5KWVA 2K87A 3WIEA 3FWYA 1X1CA 2DQ4A 3IOMA 2JPDA 4ZOAA 1XPUA 3SJUA 1UBTS 3ASZA 2AFRA 5GVRA 3K0CA 1C8LA 2ZUFA 4PLFA 2EKQA 1H4VB 2POCA 3E3MA 3RGGA 1FFEA 2AXQA 5E3JA 2C9BA 2QDKA 4JZYA 2V6BA 4EYKA 4F9TA 3R9KA 4FMCF 1VLMA 5DSTA 5K8CA 4DYVA 1PD1A 1VSVA 2WLTA 1P4JA 4KE7A 4YXWA 3WRXC 5AESA 3K71B 2UZ3A 2E4VA 5H3HA 3P52A 4IOJA 3VZSA 5HR5A 3KL2A 2IHKA 1LZKA 4YRLA 2F8TA 4Z7JA 2IY7A 5FJJA 1KDZA 3T5TA 5I5EA 3CZ4A 2WW8A 4QFDA 4Q5IA 4MLZA 4MP6A 1ZD4A 3HDYA 3CRNA 3B8EA 3A1TA 4E15A 1I2BA 2ZPTX 4F21A 4Z4HA 1QR2A 5E7JA 1Z47A 5ICGA 3OM1A 1QAMA 3ANYB 1NOJA 4LJ5A 5EOVA 4O1MA 4RHYA 5K3DA 2ZUUA 3VFDA 1JHZA 3AGQA 1O96A 1P0PA 2D0DA 5JD5A 2C7QA 1N0UA 3RRXA 4N40A 3IRUA 3QEMB 2WHQA 4TX1A 4LJ7A 4MTLA 3WX0A 4CR7A 3CRW1 3DVAB 4KGZA 2ERXA 2JFVA 4URXR 1DBWA 1D1PA 2VJBA 1DAIA 5LDHA 2OD2A 2QRJA 1E96A 1E77A 1T5IA 4L9RA 4CM9D 3AM5A 1Q1NA 3WGJA 5ISMA 2MSLA 4ATNA 5K8VA 2QZPA 3ME5A 3SVZA 2JI7A 1G2IA 4JVMA 3ED5A 3LYUA 2OZKA 3P5BA 4IIJA 4PSVA 1MB4A 3KX2A 3UO8B 3M7IA 2J3EA 3I8XA 1BHJA 2JW5A 3GVCA 3L82B 2FCRA 2W48A 4W5QA 2WWGA 3FOZA 2F4VB 3B3AA 3BXEA 2IYTA 3EOBI 3FCEA 4WASA 4XWYA 2QNRA 5JY1A 2VQDA 1X39A 3VGPA 2ZE7A 3FFWA 2VZ9A 3C6XA 4P4SA 2EV9A 1ELOA 2FSFA 3OAAA 4X5OA 3L0YA 1F2TA 4WHMA 3HYRA 3KQLA 4QRIA 2JEYA 1LD3A 3RS7A 4R3NA 3F96A 2FUEA 2V8OA 5CT5A 4A6DA 5BRAA 4EMBA 1MZPA 1D6SA 2DUNA 5G0SA 1CYEA 2CMHA 1QWSA 2RH9B 1YR3A 2EQ5A 3RS4A 3U1TA 3TDKA 3V1LA 1BXGB 2JI9A 3IAUA 3AOEA 5JSKA 1J56A 4ZREA 2QD2A 4GFDA 4MEBA 5JROA 2LWIA 3WDSA 3QTLA 1II0A 2JAPA 3PFFA 2RKBA 4RZHA 3QU4A 3ZX4A 3EA4A 2W98A 2QT0A 3BH0A 3ELBA 3MB8A 2R66A 5DM4A 1L9KA 4D6PA 2XRZA 2C4TA 2YXNA 3DEZA 3CLHA 2W2XA 3V46A 5J3JA 4D82A 1EFLA 1UZUA 1T5BA 4RLSA 1E4EB 3AV0B 5AKYA 1GL6A 4IIXA 4B81A 1U0EA 1FMCA 3TSWA 1M2VA 5ALWA 3L0OA 2ZWPA 1BD3A 5CFRA 1PGQA 4MCAA 2TECE 1H0SA 2HLHA 2RHOA 3SCZA 2DXIA 3T0IA 1C1XB 2IOQA 4UM9D 4LF8B 2R47A 4V2UA 4D8YA 4OD0A 3W5SA 1WSAA 2EWMA 2YHIA 4CXMA 1PR3A 2ZAMA 4AIIA 1ZNXA 5C5EA 3G5TA 1H6BA 2W0SA 3R8XA 4Z9FA 5CFNA 5JNUA 1SU8A 1PRYA 3EHDA 5LQMA 3A31A 1FDSA 3DZIA 2JHPA 4G1EB 4RZ2A 1MT0A 1KWGA 4KAAA 4Q12A 3LP8A 2VSQA 1D1SA 8MHTA 4WNYA 3NCTA 2OWDA 3A6GA 2QD4A 1M66A 3G6WA 2A7XA 1IZYA 2GZ2A 3IURA 4JL6A 2B25A 4D9JA 4F3NA 5ELXA 4AG5A 5KZMB 3QYFA 1WKCA 3M6VA 1XD8A 5E4JA 3ADBA 5IANA 3UHPA 3UMMA 1YZ3A 2FPSA 1ENYA 1JHDA 3I1JA 3Q7PA 3IAS1 4ZALA 5F7ZA 3LM8A 4KJXA 1NM5A 4P3XA 3L6CA 1DIOB 4Z4QA 3LVBA 4ZT4A 4HATA 5JAOA 3DV0A 3OZVA 1A8SA 3LCVB 3R8FA 4YAWA 4RANA 4M83A 4TZ6A 4PHFA 3B5EA 1ECGA 2GETA 3QXHA 4PSKA 4KOAA 3JAMA 1PJLA 3IQZA 2PCLA 1N75A 1UK6A 2PX6A 3D7LA 5HIIA 2IYQA 3WLNA 2P4QA 3ZI4A 4R16A 4IUYA 2ON6A 4C14A 1F6BA 2P40A 5IT4A 2NT3A 2QNBA 2CVOA 3ANNA 3JY6A 1ZHHA 1U11A 1ZAKA 2BF4A 2VWQA 2WWIA 3AOEC 3TQCA 3STYA 2O3UA 2YMLA 2E5LB 1NU6A 3KSMA 3F1KA 1ZA2A 5FA5A 3JV7A 1E2BA 2VJLA 5K0JA 2R1TA 3CLRC 1PJ2A 5E6RB 4B9EA 1X77A 1Z8HA 3E22B 2R44A 1H42A 1N8SA 1Q20A 3MB5A 3NATA 4HR7A 4N5HX 3G1UA 4FW8A 4DRYA 5FBQB 4DNQA 1XQ6A 4G89A 1FTGA 2IXFA 3T1HB 3AV3A 4BC1A 5DK6A 3RS3A 3KT0A 4OHKA 2XGGA 1MO6A 3VZCA 3EVTA 3IUPA 3QV2A 3WGHA 3ZGZA 2I8CA 2I87A 1AC5A 1KQPA 4CFZA 2XMCA 4YDHB 2YXBA 1P1HA 1I3NA 2GTPA 4KQHA 4UPEA 1S01A 3QKSA 4WOPA 5IDXA 2CV2A 2FN4A 2IS2A 2YS7A 1UM9B 4U0KA 5JADA 5TS2A 2IJGX 5KYXB 4ILEA 2QM0A 4BP9A 1NLZA 4DBZA 5KNDD 2F67A 5GONF 3R7LA 2ZJ6A 3TRDA 2G8NA 3O8LA 3L84A 3ZXUB 1RD4A 5ALQA 1V41E 2OCAA 4M9ZA 1QB7A 2CJFA 5A71A 4N6NA 4HDAA 4EAAA 4ENRA 2HDOA 1JJBA 1YRWA 3R77A 1BW9B 1P9WA 5FUVA 2YWGA 3D8UA 1PWHA 4UASA 5FYDA 2OCGA 3KYDA 3OE7A 1T0PA 2R5WA 2W6JA 3DKPA 4WOCA 9ABPA 3GRZA 2VPQA 2J32A 5KSPA 1DC6A 2XQIA 3OCVA 1FJHA 4GPTA 1NUAA 4IQ4A 5HJ2A 1KC3A 1UBNA 5DHSA 2NYUA 2EHDA 3G9UA 1X1BA 3LIIA 1Y7IA 2V58A 2AG6A 1KTVA 3EGXA 3W8NA 1KZYC 1KC1A 1NX6A 1V8FA 3AESB 4S1PA 3Q0IA 1GU7A 1WW8A 4RQUA 5EC8A 2D13A 1JSCA 2B4TO 5I9MA 1MH9A 3FBGA 1IXSB 4DR5B 2H11A 3FVVA 1IULA 4Z4GA 3S8MA 2UUBB 3T4XA 2D1YA 3GX1A 3OF5A 4XIGS 1GYPA 4HD8A 3R7NA 4F8EA 2WFLA 4XYLA 1Q3KA 2XZOA 2OFPA 4HDNA 3E1GA 5LB4A 1ZGJA 2I8AA 2GLTA 3O8CA 3HJUA 3T1YB 4P4SB 1JIXA 3EXHB 3QXXA 3A28A 4B84A 1K0UA 1NPDA 3I58A 1QRTA 1ATZA 1NLYA 1RM5A 1Q77A 4QBFA 2Q1WA 2YDXA 3GI1A 5EZ5A 1O6ZA 2C84A 4IJ6A 4QGAA 3LXMA 5I4IA 2AC2A 3ICWA 4E3ZA 2IZ7A 4R3UC 4S12A 2VG8A 2J3QA 2ATXA 2YJ6A 4FGUA 4MVJG 5DBIA 3T7TA 1IUPA 4G1FA 2BR3A 1U0FA 4LYHA 3ZD6A 3EIXA 4CLRB 1CYDA 1E5XA 3L1IA 3OOEA 1PK8A 3M5DA 2VUHB 3PE6A 1M8PA 3G2HA 3LT0A 4NMWA 1QIMA 3JRNA 4ZFNA 4UQPA 2DR2A 4URFA 4MW2A 4LF7B 3VPAA 1T9HA 1F0NA 2X0FA 4BIMA 3DUFB 4GEGA 2QUHA 2ZU6A 1W36C 3GOHA 4DTCA 4H7EA 3K8QA 1OT5A 1RR6A 2JCBA 2OXIA 3TN7A 2ID9A 2WV9A 5ALEA 2H6EA 3QUBA 5LLDA 3K0KA 3SJ7A 3KVNA 4WGFA 1N7IA 5H1YA 3IXLA 1ZK2A 3C3MA 1SBYA 4