1KEVA

Structure of nadp-dependent alcohol dehydrogenase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
351
structure length
351
Chain Sequence
MKGFAMLGINKLGWIEKERPVAGSYDAIVRPLAVSPCTSDIHTVFEGALGDRKNMILGHEAVGEVVEVGSEVKDFKPGDRVIVPCTTPDWRSLEVQAGFQQHSNGMLAGWKFSNFKDGVFGEYFHVNDADMNLAILPKDMPLENAVMITDMMTTGFHGAELADIQMGSSVVVIGIGAVGLMGIAGAKLRGAGRIIGVGSRPICVEAAKFYGATDILNYKNGHIVDQVMKLTNGKGVDRVIMAGGGSETLSQAVSMVKPGGIISNINYHGSGDALLIPRVEWGCGMAHKTIKGGLCPGGRLRAEMLRDMVVYNRVDLSKLVTHVYHGFDHIEEALLLMKDKPKDLIKAVVIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADP-DEPENDENT ALCOHOL DEHYDROGENASE
publication title Crystalline alcohol dehydrogenases from the mesophilic bacterium Clostridium beijerinckii and the thermophilic bacterium Thermoanaerobium brockii: preparation, characterization and molecular symmetry.
pubmed doi rcsb
source organism Clostridium beijerinckii
molecule tags Oxidoreductase
total genus 110
structure length 351
sequence length 351
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 1996-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1kevA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1kevA01
1CRWG 5DNAA 5F1OA 1NQAO 5CFZA 5JMWA 3NDIA 1Z82A 4FSHA 4L8VA 2AA3A 5ICSA 3WTCA 1R0LA 1BHSA 3BXXA 1MC4A 5BSFA 1P44A 1GQQA 4L0QA 5KKCA 3TZ6A 4BO4A 2ZB7A 4MVJE 2GLXA 5LDHA 4MPDA 4IQ8A 5HRUA 2I3AA 1P1IA 1E1MA 1JQBA 4J4HA 4UVGA 3DOCA 4RO0A 1NQ5A 5L9AA 3K96A 1DFIA 1GQYA 3DTYA 4O63O 1LXCA 4OH1A 4E30A 1E77A 3PDUA 3TPCA 2CZCA 1PJQA 4QTZA 4EJ6A 2FPGA 4TRNA 1XYGA 4RGBA 4EEXA 4J43A 4AJLA 1HF3A 2Q1UA 2OUIA 3JD4A 3WBFA 5TX7A 3PXXA 3EVNA 2P2SA 4I9UA 6ADHA 2QYSA 1EDOA 3ABIA 1Z7BA 3RBXA 5L40A 3T7EA 1GADO 1E3WB 3L4BC 1HE4A 3OMLA 5JS6A 1LRJA 2DT5A 2EIHA 4M89A 3GZNB 4WECA 3OEWA 1EDZA 1P74A 4R51A 4ND4A 3QVWA 4BB5A 5ADHA 2PGJA 3VVCA 3QE3A 5EMHA 1N2SA 2BFMA 2FSVA 1M6HA 1WLYA 4R1UA 3RCBA 3LC2O 1TVEA 5DBGA 1E92A 1XELA 2ILTA 3OJ0A 1PJTA 4OAQA 5BSHA 4NJMA 3RFTA 2OFPA 2VUTA 2X5OA 1YL5A 3Q1LA 1SC6A 1SNYA 2OGUA 1XWFA 2X58A 2DLDA 1LRLA 2G76A 2WD7A 4CUKA 1PJBA 5ENDA 5KJCA 3NDJA 5DCWA 1J6UA 3ZWPA 4LMPA 3FTNA 3RVDA 2NV6A 4DL9A 3WYCA 3I4CA 1RM4A 4E6PA 1EBFA 3A9WA 1IHXA 1EQ2A 3KVOA 3VTZA 3G17A 6LDHA 2X6TA 2NSDA 5G0TA 4JN6B 3ZWOA 1N9GA 4XD2A 4CJXA 1KC3A 1K2WA 1O89A 1R6DA 3EC7A 5JE8A 1KIFA 4XJTA 1B15A 3I9MA 3NT5A 2IXBA 3ASVA 2P68A 3BHMA 3WWYA 4RVDA 1IE3A 3ICPA 5L53A 3QW2A 3ANNA 4NH4A 5CDTA 4GQAA 1Q7CA 4IDDA 3P19A 3GLQA 4W9NA 2WM3A 1BDBA 4DLLA 2JJYA 4J2HA 1BDMA 2DTEA 3RKUA 3WYBA 3PYMA 1LSOA 3HZZA 4BNYA 4YA6A 5K6AC 2ZYGA 4CM6A 1DJNA 2GN8A 2VYND 5CEFA 3I9NA 5T6BA 1J5PA 1EUZA 4TQGA 4XQEA 4K26A 2V6BA 3MJ4A 1F0YA 3CUKA 5IAAA 4EUFA 4FC7A 3A1NA 3AU9A 1PZHA 1QYVA 3NGLA 1LLDA 2WE8A 1I3NA 4OM8A 3WGZA 2LDXA 3IQDB 4YJHB 4WEQA 1B8PA 2Q1WA 1VE9A 2H6EA 4PZEA 4KWHA 4O1MA 1T4DA 3K6JA 1E1KA 1MLDA 3B1JA 4O6VA 3GPDG 1EZ4A 1E6EA 3TJRA 4XQCA 4BO5A 2YW9A 3JQDA 3JD0A 3O03A 1GCOA 4OXKA 1RM5A 1MX3A 3WQQA 4DPMA 4BNNA 5U4QA 2DQ4A 2FZEA 1DAPA 3EDMA 4BO6A 2C2YA 3JYPA 3R1IA 4QFDA 4GPD1 3UHAA 1SO8A 4D3FA 4OQZA 1YDWA 1P1HA 2VZ9A 3D0OA 3JQCA 2WEKA 2W90A 4KUHA 1PJLA 3ENNA 2X0IA 1U7TA 2HK9A 1I10A 2YY7A 3I3OA 1EE9A 3ZWBA 3GH3A 1EUDA 4PCVA 3ZV6A 1K6XA 1Q7BA 2IEBA 4GSLA 2P9GA 3GVIA 4ND1A 2ZB3A 3DMYA 4KUEA 2I65A 3GR6A 1E6WA 4RVHA 1ENYA 3OFSA 3SX2A 1Y5RA 4ND2A 3K9QO 5A03A 2YQ5A 3M6IA 4R3NA 4U6SA 3MOGA 4TRMA 1I2CA 4FFOA 4Q39A 5IDXA 3NDRA 3E48A 3EYWA 2DUUA 2WMDA 2RCYA 4NU6A 3Q9NA 4XWYA 2POQX 2ZYDA 5ER9A 3WSWA 2HMSA 4S1VA 1EUCA 5DDIP 3TZKA 1F17A 2C7GA 3JD1A 3SC4A 3HFSA 2QX7A 2ET6A 3F46A 3H4VA 1N8KA 2CNBA 1Q0QA 3QY9A 1SCUA 2Y0EA 4TZTA 3MWEB 1PWZA 3BMQA 4YRBA 4R1NA 1VRWA 1IHYA 2FPIA 4G2NA 5F5LA 1ADCA 3FR7A 3OETA 4G65A 1C1XB 3S1LA 2DC1A 5ER6A 2DBZA 4NFYA 3ZZNA 4YACA 1LUAA 4EDFA 5KOIA 1ZH8A 3JQFA 4HNHA 4IDEA 2J3IA 4R1SA 5T8KC 1WW8A 2PH5A 2Y05A 2VYVD 2H63A 3ROMA 1GZ3A 4WNCA 1HZJA 1X7GA 3ZWMA 1I3LA 3RBZA 4ZJUA 3ZW9A 1VL6A 1N7GA 3KRTA 2Y1FA 4HFJA 4YBZA 2BHLA 1P45A 1HXHA 1E1LA 3ZHZA 4ZQFA 2VHVA 4M86A 1OI7A 3U62A 3VH1A 1NVMB 5TT0A 3WTBA 3ZCXA 1ZK1A 2LDBA 3AY3A 1K3TA 5COQA 1O9BA 1V3TA 2WE7A 4MVJI 4J6FA 2Q49A 2OBNA 4EBFA 4Q3EA 3Q0EA 1ZSVA 4EJ0A 4RDIA 4L4XA 4J49A 1ZBQA 3A4VA 1PZGA 2O3RA 1T2FA 2GUGA 4I1IA 3F4LA 3H8VA 3K8ZA 1E3IA 2PV7A 2W2LD 4II3A 1GV0A 1AUPA 4YT5A 1CQIA 3TZHA 1NAIA 4BNWA 4CMEA 3H9GA 1E3JA 3NT2A 2P4QA 1NWCA 2YHIB 2O3TA 3AOGA 3RU9A 2QZ9A 1NFRA 2JHGA 4CMBA 3PWSA 5JCJA 3NTOA 1LDYA 1UXJA 1MXFA 1YO6A 3GGOA 2V7PA 1E7YA 3INRA 4E0BA 4YCAA 5IN4A 3DZJA 4D46A 4D79A 1FDTA 2NM0A 2R00C 3I52A 3LC7O 1UP6A 1PGQA 3JYNA 1PJ2A 3C1OA 4CM9A 3ANLA 2C0CA 4CV0A 1GY8A 1E3WA 3HDYA 5L7WA 3BYZA 4IGFA 2BI7A 2GERA 3GZNA 4PG5A 1XDWA 3DXFA 5DP1A 4HP8A 4N7RA 3WLFA 3B70A 3IOYA 1PGPA 3C85A 4YT2A 1UAGA 3VH2A 3T4XA 5JDCC 2O7SA 3WGIA 2GYYA 3I6IA 3MWDB 3EMKA 1YB5A 3GUCA 1CDOA 1GZ4A 1XIVA 3ONDA 2I76A 4FGSA 3DAPA 3T7CA 2WDZA 2A4KA 2VZ8A 3R0IA 4EEZA 3WYEA 3GNSA 1VLLA 4XCVA 4CMAA 5IDQA 4UUOA 3TZQA 5COBA 3SLGA 3PHJA 4JNKA 4L9RA 4XR9A 5H83A 1ZMTA 4E3ZA 3I5MA 5JBIA 2HMTA 1HZZA 3W8DA 1PQUA 3BMCB 1KVSA 1D7OA 1K6IA 5F1PA 1YBVA 4M49A 1QYWA 5BNIA 2Z5LA 1T25A 3RROA 1CJCA 1WWKA 5ITVA 3QWAA 4HWKA 1ZMOA 1RWBA 3GVHA 1UR5A 1O5IA 3X2EA 3IDSA 1UDCA 3DBLB 4IJUA 3JQ7B 3JQGA 3SVTA 4DQUA 2OXIA 1ZK2A 4RVUA 4W6ZA 4PZDA 3AJRA 4NBWA 3V5NA 1I0ZA 3RUFA 2P91A 4EUEA 1HSZA 4ZRNA 1T4BA 4U0JA 1YOVB 4CMGA 3ZV4A 3ZH2A 1KVRA 3TN7A 2CSUA 4YT4A 2NVBA 4RF5A 1TLTA 4KTTE 4E5KA 3PLRA 2VUSA 2HO5A 3LT0A 1GUYA 3AI2A 1P0CA 4Q9NA 4TKMA 3GZ4A 4GMFA 2GNAA 3V1TC 5IZ4A 1RPNA 3V1UA 4GX0A 3RWBA 1QORA 4IDAA 5HS4A 4ZGWA 1A4IA 1CWUA 1U3TA 4WPGA 4XDZA 4U6QA 4B3IA 2OZPA 1PR9A 5TT1A 4WLUA 1CEQA 3TF5A 2G5CA 3DAGA 4OO3A 4DREA 4CLRB 3EGOA 4WCFC 1F8GA 3PIIA 4KZPA 4CPDA 4GVXA 2EKQA 2CVQA 2E82A 2O4UX 3GN2A 4AJ4A 5FEUA 3TFOA 4YJHA 1FDWA 3F1KA 4A73A 2IYPA 1T2DA 4F45A 2W4QA 1DB3A 1I3MA 1PQPA 1WVGA 4IDBA 4MKRA 3AW9A 4MVJF 4NJMB 3ZWVA 1RKXA 3D7LA 5TLSA 3HHPA 4GX5A 1XU7A 4QT0A 4UVHA 4GL4A 3ASUA 1PGJA 4BO9A 3OBBA 4ZVVA 1T2CA 4U5QA 1DHTA 1Q0HA 3WIDA 4TWRA 1D1TA 4CMHA 1ID1A 2QRKA 1TT5B 4LCEA 1DXYA 3RBVA 1M76A 5JNLA 5A9RA 5CG2A 2RH4A 3BMNB 5TNXA 1O0SA 2C07A 1GZ6A 1GV1A 2BKAA 1ZK4A 5F21A 1Y8QB 3HDHA 3RI3A 5KVCA 3ANMA 1ISMA 4R1TA 4IINA 4LSWA 4R69A 4PFJA 1H2BA 1YKFA 1IPEA 1MFPA 1SEPA 3JQAD 1BGVA 3WQRA 2ZKLA 3I1JA 1OAAA 2FWMX 3KHUA 1E7SA 1Z74A 2WYWA 2WJPA 3D1LA 5KVQA 5G0UA 3FRJA 3NT4A 1EVZA 3KYDB 5GMOA 4BNKA 4RF3A 3LZ6A 4B3HA 4J9UE 3FTPA 3D4OA 1DRVA 4GI2A 1A9ZA 3H5RA 3QV1A 1W6UA 1YDEA 3PWKA 1E0DA 3JQ9A 3DMTA 2GR9A 4C4OA 3HADA 1Q0LA 2B0JA 4BNUA 1Y5MA 3DTTA 4IBOA 1A71A 1P33A 4J3FA 5JCXA 3JSAA 2X0JA 4HX5A 3UW3A 4BNVA 4NMHA 3BMOB 2JCYA 4A7PA 4RF2A 1CETA 3DONA 1RYEA 1BG6A 4DRYA 1RM3A 4L76A 4BOYA 1ADGA 1PL7A 2HMWA 3GF4A 2HRZA 3KB6A 5EQDA 4MVJM 1DO8A 3CEAA 3H3FA 3KSZO 2UAGA 1LDNA 4WLOA 2BRUA 4FJ2A 1DIRA 1R4MB 4IS2A 3WGGA 5KJFA 1C1XA 2I6TA 4AJKA 4JGBA 4NK5A 4EYEA 1R37A 4KUGA 4E5MA 4WOJA 1A27A 3E82A 4J4TA 4R9SA 2V6FA 3I83A 4RL6A 4RZIA 2GN4A 3DZIA 3PHHA 3PTZA 2GGSA 1KS9A 2BGMA 4IDGA 3PLNA 5A9SB 4RVFA 3GQVA 3DQPA 4GKVA 1GR0A 3GAFA 4R5MA 4E5PA 5KJEA 2UV8A 5AXDA 1Z7EA 3BTSA 2O23A 4BGVA 1I30A 2PH3A 4D7AA 1EBUA 4CLHA 4JP2A 4HY3A 4PVCA 3GGGA 2QRLA 1LSJA 2HAEA 3C3XA 3E9QA 1E3EA 1WP4A 2QIOA 2VOEA 4K6CA 3CMCO 4GLOA 4BHTA 5B1YA 3H2SA 4IXTA 1PJSA 4CUJA 4ND5A 4BKOA 4IM7A 5I8ZA 3FSRA 2NU6A 4FFPA 3H65A 3ONFA 3H9JA 1GEEA 2WTBA 3BTOA 4FJ0A 1QSGA 1YB1A 4GH5A 3VPGA 3W4KA 8ADHA 1LEHA 1CERA 5DCUA 4OXNA 3UVEA 2JCXA 3DOOA 2VTEA 1UXGA 5A06A 3M2PA 4OXYA 2BELA 4YTEA 2C59A 1QLJA 3V2HA 3ZHXA 1AGNA 1H9AA 1GPJA 2AEJA 2E4AA 2P9EA 3W6ZA 4J2OA 2NU9A 2YHIA 1I5RA 2H5LA 1A5ZA 1B3RA 1R15A 2IZ1A 4PLPA 2X5JO 4URFA 4UEKA 5GY7A 2Y0DA 4GGOA 4MVJD 4PLFA 3WDSA 1Z6ZA 1ZSYA 3VVBA 1JWAB 3LT4A 3LF2A 5IF3A 3GC6A 1YS4A 1GQ2A 2NU7A 3HN7A 1NHWA 1WAMA 1TA4A 3JD2A 4TRJA 4F46A 1W8DA 4WE3A 4UVIA 3MZ0A 4U0KA 4K6FA 1C14A 2VYNA 2X9GA 2VOJA 3NTRA 3LU1A 1XHLA 1BVRA 3GPIA 3D5QA 4RPLA 1I8TA 4BL5A 2CY0A 1HETA 3WGYA 4B79A 3IS3A 4DUPA 1PX0A 4LCJA 3BTUA 2NVWA 2AE2A 4L74A 1LLUA 3JQFC 2DUWA 4IDCA 3OQ1A 3HN2A 5L4LA 3GRKA 1ZZEA 4DC0A 1NQTA 2TMDA 1Q1NA 2Q4EA 2J6IA 1A7AA 3BMCA 5AXAA 2OOSA 3DHEA 3AY7A 4XQGA 3EK2A 5EERA 4CMCA 1EVJA 2G1UA 1P1KA 2FR0A 1F12A 5BSGA 1G0NA 4ZQHA 2PGDA 3E9NA 3H6KA 5JAIA 1JKIA 2BF7A 3GA0A 4BGEA 4N5NA 5B12A 1KEVA 1LQUA 4HFNA 1V3UA 4F3YA 3DBLA 2VHWA 3UKOA 5A05A 2PY6A 2Y66A 3JQ7A 4CLOA 3K30A 1PWXA 1ISGA 1EVYA 5G4KB 1H94A 2CFCA 4NFHA 1KYQA 3RUAA 2E49A 2BLLA 1BWSA 3QWBA 3JQAB 1YOVA 4J1SA 4ALKA 3JD3A 1H6BA 4MP8A 3W4JA 3AOEA 4IS3A 3EZLA 3UH1A 1FJHA 3U4IA 3UCEA 3BHIA 3RC2A 4BO2A 3I9JA 2XXBA 5T64A 4UEOA 3LT1A 3NKLA 4ITUA 4CM8B 1KC1A 1NR7A 4WCDA 3G1TA 1NX6A 2Q99A 2ZATA 1X1TA 3NEPX 4IGEA 4Y6RA 3QVTA 1BXZA 1E7RA 3IJRA 3DEYX 4CLRA 1P77A 3OQ6A 5AVOA 3WGOA 1OMOA 2FZWA 4YAGA 4FFNA 1V6AA 4NFSA 2GRAA 2IXAA 2I99A 1EFKA 3BZUA 3DFUA 4LMRA 2ZTUA 3E18A 5BNFA 3DZGA 3QVOA 4FFLA 1V35A 1HE2A 2J3JA 1XEAA 4HUJA 4FJ1A 4ZQEA 3E8XA 4NHEA 1U3VA 1PS9A 3HWRA 2PTGA 4MKZA 2D4AA 3AM3A 1E5QA 4BNXA 2O2YA 2O3QA 4PG6A 4YQZA 5G4LA 1Y81A 4D0SA 1I36A 3LYLA 3GNTA 4KP7A 4FN4A 1TT5A 3IC5A 4YQYA 4BMNA 2NTJA 2VYVA 2Z95A 3KUXA 1NPDA 1YL6A 4JIGA 3BMNA 4ND3A 1UUFA 1NASA 3ZU3A 5JPIA 1Y8QA 1V3VA 2P5YA 3JQGB 3W8EA 3VPFA 2WD8A 5MGBA 1U8FO 4AL4A 3M1LA 5KNLA 4J7UA 1ZKMA 4OHUA 4EITA 2ZIZA 2EF1A 3F4BA 9LDTA 1GPDG 2HSDA 2VN8A 3DL2A 3HG7A 4CLEA 2PZJA 2D1YA 2Z1MA 3BIOA 4RF4A 4BKUA 3PI7A 4B8ZA 3RIHA 4CQMD 3GY0A 2XPCA 2W2KB 3KOUA 2Q1TA 1LTHR 2ZTVA 2ZJ1A 3KYDA 1F06A 4W99A 3DC2A 4TRRA 4AICA 5DF1A 1YQXA 3VZQA 1PJ4A 2ZQZA 3LDHA 4JBIA 1QLHA 1HDCA 1SB9A 4LVUA 1UXKA 4CMIB 3GDGA 5L4NA 3LF1A 3B1FA 1R66A 3S2IA 2W2LA 4JCOA 4NK4A 5I9NA 5BT9A 3BMOA 4RQUA 5CAEA 1AHIA 3GNQA 4HXYA 4XQ9A 1DEHA 4NG5A 3FNEA 4YDRA 5KJ6A 3BA1A 4RORA 3GFGA 1G0OA 1MB4A 1N1GA 4BMSA 3OA0A 4FCCA 3VKVA 3L4SO 5HM8A 1I01A 3MJCA 1HDXA 1ZJZA 1LA2A 2CD9A 1LDEA 1WMBA 1SMKA 4AG3A 3I9LA 1R4MA 1ZSNA 1YL7A 3HDJA 4GSKA 4PG4A 2V6MA 3KZVA 3H9QA 4MIEA 5JDIC 3R6DA 1LDBA 4RZHA 1ISJA 2O50A 2E6UX 4YPOA 1JN0A 4Y6PA 1NXQA 2AEFA 5A9SA 3H5AA 3U0BA 3IKVA 2EV9A 4CM7A 1X7HA 4KTVE 4QSMA 1WXDA 2YV2A 3IIEA 3C24A 1ZFNA 4A26A 4RLHA 2X0RA 3CMMA 3GOHA 4BB6A 4FDAA 3FN4A 5LDGA 4BMVA 1PTJA 4P8RA 2OP1A 4ZQBA 1PS0A 3U4CA 2HK7A 1E7QA 2I5PO 4XYMA 1ENPA 1B8VA 3FNFA 2DBQA 3WB9A 4JQCA 5LCXA 1FF9A 4HNGA 5I7SA 1X0XA 3QQPA 5HBRA 1IY8A 5GZ1A 2OBYA 3OJFA 3AY6A 1XGKA 2IYOA 3UN1A 1LX6A 3CZMA 1IL0A 3NX4A 5EESA 1K89A 2BFAA 2EWMA 1HTBA 3EVTA 4U8GA 3OSUA 3IUPA 1X14A 3FI9A 1DIBA 3TDKA 3MTGA 4PVDA 1YQDA 1B7GO 4WKGA 3ZWYA 3RFXA 5B37A 4ALJA 1CF2O 4EJMA 1DDOA 2DVMA 3GFBA 4CQLB 5C7IO 1MG0A 2PZMA 2VHYA 4AJ1A 3D5TA 5L45A 2DTXA 1VC2A 3CZRA 5DOZA 1R0SA 3AM5A 1GYRA 3WBBA 2VQ3A 3ZWNA 4PIVA 2DAPA 4I9HA 3F3SA 5F3RA 2DU8A 1ZEJA 3S8MA 1HLPA 2HQ1A 1U28A 1GDHA 3PJDA 4I5GA 1U9JA 1ZJYA 3FBGA 4R01A 2F1KA 3PZRA 1ORRA 5JMPA 1NFFA 4R4JA 3ROPA 4ROSA 4D3SA 4CMJA 2O3SA 1W0CA 2VNSA 1ISIA 1H9BA 1KEUA 4BKPA 1DLJA 3IP3A 1LC3A 4S3MA 4GBJA 4I5FA 2OL4A 3GK3A 1HYEA 2QYTA 3ONEA 3QP9A 4LRSB 1NBOA 2BGKA 3JQ6A 1A4UA 4OOFA 5TRTA 1HDYA 4YXFA 2I9PA 4QQRA 2NADA 2GD1O 1DC5A 4FC6A 4DXHA 5I7VA 3GDFA 8LDHA 5CDSA 2Q3EA 4FOOA 1HE5A 3ZHYA 4J16A 3VTFA 1KEPA 2J3KA 4WLVA 1DC4A 4Y98A 4GX2A 2D3TA 4AVYA 1B16A 4YEDA 3JYOA 5B4TA 2X86A 4AJPA 3FR8A 3GHYA 1O95A 3E6AA 4K1LA 3PHGA 3W1VA 2ZK7A 1X13A 3EY4A 3ZGYA 1VM6A 1DLIA 1PS8A 4JROA 4WNIA 3WGQA 2CVZA 4XB2A 4BS9A 4NU5A 3G49A 1UH5A 3A28A 3CSDA 3HE3A 3JV7A 5BSEA 2EGGA 3GG9A 3OM9A 4L75A 1JAYA 1JWBB 3Q3CA 3KEQA 4XB1A 4YVFA 3VZSA 4CV1A 2UDPA 4UUNA 5G4KA 4BUCA 1DOHA 3NUGA 3H3JA 1B2LA 1DRWA 1O6ZA 2BGLA 3JQAA 1HRDA 3CPSA 3DDNA 4QO8A 5TSDA 3D3WB 1LQTA 1HDRA 2JD0A 4BO1A 3NJ4A 1AHHA 1TT7A 4HFRA 4CQMB 4FB5A 2VWPA 3I6QA 4BO7A 4W7HA 2C29D 1FMCA 1Y1PA 4E4YA 4CM8A 1D3AA 5G0VA 5JSFA 3K2EA 1PQWA 2AG5A 4KWIA 4PG8A 2HK8A 5IXYA 3QVSA 5A4DA 3Q11A 3TQHA 1M75A 1ZCJA 1YRLA 2UUOA 2ZTMA 3QLJA 3L4BA 3S2EA 3DO5A 1F14A 1Y9EA 1E3LA 4FPXA 5JW6A 5CEJA 1PR3A 3D3EA 3TNLA 4AJHA 2HMUA 4YT8A 1TXGA 1HYHA 4XIYA 4OJNA 4GLLA 3K31A 2B35A 2NVUB 4HADA 3S2GA 4YYZA 5TJHA 4D42A 4A0SA 1WDKA 1UZMA 4WK6A 5HTOA 1E7WA 4GWKA 4F6LA 4RPGA 2V6GA 2Y1GA 1E5LA 4Q3BA 1B26A 2JD1A 3DHNA 4MP6A 5JAQA 5I7FA 3ZNNA 3E03A 3PPIA 1DC3A 4CLXA 3ZI0A 1Z75A 4IQ0A 1P31A 3ZHBA 3MJVA 2D8AA 4CLOB 1P3DA 2EG9A 2HMVA 3K2BA 1I32A 5THQA 3AI1A 3K92A 1BW9A 1ZVMA 2Y1CA 1JDJA 4NBRA 2AXQA 4XR4A 4Y8VA 1AXEA 1EVIA 3RUIA 3N74A 3ZNOA 1VL0A 2OP0A 4P4GA 4NNJA 4A5OA 4BNZA 2W2KA 2X4GA 3E5RA 5L3ZA 3W4IA 4YAJA 5JFOA 3ADOA 3GRPA 3F5QA 4OIMA 4YAIA 3OH8A 1HSOA 4DTIA 2EERA 5IZCA 2X23A 1U4OA 2DFVA 4XDYA 4D41A 5I7EA 5K6AA 3ADPA 1VSVA 2YQ4A 2G0TA 3NRCA 4LGVA 4ZA2A 4B4UA 4CMIA 2AHRA 3F9IA 5CDGA 1EQUA 3PDJA 4L73A 1ADFA 1ZXLA 2Y67A 3H2ZA 1P0FA 1ZW1A 1OFGA 3KSUA 2GSDA 4G5HA 4WCFB 3WFIA 4BVAA 4KQXA 1JVBA 1M67A 3ORFA 3ZV5A 2GN6A 2B4TO 4FW8A 5AXBA 4BQPA 4ZD6A 3S55A 5JO0A 3ROQA 4UULA 3PZBA 3D4NA 4MVJA 2Z1NA 2Q4BA 3OEYA 1DFGA 1H5QA 2JFHA 2O3UA 3L9XA 3KETA 1HDZA 3HQ4O 1ULUA 4CL8A 2SCUA 3OIFA 4MDHA 1UP4A 1BXGB 2VRCD 4BQRA 1QXSA 1WDMA 5L51A 4NI5A 1YONA 4XIJA 1JKFA 1T2EA 1XKQA 3AUAA 3PGXA 1W4ZA 4DPLA 1HL3A 1U3WA 5HWSA 3DZFA 2PKQP 1PZEA 1U5CA 4W82A 2JCVA 2PGLA 2E37A 2A9FA 5AXCA 5DT9A 3ZWXA 4EW6A 1NR1A 3B20A 4XEHA 1A7KA 4FFMA 4AJNA 1FDVA 4PLTA 3FPLA 2YHUA 3G3EA 4TSKA 5AOVA 4J7XA 1GEGA 2D0IA 4JJIA 3RUCA 1X1EA 2BFOA 3DR3A 3ZWCA 4JBGA 2R2GA 3BAZA 5C3MA 4MKXA 4RVSA 4YWJA 1TI7A 1PL6A 4J4BA 4EGFA 4E13A 4MIYA 4RDHA 5L7TA 4KQWA 4JLWA 4XRRA 2B5WA 3DZKA 3QWFA 3GVPA 4MJLA 4NJOA 4WASA 7ADHA 4G81A 5COAA 4PN3A 2YFHA 3FCOA 5FI3A 1KERA 4IY1A 1WMAA 5CDYA 5KCZA 4O0LA 4W9NC 3A14A 2X5KO 3AFMA 3G1UA 3OP4A 2Y1OA 4YRDA 1G6KA 4CR8A 4KDEA 2G17A 2PZKA 4CQLA 1IB6A 3CKYA 2J8ZA 2X22A 4JX8A 1QYXA 1H6DA 2PLAA 2WSBA 2YV3A 4LK3A 5TGDA 2ZCUA 2VT2A 3DBHB 1B14A 3O38A 5AQ1A 3H9EO 4MINA 1SB8A 1BVUA 4DBZA 5J23A 3RC7A 4FQ8A 4IJWA 4CLDA 4CV2A 2GO1A 1NVTA 3ETDA 2D2IA 1KVUA 1LDGA 4XYEA 1HE3A 4PG7A 3VZRA 2GZ2A 3VDRA 2Q2QA 2FRDA 2R6JA 2YUTA 4E33A 3WJ7A 1PJCA 3ST7A 1C1DB 4OGWA 4TMFA 4DIOA 4N54A 3JQBA 2PZLA 3JYQA 2HCTA 1KY5A 2AQKA 4WUVA 3NAQA 1VKOA 2YFQA 3UGKA 1FK8A 1IULA 3OICA 3TOXA 3U5TA 4HV4A 5I9LA 3ETGA 1J4AA 4J1QA 4LN1A 4MO2A 3SC6A 1PZFA 1VSUA 4XYLA 2NLOA 3DFZA 4BKRA 4DVJA 2AW5A 2CDBA 1UZLA 4J9VA 3Q2IA 1JU9A 3Q2KA 2NNLD 4LW8A 1I2ZA 4OQYA 1AE1A 1E1NA 1S7CA 5CDUA 4Z3DA 4UVDA 1BXKA 4Q3DA 5KVSA 4OMUA 2P5UA 2FOIA 5L7YA 5T57A 4B7CA 4E21A 4J1NA 2DPGA 3C1TA 3FHLA 5DOVA 3RD5A 3QVXA 1Y8RB 1DSSG 2QZZA 1BMDA 1Z45A 1NPTO 4TROA 3RUDA 4FOSA 4GAEA 4B4VA 4XGIA 3LC1O 5FF9A 2G82A 3PRJA 1C0PA 1NP3A 3LK7A 4XZ3A 3WIEA 5GZ3A 3D3WA 3DBRB 4INAA 3EUWA 4WGGA 4CQMA 2E48A 2HLPA 1NHGA 1MXHA 3QWIA 2O7QA 4E2WA 4QFCA 3FD8A 3JQ8B 3WXBA 4E2XA 1MP0A 4J1TA 5B4VA 1DIAA 1YJ8A 1ZK0A 3C7CB 4QXMA 5TIIA 1PGNA 2DKNA 2JFGA 1DBVO 3KEOA 4J0EA 1U2GA 3SJ7A 1QMGA 4UEJA 4BNHA 5A1TA 4BNIA 4I9NA 2B5VA 3EHEA 4KDFA 3ZWAA 1QYCA 3LLVA 4MVJP 5JDCA 4Y67A 1E3SA 1ML3A 4N5LA 3OJEA 1XSEA 3ZU2A 4DWVA 1JLLA 4CODB 1B0AA 2NVUA 4JXKA 1T1RA 5ILOA 2GASA 3GN1A 2FHSA 1UXIA 2AE1A 1DFHA 3H5NA 4IZHA 4FR5A 5DBIA 4CM3A 2JAPA 4BO8A 1ISFA 3GGPA 4EUHA 2VNAA 3L6EA 2NWQA 1CYDA 3RUEA 4ID9A 4BV8A 4XYGA 1N7HA 2F00A 4QUKA 2BMAA 1ARZA 3GG2A 3BTVA 3ZW8A 1Y9AA 1QYDA 2PK3A 5B4UA 4J7CA 3QRWA 1CIVA 2PKRA 5C37A 1DJQA 1VPDA 4C7KA 1U2DA 4YJGB 3LLSA 3PK0A 1YVEI 3VPHA 4DIFA 3GVXA 2W98A 1KVTA 3DAFA 3P7MA 3WMWA 5CPFA 5JYEA 3OECA 4EI2A 3INTA 4R41A 4XGKA 4DMMA 3CIFA 1IOLA 4ILKA 4W7IA 2Y68A 3AUSA 3GMSA 1R4NB 1KY4A 3CINA 4J90A 1VKNA 1GYQA 1NVGA 3VHRA 2BI8A 4P22A 1VJTA 4DGSA 4MOWA 1GAEO 2EHDA 4ZHSA 1E6UA 2X7HA 3TL3A 2HKIA 2BD0A 4IIUA 3RU7A 1WZIA 5G0WA 1H2HA 3O9ZA 1Q2XA 3PVZA 2EJWA 1U1IA 4CMEC 1GUZA 4XKJA 3PJEA 3DWFA 3KLPX 1QV7A 3MCVA 1I3KA 1ONOA 2X9NA 2ZYAA 1QV6A 1U4SA 3PYXA 4WJZA 3FNGA 3IL2A 2TMGA 3EW7A 4PRLA 2FR8A 2I67A 3LQFA 1HYGA 4WCFA 1YBMA 2A92A 4IJVA 5ILGA 4BGUA 1YBAA 3WS7A 3V1YA 3O8QB 1HLDA 4L4SA 4R3WA 3WNQA 4B7XA 4WLFA 4BNJA 5F1KA 3LT2A 3O26A 1I33A 3ZU5A 2Y1EA 4GWGA 1JA9A 3RC9A 4FD3A 5CHEA 3IKTA 4DA9A 4E31A 2OO5A 3F47A 5DCYA 2QQ5A 3KYBA 2I66A 4PZCA 2VRBA 3V2GA 3PEFA 1ZNQO 3GHHA 5EJ2A 2OHXA 2JAHA 4GX1A 4R5HA 3RSHA 1BXGA 3QJ5A 4IXWA 2ZQYA 3ROKA 3S2FA 1ULSA 3L77A 2VZ0A 1LU9A 1MV8A 3LSYA 2B4QA 4UREA 2ZTLA 3TRIA 4BGIA 4DLAA 3PJGA 1ZEMA 3ITKA 2W8ZA 3ETEA 1F8FA 4R9RA 1BRMA 4LISA 1XLTA 2B83A 1RYDA 5G0SA 2NACA 4BIIA 3L9WA 1SOWA 3DZHA 4AJIA 3W6UA 5A5FA 5IN5A 3VH4A 1BW9B 1V9LA 5KTKA 1GTMA 4UVEA 1EK6A 4PLCA 2C54A 1WNTA 3A06A 4Y9DA 3WG9A 4AJOA 5T5QA 1PIWA 1KOLA 5EIOA 4PLGA 4CR7A 1GL3A 2O48X 4YJFB 1DIGA 1UDAA 2FY8A 4UAGA 4D43A 1IYZA 3AWDA 3VAZA 1YGYA 3TL2A 3FWZA 3AK4A 5DP2A 1B3BA 2IDZA 1QP8A 1K5HA 3OHSX 3SJUA 1OC2A 1NWHA 5ITWA 2ZCVA 3WLEA 3WOHA 4PLWA 4ESOA 5HA5A 3VPXA 5IDWA 1C0LA 2GDZA 4WLNA 3ZN2A 3PHIA 3UOGA 4KMSA 5ICMA 1NNUA 4CM1A 2C20A 2GF2A 5K9ZA 4ZN6A 4DBVO 4X54A 5IZCC 4Z3KA 1Y6JA 2EW2A 4ALMA 1EK5A 3DBVO 2JD2A 2H9IA 3UCFA 2BH9A 3DBHA 3ULKA 4B7UA 1OC4A 3HB4X 5EQFA 5BQFA 2O3JA 1JTVA 2PD6A 3AM4A 1FDSA 2GCGA 5KJ1A 3L0DA 3AUUA 4QO7A 4UUPA 4F6CA 3UCXA 2IRWA 3IJPA 4H3VA 3RFVA 2D59A 2J3HA 2DM6A 3EZYA 3PQDA 5EINA 4MP3A 4RJTA 4NQZA 3WMXA 1D4FA 5DN9A 4E5NA 1HDOA 1KBZA 2VT3A 2PD3A 2VWQA 1UJMA 3OF2A 4DLBA 5IXSA 4RVGA 3RKRA 1SOVA 2FR1A 1C1DA 1UXHA 3N7UA 1P1FA 1SEVA 4I5EA 2VTDA 4ZU3A 5A9TA 3M2TA 1LC0A 1P1JA 3PFFA 4HKTA 4C7JA 1O94A 3D4PA 1PU2A 2Y0CA 2P4HX 2ZB4A 3NJ8A 4YRAA 4TKLA 1U3UA 3RASA 4AJEA 3IAHA 5I8WA 2HJRA 4DMLA 5TF4A 1NAHA 2B37A 1GFSA 3GEGA 4PLYA 1GYPA 2JFFA 2CUKA 3F5SA 4PLVA 4RPKA 1GU7A 3B6ZA 3QSGA 3I23A 1L1FA 3V8BA 2RH8A 3R3JA 3INGA 1ONNA 1ADBA 3V2UA 2UYYA 2C5EA 1ONPA 1GCUA 1SAYA 3HB5X 2AEMA 1RJWA 1Y8RA 2QRJA 2CMDA 2FPPA 3WGHA 5KKAA 3U4DA 2UUPA 1V0JA 2J5QA 1ZK3A 2GPTA 2Q2WA 5L95A 4D3DA 3KYCB 4DC1A 1LNQA 2CF6A 3SBOA 2EP5A 4FFRA 3OJOA 4CL3A 4M54A 4JJFA 1ISHA 3JQ9C 3DMTC 2AQHA 3KM0A 2WYVA 3PFWO 2YDYA 1P9LA 3DBRA 3K5PA 3P2YA 2VHZA 4PRKA 3MEQA 1LBEA 4GMGA 5EN4A 3HDQA 2IZ0A 1S6YA 5DBFA 4IMPA 3JQ8A 3MOIA 1L7DA 4PLHA 2EJVA 4IJKA 2O4CA 4E2ZA 2Y99A 1BTOA 4XA8A 3WQSB 2GZ1A 1LJ8A 1EEHA 1EMDA 2NTVA 4QECA 4BNFA 1DRUA 1KETA 4I8XA 1KVQA 4FS3A 2X8LA 5JC8A 2GZ3A 4MVJG 1YB4A 5JYDA 2ZJ0A 1OZAA 5JC1A 5CEEA 1O8CA 1GD1O 4OOEA 2Q46A 2P9CA 4FGWA 3ZV3A 1XA0A 4FIZA 1FXSA 1ZO8A 9LDBA 3UAGA 1HKUA 4TVOA 1DPGA 4OKIA 4IMRA 2VWGA 2WWRA 4LSMA 2PD4A 4J91A 3FNHA 5DULA 2NQ8A 5H81A 3K73O 2YJZA 1HEUA 1DIHA 2OMEA 3JQBC 2A35A 5THKA 2VRCA 5U1PA 3PQFA 4B3JA 5IJZA 4DPKA 3JTMA 3W8FA 4CM4B 4BKQA 4RLSA 3MJEA 3SEFA 5FFFA 4MIOA 4YJGA 1N92A 1XQ1A 2C5AA 1JKJA 3TOZA 2AQ8A 3GDOA 1X7DA 4Q3AA 1C3VA 1X15A 4A2CA 3L07A 4M8SA 3SXPA 3GT0A 1R4NA 3PHLA 2Q1SA 2J5RA 1IUKA 4M1QA 1MUUA 4NIMA 3ZNPA 3MTJA 2PA3A 4AJJA 4NZ9A 2VUUA 4B8WA 1T2AA 3GEMA 2WYUA 4A03A 1PGOA 4BNGA 1QR6A 1N5DA 4BV9A 4ALNA 5A02A 3NGXA 2FP4A 2HDHA 4GKBA 2EP7A 3TWOA 1D8AA 4IDFA 4YB8A 5TQVA 5F5NA 2YDXA 3I4FA 4OL9A 4PLZA 4Z0TA 5FWNA 5K1SA 5A04A 1YJQA 4GVLA 2J5KA 1ZXBA 1C0KA 1J0XO 4NBUA 3O4RA 2QW8A 2UVDA 4E32A 3TZCA 3HNPA 3O8QA 1XG5A 5U9CA 1A9YA 4U7WA 3RQSA 1MGOA 2HRBA 3KXDA 4P4NA 3ZDFA 3GEDA 3RAJA 5KWEA 4IZIA 3AFNA 4Q3CA 4BNLA 4O59O 1D1SA 4DYVA 4CV3A 4RPHA 2FN7A 3N58A 2D5AA 2QG4A 1LI4A 2NU8A 3HFGA 3VPSA 3IMFA 2HJSA 5FI5A 1NPYA 1JAXA 3NTQA 2GN9A 3FPCA 1SPXA 2VWHA 4AJ2A 3UUWA 1HDGO 2EKLA 3B1KA 3WWZA 2DPHA 4JJGA 2CDCA 3D64A 1I2BA 4L4RA 1ENZA 1HWYA 2PKQO 5A5EA 1UZNA 5IDYA 4XX0A 3ZU4A 3WX0A 4PGFA 3RJ9A 1XQ6A 4P38A 3M1AA 2VHXA 4N5MA 1VJ1A 4CM5A 3U9LA 3OIGA 4ZRMA 3PWZA 3VOSA 1MA0A 1M2WA 3RC1A 5DZSA 5GZ6A 4AFNA 4YJFA 3AUTA 3CE6A 2CF5A 4LVCA 3OJLA 3U49A 2AG8A 3UF0A 2XAAA 1U7HA 1GUFA 1EFLA 2PFGA 4O5OA 4QX6A 4XGNA 2DFDA 1SZJG 3WR5A 3WSVA 3AOEC 1H6AA 1HT0A 3WGTA 3U09A 4OKNA 4Z0HO 4BNMA 4RCVA 4RPJA 2C2XA 5JXWA 3PGJA 1CQJA 3KV3O 4DQVA 1PL8A 2DBRA 3PJFA 4R16A 4D0RA 4Z9XA 3IP1A 2Q2VA 5JO9A 3NYWA 3WNVA 3P5SA 2RIRA 4FBGA 1P1RA 2JKVA 1E7MA 4Z0PA 3QA9A 5EL0A 2YV1A 4OYRA 2CVOA 4IIVA 1WDLA 3WICA 2OORA 1JVSA 2IEDA 4GGPA 4N18A 4NDNE 5CPBA 3X2FA 1R12A 3Q9UA 5A3VA 1T1SA 3COSA 3C1AA 1H6CA 3H7AA 5ENVA 2CDAA 5JDIA 1SBYA 5L4SA 4LRTB 1U8XX 5K0ZA 2EGHA 4RQTA 1MC5A 4HBGA 4XRGA 2Q45A 4R54A 4HFMA 2EXXA 5JAZA 1T24A 2AQIA 2B4RO 4I5DA 4P4LA 2Y1DA 4RV9A 4UUMA 1MFZA 3ON5A 1XU9A 4IQGA 2WD7B 3KSDO 4B4WA 3C7AA 4Z6KA 3G79A 1FDUA 4WEOA 5TS3A 3VC7A 4ALLA 2XOXA 1TB4A 1YWGO 4R68A 2PWZA 1VJ0A 3FBTA 3C7DB 3HJAA 1R0KA 2DTDA 3I9OA 1AN9A 4M87A 1YH3A 3I9KA 1IZ0A 1BSVA 1N9GB 2I3GA 3MJSA 4TVBA 5JLAA 4DIBA 4A27A 5A3JA 3E5MA 1LLCA 4ZICA 4IPTA 1B8UA 1X0VA 2H1SA 5LC1A 4J0FA 2YYYA 1LSSA 1PEDA 1AXGA 4ALIA 5C7OO 2A94A 5JCJD 3UXYA 3HSKA 2BFPA 3KYCA 4YJDA 3ZWWA 1DC6A 3MJTA 1LLQA 4D45A 2D5CA 4MVJH 1NYTA 2YZ7A 3QIVA 4CM9D 1N1EA 3ENKA 3R3SA 4M55A 2PNFA 1G1AA 4JP3A 3FWNA 1K0UA 3E1KA 3VDQA 1LSUA 3AI3A 5CP8A 3UFXA 4KOAA 2B36A 2JHFA 2NQTA 1KEWA 4Q3NA 1UAYA 1IPFA 5TC4A 3JYLA 1MG5A 7MDHA 1QKIA 1LRKA 5ES3A 3IUSA 5T8KA 1R16A 5AYVA 3DHYA 4DQXA 5C5IA 3PYLA 1VI2A 3KLMX 1T26A 5HS6A 4A10A 3F6YA 3JQEA 3UICA 3PQEA 3OIDA 5IG2A 1ZUD1 5EPOA 5BNTA 4JK3A 4K28A 1U5AA 4NR0A 3VKUA 4CUZA 5CG1A 3KO8A 2QHXA 1L7EA 3BHJA 5TJ9A 3U3XA 5JY6A 2Q50A 3OQBA 3GUYA 1I24A 4E5YA 4OSOA 3KTDA 4H7PA 3ITDA 1DAOA 2FMUA 2IE0A 1QRRA 2IODA 3U4HA 3WJAA 4D44A 3FF4A 4QEDA 3ICCA 1UDBA 4Z9FA 2PR2A 1Z73A 1OOEA 5T67A 5MDHA 1TEHA 3F1LA 2RHCA 4JBHA 1EE2A 4H15A 3T4EA 4CM4A 5KVVA 2B69A 1J49A 2JL1A 3DB2A 4TZKA 4XJSA 4Y6SA 3RUHA 3JCZA 2NUAA 2EKPA 2O2SA 3L6DA 1V8BA 4E12A 3VZPA 4I08A 1Q7GA 1H93A 3CXRA 3G0OA 5I9MA 3QHAA 3E9MA 1W73A 1XCBA 3PIDA 3TSCA 3OA2A 1LDMA 1C0IA 4WOKA 5G2OA 4DYDA 4YR9A 4K9DA 2HU2A 3GMDA 3VH3A 4NBVA 1Y7TA 2RBEA 4NPCA 3LVFO 1DHRA 3GAZA 1YXMA 3PP8A 2C82A 2C7VA 2VCYA 3WFJA 1A72A 3EAGA 4E2YA 2NTNA 2R00A 4CMKA 4Z9YA 3CH6A 3AU8A 3TFQA 2IZZA 1IZ9A 5JAMA 2AMFA 4WLEA 1H0KA 1NTOA 1OBFO 4EZBA 4IUYA 4CR6A 1WPQA 2FSSA 3H9UA 1M66A 3P2OA 1RM0A 4B4OA 5IFLA 1PJ3A 3BMQB 3CTMA 3HUDA 4II2A 4W4TA 1NFQA 3ZNQA 4BNTA 3STHA 3DOJA 2RAFA 1QG6A 2RHRA 2XF8A 1ZIDA 1VL8A 3NV9A 2X1HA 2EEZA 1WZEA 1YE3A 1PSDA 1XR3A 3GVCA 4YAKA 2X0NA 5KIAA 3QWHA 3Q6IA 2HUNA 1NQOA 2X9VA 3C8MA 1NM5A 4NBTA 2V65A 4H16A 5FYDA 5C7LO 2ZB8A 1YQGA 4ONEA 5JY1A 2Y93A 2EW8A 4YAEA 3RJ5A 3SLKA 4BO0A 3KBOA 1JW9B 5H82A 1ENOA 4ZQGA 2XXJA 1M6WA 4OSPA 1K6JA 1UP7A 3DZBA 4BO3A 3L6OO 2DBVO 4XYBA 5BR7A
chains in the Genus database with same CATH superfamily
4MQFB 1TYCA 4JP8A 4NCKA 2RBKA 1O95C 3BFXA 5DNAA 3B8EA 4GYKA 4AZ0A 3W04A 1E60A 2ACKA 4KQCA 3D31A 2FEPA 2Q28A 1R6AA 3NDIA 3F90A 5E1BA 1XKTA 3K4HA 4E11A 1RAHA 4TLMB 2PRZA 2A9VA 1N9KA 5BSFA 2IS2A 4K6KA 4Q4AA 5IT0A 4JYBA 1HE1C 1NBEA 1XZCA 2XD9A 2RHHA 2WOOA 1UMCA 3VYWA 1IXKA 1GTL1 2HH9A 4BO4A 2JW5A 2R7AA 4TS3A 4UVGA 4R2XA 1E1MA 4FOPA 3OLQA 4DSOA 3DOCA 2J07A 3KE8A 3AETA 1LZKA 3C2QA 3QYJA 1NQ5A 1S2DA 3PQ5A 3U9TA 1QQAA 1V45E 2V7WA 4K2AA 2QLFA 5IYZA 1UJ2A 4E30A 3C3JA 2ZS9A 1NRWA 1A04A 2CZCA 7ABPA 1QQTA 1U0JA 4I14A 1GRRA 2ZRIA 4RGBA 3B9PA 2P1ZA 4UHCA 3W5JA 2ZIUB 4G9GA 2H16A 3DS8A 1G42A 2Q1UA 1U0GA 5CT9A 5SZJA 3PF8A 4IOLA 5BWMA 4MQ4A 4X0EA 3WBFA 4CF7A 1N7JA 5AVVA 5TX7A 1CUIA 3EVNA 1P0IA 4RX1A 1QIEA 3HKBA 1W8IA 2BVNA 1WCV1 4UAUA 1YQUA 1ZNYA 1IK4A 1DQSA 3QK7A 3RBXA 1L7XA 3PUIA 5FR2A 3T7EA 3WE7A 3GNLA 4JVMA 5JSUA 1NURA 2QDXA 1BZYA 2AJCA 3L4BC 4MLDA 3W8RA 1RVDA 5HJEA 3D1VA 3GZNB 4PNZA 3ZXYA 3JARA 4DDVA 5K4GA 2XCSB 1H5UA 1P74A 3E8MA 2C03A 3OCVA 4MCHA 4OAPA 3KQTA 1E0AA 1S2LA 3IVXA 3QE3A 4ZO6A 3MS7A 3MTQA 4WXYB 3HA7A 2BMDA 4IDPA 3RCBA 4NFLA 4KQ6A 1TVEA 1PVVA 1GPLA 4BE9A 2J9FB 2XRYA 1I6LA 1XELA 2XECA 4Q4JB 4B47A 4OAQA 1PJTA 5FQNA 1SXJE 1AX9A 2GPSA 3BXEA 3CRZA 5FJJA 3UAOA 4RAOA 1FDIA 5BV1A 5DSTA 4D74A 2GF9A 2CXTA 2HREA 4U2KA 1T1IA 2FOLA 2X58A 2UZ0A 5J9FA 3V7UA 5AVWA 3K1JA 1CVRA 2AMLA 1EDBA 3MD0A 3OUUA 5LZ9A 3LVRE 1LRLA 5CNIA 2WD7A 2X5NA 1CVLA 1PJBA 2R6AA 4GUAA 1PSWA 3NDJA 4QYXA 1WETA 3NNSA 3EGXB 4LMPA 5EA2A 2WWYA 3RVDA 4DL9A 1L3BA 2MCFA 3WYCA 2WI8A 3KEFA 5B30A 2NO6A 2ZSDA 4HNAB 1EBFA 1IHXA 1EQ2A 1QO9A 2IOYA 2QTNA 3HBFA 5TQ2A 1OX4A 2NZXA 3G17A 4ZCTA 1JH8A 2GN1A 1JSCA 4EKNB 1W4RA 2ODAA 4ZYTA 2HQOA 4ZREA 4XD2A 1B93A 4FCWA 3O2QB 3TIXB 4F8JA 4BFWA 5HHTA 3KAKA 2AL7A 1B15A 4D82A 4ZPJA 2VNKA 3ASVA 3CZ5A 5FR1A 4B4KA 2O14A 5K0GA 1ZX1A 4QTXA 1IE3A 2BY4A 3ANNA 3AFHA 1KEZA 1H22A 4GQAA 4QSHA 3T1NA 2PUHA 1CQJB 2XE8A 1EP2B 2AI3A 4W9NA 3S8EA 1BDBA 3P52A 2JJYA 1K6EA 1NSFA 2DTEA 2NZVG 5EQTA 1UPCA 1MO4A 3WYBA 1E2BA 3PYMA 1SHZA 2DHRA 3A58B 5K0NA 5CT8A 3WIOA 5K6AC 5HSGA 2ZYGA 5CTJA 5GP1A 4XJXA 1UM8A 2I0FA 2BH2A 1BMTA 2IKQA 2VYND 1CHNA 5T6BA 2X19A 4XQEA 2D62A 2QX4A 2V6BA 3MJ4A 1F0YA 3OVMA 5IAAA 4EUFA 3K72B 1XFAA 2VPTA 4QHYA 5CT6A 3EIEA 4FC7A 3X0DA 5LOVF 1EFUA 3ADKA 3AU9A 5KNDA 1PZHA 1LLDA 3UAZA 3ZZMA 4TTQA 3I5XA 2I4LA 3WGZA 4LOAA 1L4KA 4YJHB 2GAFA 4NPAA 1NDQA 5LDDC 3QEAZ 4MTLA 1NC1A 4URWR 1T0HB 8MHTA 4O1MA 2JVIA 1XX6A 1R18A 3L7CA 1TVMA 3A1VA 2IFTA 4ZOEA 4IWNA 2CVFA 4O6VA 3ZVRA 3SN6A 1NOKA 2AZMA 3GPDG 4DSUA 4XQCA 1YIAA 1M7HA 4UNIA 3CVOA 3JQDA 3JWIA 4WESA 3USES 5C8XA 2BM0A 3I28A 3J81k 3ZVMA 1SU4A 2GD0A 1PEAA 2O0LA 4WT7A 2ZWVA 1Z2PX 3LW7A 4KMOA 4I99A 5JH7A 4JNCA 3TEMA 3ZOZA 1NUHA 1SKUA 3IP7A 1KE2A 5IT4A 4MB2A 1AUVA 3ER6A 4RIIA 4Q4HA 5JTTA 2C2YA 2QJWA 7REQB 1GJRA 1FFYA 1XEWX 3AHJA 1UINA 1LPSA 2HQSA 3BL8A 3DE1X 2VZ9A 4RS4A 2WEKA 4ZANA 1JHOA 2QTBA 1K63A 3OPMA 3QVUA 5HJ5A 5A5GA 1I10A 1YIOA 3UB2A 5EFZA 3AH8A 4IRXA 1EE9A 3ZWBA 4PCVA 1IQRA 3AXTA 1Q7BA 1AKQA 1WKVA 2BKLA 2ZI4A 5DYIA 3SEZA 1PVOA 1X2BA 3P2MA 1ZVKA 2IEBA 3GXOA 2Q5JA 2P9GA 3QXSA 4B6OA 4ND1A 5IS2A 2PGOA 3CTPA 2I65A 4LSGA 2ZUBA 4M1TA 2YIMA 3LHDA 4HTFA 4GPBA 3BC1A 1NMEA 4XI9A 3TSWA 2JANA 4LQCA 4P7JA 1DCTA 4D9JA 3W9UA 3MRVA 2YQ5A 4L0CA 3DV2A 4Q39A 3QVGB 4L1KA 4NU6A 2DUUA 2RCYA 5DXJA 2OUKA 2GXAA 1YVPA 1JQEA 4DUGD 1L5YA 2POQX 4N9QA 5KNDH 4XUGB 2JLCA 3QPAA 3WSWA 5B58T 3R8CA 4DLYA 2W71A 2X1LA 1NW5A 4L57A 4S1VA 3M1IA 3UHJA 4YCSA 1MCZA 4DLRA 5FHQA 3TZKA 2PX8A 1E63A 4R40A 2H1VA 4TTJA 2BR5A 3SC4A 1KFKB 2VQFB 3H17A 3HFSA 3WV5A 4AMBA 4XWGA 3ZXUB 2EQ5A 2VF2A 5EE9A 2CNBA 1WPGA 3K6SB 2R6GA 5I9SA 3N5CA 1MF7A 3OPYA 3BRWD 3EULA 1PWZA 1DXQA 4PAWA 1P4SA 1Y33E 2OD9A 3ONWA 4R1NA 3ZLBA 3A1TA 4P92A 4YRBA 1IHYA 1NN3A 3JAKB 4RTOA 3DKVA 3FR7A 1C1XB 2GZAA 3S1LA 2MT9A 4RETA 3PUVA 2Q27A 3Q12A 4HNHA 3JQFA 4I4NA 1Z0JA 2CLOB 4KO2S 5T8KC 1J1IA 4AMUA 1GGEA 4CHTA 4AK9A 3V7YA 5KYXA 3QIAA 5I7AA 2JGRA 2VH1A 3M6WA 2VYVD 2H63A 2ATXA 1FLAA 2EWWA 4GQBA 1NUQA 2VVTA 2FRDC 2RGEA 3W2TA 2GYUA 1M8KA 3L0BA 3ZWMA 4F2PA 5CFQA 3LHSA 1K5DA 2Y0PA 5DEIA 3LCVB 4R1MA 3MW8A 1GA1A 4LYFA 4RU1A 4K9PA 1TVKA 3WYDA 1N7GA 3F0TA 2FWRA 2VHCA 2C2MA 1LQ2A 5B2ZA 2AN5A 4DIMA 4US0R 2BHLA 3T5PA 1K5PA 4XD7A 4D98A 4YCNA 5DRYA 3GBSA 3AL0C 4RIHA 4OYLA 2VHVA 3VH1A 4RZ3A 1ZK1A 2LDBA 2WJVA 3MJDA 3O94A 1K3TA 4YNBA 1ZOIA 2JDID 2WICA 1V3TA 2WE7A 3DAHA 3LBNA 3IMKA 4MR7A 4MVJI 1W4BA 2BT4A 1S3GA 3EBPA 5D5QA 2OGZA 3FCUB 1KO5A 2JH3A 4MQEA 3IQZA 5SICE 2GCEA 2H1IA 2VSFA 4M22A 1NMQA 1MD9A 1L3CA 1CUWA 2ZU0C 4AO6A 5ITZB 1QZUA 2DLNA 3N8NA 5KTOA 4EJ0A 5GONF 4LJSA 1YA6A 4QU9A 4GPAA 1QIDA 3BFPA 5EY5B 3WZLA 5KTTA 2Z9CA 1QFYA 4RVCA 5A6SB 2AI1A 5DX8A 2ID8A 5C80A 1E2GA 2PV7A 3C3PA 3EQ9A 1GV0A 2G06A 3H1FA 3PRKE 4G1MB 4HDMA 4YT5A 3S99A 1L7BA 3SMVA 1FTSA 1NAIA 3LX6A 1RI2A 2OB2A 3KL4A 5EZQA 2Z6UA 3NT2A 1AQLA 4X44A 2P4QA 4PEVA 5EE0A 2YHIB 1G60A 2O3TA 3AOGA 3MWJA 4CRWB 3OESA 2XYQA 4CFZA 4LBZA 4LPSA 1L4BA 1MA3A 1YS7A 5JCJA 1X1CA 2VAMA 4RHEA 4D99A 4B43A 2X4IA 1E7YA 4YCAA 5IN4A 5J4HA 3KKQA 3LPMA 3P4XA 1Z39A 1VG0B 4KLNA 2NO1A 2HBYA 1SUBA 3SM3A 3TPFA 5JV5A 3I52A 2HWWA 3LC7O 4JITA 4Z49A 1R6TA 1DWQA 3MT0A 4GE0A 1Z5UA 3W3AA 1PJ2A 3C1OA 4AZSA 4CV0A 4CT4B 5EMLA 1ORVA 4HD8A 4HRAA 1CY6A 3CRW1 4Q93A 1IQPA 2O5VA 1YACA 3IPAA 1HDEA 3LGSA 4GT1A 4H08A 4IGFA 1DG3A 2W2NA 2OHFA 3DXFA 4DDKA 3ROFA 3WLFA 2Q9UA 3B9BA 4BLVA 4DWJA 1RAGA 2VAVA 3VH2A 3T4XA 3HJCA 4P33A 1QIIA 2GYYA 3MWDB 5EXPA 4OHMA 2GILA 4WTOA 3WGIA 1CDOA 1S4QA 1XIVA 3FUXA 2I76A 5KC8A 3OT1B 2CMHA 2IYNA 1G41A 1Z0UA 4P4UA 2WDZA 1JXQA 1BO6A 1ZI9A 2A4KA 1OGJA 2VJQA 1UBTS 3LUAA 4JIMA 3WYEA 1KP2A 4AIIA 4B33A 5L3SB 1KO4A 4CMAA 4U9UA 3VC1A 3AF6A 1NM5C 3SLGA 3PHJA 2FLKA 1KI3A 3EZ2A 4XR9A 3H16A 5DNWA 4BN0A 1HQDA 4F2GA 2ZIXA 3TSZA 1PQUA 3BSYA 2K2WA 1T9GR 1K6IA 2GUWA 2BGGA 1TJ4A 1YBVA 4RJLA 5I4CA 5F98A 4IV5A 1J1ZA 2WJ3A 1WWKA 4K40A 4EHDA 1XZBA 2Z6QA 4OF4A 2ONKA 2R6R1 5T4BA 2ZFUA 1EH5A 1DAFA 2GEVA 3H9BA 1O5IA 1WRBA 2MOKA 4DRXB 2AJDA 1UDCA 2HJGA 1T4GA 3IDSA 3QYAA 3JQ7B 2VP3A 3MLEA 4FQ7A 4X92A 3PC3A 3SVTA 4LF7B 1ST2A 3R6LA 1ZK2A 4OQEA 4W6ZA 5DB4A 3AJRA 5K99A 4IUCS 3V5NA 1I0ZA 4FYXA 4I1RA 2P91A 2AX4A 3RUFA 4EUEA 2YICA 1CR0A 3U81A 1HSZA 4AS3A 3KVYA 3ET4A 1VLQA 2IYAA 1SVIA 1YOVB 4UBKA 4MEAA 2XYRA 4JKYA 1JR6A 1A97A 2LKDA 2ODBA 3NCHA 4X1IB 5JZ9A 3R6GA 4KTTE 1CUAA 5I51A 5CA0B 5E0OA 2PGXA 4C04A 2HCBA 3W3AH 4D5GA 2VUSA 2RGUA 3LLMA 2Q3DA 1P0CA 4TKMA 4TXNA 4L8LA 4IVQA 3V1UA 4LXXA 1O58A 1L5NA 5JBNA 2VJMB 3AT1A 2BEWA 2YXEA 4L3VA 2XGSA 3NHMA 4WPGA 3TW6A 5BSWA 2QTVA 3ORRA 1CEQA 5GPBA 2ZJ7A 3TF5A 1ZPDA 4OO3A 4QARA 3BGWA 3TRFA 3EGOA 3LBAA 4MQ5A 2DEUA 4KZPA 4NU0A 2JGIA 5C5CA 4GVXA 4AS2A 1N2GA 3OZDA 1Q19A 1O5TA 2XYGA 1DQYA 2DWQA 2FAXA 4RTJA 2YWXA 3KUDA 3V8EA 3CUTA 3OFKA 3FJ1A 2ZVJA 1E69A 1JJVA 2Z08A 5HE9A 1WVGA 3FFTA 4MVJF 3MTEA 2FW9A 4NJMB 3ZWVA 3LDUA 1SRQA 1TLLA 3N0WA 1DZ3A 4F93B 5EHNA 1EEXB 3IB3A 3K0AA 4GL4A 2BE7A 5AR1A 3ASUA 1RRVA 2LE0A 3LXXA 4ZVVA 3K0KA 1T2CA 2FN9A 2WWGA 4DCVA 3N2KA 1G21E 4QJ5A 3AHDA 1EWYA 3NMUF 4G4JA 2UZ1B 1D1TA 1G8YA 1R2QA 1RYYA 2YN0A 3KD3A 2K6GA 3RYFB 3R3XA 4QQ8A 4JJZA 1RJGA 4YRRA 1M76A 4C0BA 5CG2A 4OG2A 4ZVSA 1GZ6A 1RKVA 3K3PA 1GV1A 4TUYF 1EPUA 4DGQA 1OX6A 5F21A 2QKYA 1XFDA 1DXOA 2G5TA 3ANMA 1P0PA 1Q92A 4R1TA 3KB1A 4MV3A 4JASB 1H65A 1T5SA 1NZJA 1H2BA 3HSSA 1VE5A 4JBWA 1U0TA 4HMOA 5HX7A 1F3OA 4LZNA 1MGPA 1RRGA 3OU7A 2NVOA 3SX0A 2ZKLA 1CLUA 2H1FA 2FWMX 2KJQA 1KAHA 3MUFA 2XNJA 1G19A 5HEKA 4JC0A 2WJPA 1E8NA 4QHSA 1KYXA 2E4VA 2REXB 2P40A 2VF4X 1EI9A 3KYDB 5GMOA 2FN8A 3DLHA 2QUHA 2FUEA 4IJQA 4J9UE 3SHVA 2IITA 3ESDA 4GI2A 1A9ZA 1T8UA 3H5RA 3D8TA 4DDMA 2G08A 4GRIA 1ZQ1A 1G4AE 1E94E 3A25A 4RMJA 3DMTA 2GR9A 2JLSA 4C4OA 1Q0LA 1T8PA 3ER9A 1LW7A 5C0OE 1U9IC 4KFSA 1U7PA 1C7RA 1Y5MA 1A71A 1P33A 5AMXA 4ZAYA 5TS2A 2FG7C 1Z4IA 2AR0A 2R1TA 2CLKB 3KJHA 1N1DA 4YJ3A 2SBTA 5J1SB 1NIPA 4MHTA 2Z8YM 1CETA 2JH8A 3P5BA 2V4UA 3GLTA 4DVGA 4YRFA 3R5XA 5JQGB 3B3JA 1BG6A 2RHMA 1YUBA 4MYTA 3MSCA 4C4ZA 4S04A 1IEXA 4BU0A 5AHKA 4DYHA 3I42A 2D0OB 2ZTHA 1TMOA 2D5BA 1MAUA 2X5XA 2ZIAA 3E3OA 3HXKA 3IB6A 4RY8A 4DMRA 5AVUA 1ZGAA 4FEGA 1FYWA 1SOAA 4A2QA 2GBLA 1R4MB 3JZIA 3WGGA 1YZGA 3WRWA 5KJFA 1RPJA 2FSIA 2Q21A 1XYYA 5HJ7A 1SCDA 2ZRBA 4PF1A 4O2BF 3OO1A 2WLSA 3I83A 4V03A 4EZIA 3PPYA 4ZMSA 2O2XA 4KYIB 3OOEA 3TNFA 4XVHA 1P6XA 5LD2C 3VMMA 3L4KA 4E09A 3DCYA 2GGSA 3CT4A 3M9WA 3PD1A 4IHAA 4ZEOA 1L5LA 1EZZA 2BGMA 5AKYA 4Z54A 3P71T 3R3WA 2NQ2C 4M53A 3DQPA 2OHVA 5ALMA 1MHTA 2QD3A 5GVRA 4P4TA 5KJEA 2JIOA 3LUBA 4Y6LA 3A7EA 1MVNA 2E87A 3B48A 5TMBA 4BXOB 1GNLA 2O23A 3H2YA 2PRYA 4D57A 4D7AA 2PLFA 3OCCA 2M6LA 2O07A 4B45A 3NBUA 4CLHA 1NKVA 1PTKA 1E5VA 1DUSA 3IX7A 1SJ9A 3GGGA 3PHCA 1LSJA 1D09A 2HAEA 4IUDS 1VMEA 2EHJA 3DOEA 2VOEA 3E9QA 2ZAYA 3OO0A 5JFGA 1OSNA 4CM1A 3R9XB 1QCYA 4IXTA 1RIFA 4AD8A 4Z2AA 4UEQA 4HGRA 4CUJA 3II6X 1SIUA 1EJ6A 1T6BY 4DCGA 3FOAA 4EPVA 5I8ZA 1H66A 5JWRA 4X8OA 1RHMA 1W0KA 3CE9A 4MWBA 1JDSA 4JI4B 1H8HD 3OX4A 1TLFA 3N70A 5FBKA 3Q72A 2DQZA 3BSFA 1HYBA 1L5SA 1QSGA 4TYYA 1UFVA 4G5FA 2WU8A 6REQB 3KT0A 4P5PA 1ZN9A 1K8YB 4EF5A 5FPSA 4KIUA 5DU2A 1RRCA 4J76A 2HU7A 2VTEA 1QPBA 3GJ0A 3M2PA 4RY0A 3TBHA 2V55B 3CONA 5FOQA 2BELA 2IS6A 2RI0A 4UDNA 1GPJA 2E4AA 4PO1A 3O2JA 1XMVA 1NVAA 3P8ZA 2C4KA 2VXYA 3DHWC 4QBIA 3UPTA 5J5CA 1CEXA 1ZRNA 1B3RA 3OKFA 3RRYA 1GSAA 4LHXA 2X5JO 4UMEA 2C1XA 4URFA 5BQPA 4PC3A 4C14A 3FPJA 2Y0DA 2QROA 4MVJD 4RYLA 5G02A 3MGBA 5LA6B 3VVBA 4QGHA 1P19A 3LT4A 1GN9A 2JFZA 4PO3X 4S05A 2E9SA 2VPIA 1EFRA 2A86A 2VJCA 4N12A 3LTNC 5C4GB 4KW7A 1UEJA 2TECE 3A3OA 1Y6QA 1W8DA 2IF0A 3OAAD 4U0KA 3OZCA 1C14A 1LGYA 1TCAA 4QRIA 3T12A 2WLTA 3COPA 3U7QA 5AW0A 4HTAA 3ZKAA 1ODSA 4EB8A 5AKJA 2P3SA 4ZVOA 3M6VA 1FZQA 4L27A 1M1XB 4ISBA 5K3AA 4BL5A 3N5KA 3SSAA 4EI8A 2VPPA 3IKMB 3R09A 3T5GA 3WGYA 3W5CA 1I94B 4DUPA 3BTUA 2J0UA 4NONA 5AP9A 4MW6A 4N49A 4XWOA 2ZDQA 1IN1A 3KJXA 3JQFC 3QE2A 1DBRA 4J7AA 1CUVA 3D81A 3LTEA 1PEYA 5JYBA 5IM5A 5L4LA 3GBPA 3KQMA 4LOIA 3REQA 2UXBB 3LVBA 1NMSA 4UFPA 1ISPA 4GRAA 1YJXA 2GVNA 1IM2A 2EJUA 5HUQA 4RTQA 4IXNA 4HAXA 4R81A 2Q4EA 2J6IA 1A7AA 1I7NA 4Y6OA 3W79A 2H2DA 3P2KA 4O2LA 4CIWA 4KRGA 4PQEA 4XQGA 5HKLA 3LE8A 4MW9A 5B53A 2ZI9A 1G0NA 2WU4A 721PA 4WKNA 2PGDA 1RHJA 5KX5F 3H6KA 4X8HA 4HT3B 2I87A 3NONA 4BFLA 3RV3A 1DCMA 2JFNA 2JHCA 1W9HA 2HA0A 4MLCA 3ABRB 4HFNA 4HDAA 3DBLA 5KYNA 1MMFB 3RVMA 4Q9KA 3RIYA 3U1TA 3SVZA 1ZH4A 4H3KB 5FAKA 1UBCA 4MRPA 1H94A 1X7YB 2CFCA 3QNUA 4KO1S 4NFHA 3T5DA 2C4TA 2OBLA 4L2IB 2IEGA 4PGGA 4CE6A 2OEPA 4YMGA 2G6TA 2QX9A 3OT4A 1P5HA 2PQ6A 4B2IA 1H6BA 1U7DA 1KU0A 1VRCA 4F84A 2IY9A 4P53A 4XM2A 4CKYA 3DMPA 3UH1A 4BEWA 2YL2A 4LVOA 2ATVA 3U4IA 4DTCA 3DUWA 3QKSA 3DEIA 3RC2A 4DE5A 1MNQA 3KSAC 3X43A 3MTDA 1GTSA 2HLDD 1JJAA 1XXHA 2V0NA 1A95A 3EIQA 4HPXB 2VXBA 4P3YA 5DHTA 2CNKA 1IMOA 2B3DA 1NR7A 3NHWA 3NP7A 1AXRA 1NX6A 3RS0A 1R64A 3UWPA 2Q99A 1VCMA 2GRJA 2PUFA 3NEPX 1X1TA 4UM9D 4ZI7A 3ZGNA 4HHEA 1AKTA 4G23A 2II6A 1BXZA 1E7RA 3QVTA 3TAUA 4EUKA 1JHUA 4QJ3A 3M6LA 4EHLA 5BXQC 3BE4A 3SYKA 2V5AA 4GXNA 1J07A 4FLMA 1AKRA 2I2FA 1JJ7A 1PF7E 5T41A 4FFNA 2F43A 1JLRA 5IHXA 2HC9A 2PRKA 3GJXC 4NFSA 2OCAA 3ZY6A 1S8NA 3LFTA 1W6RA 2XAUA 4PWZA 1PFGA 4J29A 4BBPA 4GOLD 5BNFA 2ZTUA 1GTJ1 6AT1A 2B2CA 3DZGA 2AF4C 1I9CA 2HBZA 1CUCA 3BFKA 1NU8A 3QVOA 4RESA 1GIAA 1TZ2A 4ENQA 2ZT5A 1V35A 4FK8A 4L7VA 4LOHA 1KJWA 1UXOA 1XEAA 3EPJA 4BLUA 4PPGA 2WWIA 2PXHA 4ZQEA 1M3SA 1U3VA 3SNHA 1VIYA 1YSCA 3HWRA 1ES9A 2JGKA 1CSEE 1M7BA 3CW8X 1GAJA 2XWQA 1EXVA 4CVNA 1YD7A 2P1RA 3KZNA 4WZBB 4YQZA 5G4LA 4D0SA 2JJMA 4R31A 6CHYA 4F92B 4D4HA 3GNTA 2QL7A 2G0AA 4FN4A 4LJRA 1TT5A 4YQYA 4JT8A 4YRPA 4BMNA 1BJRE 1RNLA 3KUXA 3GLKA 4FCVA 1ZMXA 5G53C 1YHZA 4ND3A 4HLUC 5CYPA 4YONB 1NASA 3ZU3A 5JPIA 3D0KA 3WK8A 2P5YA 1ZXXA 3OQIA 1G64A 3ILVA 3VPFA 1DQNA 1DO0A 1AQUA 1R9NA 3CEPB 2CXNA 1XRSB 4H1VA 4WOPA 4O4LB 4EITA 2XOKD 3CR3C 1ABEA 2ATCA 2OAP1 2HSDA 4RJJA 1SU7A 9LDTA 3Q4GA 3GI1A 3CEHA 3HG7A 4R0VA 5KU7A 2PZJA 4BMCA 3W0LB 1KMMA 2CC2A 2GJ9A 2WWXA 3PI7A 4IGIA 3ZH9B 3CH4B 1V5WA 4ERNA 3ZCQA 2W2KB 1E32A 1NNSA 2AFIB 2Q1TA 3A9SA 4W99A 3ZTWA 1F06A 1C9MA 4NMMA 1GG8A 3EVFA 1F6WA 4TRRA 4B3BA 4MRNA 5DF1A 3RYIB 2W6JD 1DE0A 3G2OA 2ZOSA 1Y1SA 3MXOA 5GAJA 4ZVUA 2QZJA 3KQLA 1RAFA 2IEAA 2PPLA 1QLHA 2P9TA 1Q6YA 3QVMA 2PWYA 1CE8A 3LCJA 4EABA 1AF4A 1I1HA 2K87A 3SBEA 4G84A 2WHRA 2NMVA 1SB9A 4WKBA 3AP3A 1NNEA 3GDGA 2FWNA 1ADJA 5J2TB 3JQRA 3L6CA 4B3TB 1G8KA 4HH1A 3TXXA 1XMSA 2GB4A 4CTKA 2L82A 1CU1A 5CAEA 4ZFNA 1PWHA 2FHPA 1RSZA 5FIUA 1UWCA 3K6KA 1WXXA 4INOA 1C30B 1F51E 4XQ9A 1Q95A 1E2NA 2R7LA 3BA1A 5AIAA 3B3QA 2SKCA 3GEEA 2FV8A 5AOBA 3N3BC 1G0OA 1U3FA 3EG9B 4X85A 5CVTA 2J7PA 3L4SO 1I01A 4BP8A 2C84A 1T9CA 3EW9A 3MJCA 2J3QA 2OFXA 4ER3A 1AKNA 1UKEA 2O52A 3QE0A 4TTRA 1SMKA 4KXXA 5B2EA 1EG2A 2WNSA 2BONA 1EM8B 2OORC 3UG6A 1YKGA 3E4DA 4GSKA 4Z0NA 2XTAA 3UA4A 1MRZA 4PG4A 3HS3A 3EX7C 4MHSA 3RAEC 4B80A 3H9QA 1GGJA 1ZN8A 1LDBA 1UPUA 3ND6A 4RZHA 1J24A 5FXMA 5JNTA 1ISJA 2O50A 4DADA 3C6ZA 4YPOA 5HF9A 2PUEA 1JN0A 1H0SA 1NXQA 3NWEA 4JLBA 2BSXA 4GMKA 3H5AA 3SYNA 4A6EA 3AKYA 4OQNA 4QFMA 1S2GA 4RWEA 3NZEA 3R8FA 1YS1X 1X7HA 2ZIGA 3T7RA 5JNUA 5D1HA 3DO8A 3MNFA 4QSMA 1E1CB 1U9ZA 2C5BA 2OD7A 3G2QA 1MKYA 4PNPA 2X0RA 2ZUDA 3CMMA 4BB6A 4KXUA 1KWKA 3OTQA 5LDGA 3K8QA 1ZCBA 1PTJA 2BZSA 5KO2A 2OP1A 4I50A 4HWSA 4L5IA 4LRYA 4S0ZA 1TADA 2Q5OA 3MMZA 3U37A 1SOUA 3U4CA 2HK7A 4EUSA 1ZD1A 3HYRA 1ENPA 4U2EA 3KOMA 1KHHA 2YS7A 2G9RA 4JXJA 1A3CA 4WBNF 4KQIA 3M4NA 2JIPA 1OQAA 3VNBA 4CTJA 5KNBA 1IY8A 3GAAA 3LUPA 4LDZA 3X1MA 4HNTA 3LCCA 3FYDA 5EOVA 1JLSA 1JYFA 3DYVA 3BOSA 3C1UA 3NX4A 5EESA 3R7WB 2BFAA 3QFFA 3ZEAA 1Z63A 3R74A 2GM3A 4U8GA 3KOOA 1X14A 1UJ6A 1VMDA 5F7ZA 2I7TA 1I4OA 2KE5A 4PS1A 1Z47A 4C2BA 4FFSA 3QW4B 1I80A 2XTJA 4HGOA 3MTGA 4PVDA 1DKOA 5SYAA 1GNSA 3FMOB 3RFXA 4JVLA 1PUJA 4LXUA 5C7IO 3OP1A 1LK0A 4CQLB 2QR2A 4EJMA 2XT9A 2IW1A 2PZMA 1T4CA 2K4MA 1O54A 2X9LA 1VC2A 3CZRA 2HNBA 1R0SA 2FFRA 1W1UA 2D1QA 3ZWNA 3IE1A 5H1YA 4RJIA 3KKKA 4C0LA 1W4CA 1JF8A 3F6BX 4N3BA 4YK7A 1T6ZA 2O2IA 1RWNA 3WWDA 2YMPA 4FE4A 4KSBA 5HZKA 1GDHA 1G3UA 1JPVA 3PJDA 4GNRA 1U9JA 4I5GA 4LX0A 4NC9A 3N2LA 3E70C 4MEBA 2YZ2A 4R4JA 4WNAB 1TECE 4MWOA 2A5DA 2O3SA 5CX4A 4ZT6A 5K8IA 2IY8A 3H19A 1CR2A 1XJ0A 1BXRA 5C1OA 1RLMA 4GBJA 4I5FA 5K8LA 4M46A 5HQ3A 1F8YA 1Z0AA 2WKWA 2QYTA 5LQCA 5TRTA 1A4UA 2GBLC 1HDYA 2IU6A 4NOJA 3I2IA 121PA 3NO4A 4EG7A 5FNVF 3WWEA 2I9PA 5HMMA 5CBKA 3BXZA 1OA1A 4LEIA 1V1MA 3G7SA 2EWVA 1QYIA 1CUJA 1M2JA 3NALA 5CDSA 2Q3EA 1V8ZA 4QDZA 4J75A 1VI6A 3WO1A 1RDFA 1JE1A 4GI7A 3E58A 4GBGA 2OZLB 2WTEA 3QOYA 2IX3A 1MB3A 3IBCA 5G1PA 3Q7QA 4GX2A 5KNBH 1PHRA 1K8ZB 1U65A 1RZUA 1KPHA 5KYVA 2QV7A 4BZQA 4Q7LA 3FR8A 1X7XB 4RM3A 4IIEA 3V8VA 5B3JA 4ETWA 3FCYA 5EWLA 1U9YA 4RZSA 4CF6A 4QYWA 2ZK7A 1KSGA 1GKIA 1GU1A 2VPWA 4KEAA 3W1VA 4JROA 5D3KA 4WNIA 3LO5A 2VO1A 1Z5PA 1WEHA 4M4SA 4IHJF 3EAFA 2CVZA 4XB2A 1BVYF 5HTKA 4C5AA 2ZPUA 5BSEA 3HE3A 2ZRDA 4AYXA 3OM9A 2QNRA 1JAYA 3Q3CA 2WZBA 3KEQA 4XB1A 4CV1A 2JIBA 1Z35A 4PSAA 1VG1A 2FF7A 4UUNA 1Z6QA 4BUCA 3IEXA 1DOHA 2WWTA 3UK6A 3ZZ0A 2VYQA 4R0NA 4KWTA 2NU9B 5FPKA 1O6ZA 1DT5A 3JQAA 3MBKA 3T3IA 3KR2A 5DK4A 1E79A 3CPSA 1ZS9A 1XLUA 4ETIA 4Q1BA 3AVUA 4IIBA 3UATA 3VAYA 4TYWA 4QBHA 4HFRA 1H0RA 4DSNA 1QTNA 5C81A 2FN3A 3D0RA 3I6QA 4PANA 4W7HA 1KO7A 1N25A 2IX9A 3IYLW 3T0IA 2W6ID 1Y1PA 4YV0A 1Q14A 3DAYA 2VH5R 4ARAA 4DWOA 5G0VA 4XAQA 2D1SA 1PQWA 2AG5A 3IO5A 5ESXA 3PNBA 3O2NA 4GZ3A 2PZFA 1HFKA 1JEJA 4ZZ2A 1M2VA 1G7RA 3MAGA 2UUOA 3DE2X 2P30A 3N86A 4FDUA 3KZCA 3EZ6A 2WV7A 4JELA 4L8FA 1GGFA 5J5VA 5I7HA 3S2EA 1F14A 3BD7A 1VHWA 3PEWA 1X1RA 1EB9A 2WKSA 3FSJX 1N2OA 4MCIA 3E05A 1RWVA 4M0MA 2IVZA 5FTJA 5DW0A 4KPEC 3U61B 2YASA 2EL9A 1OXKB 2XW6A 4PXYA 1DS6A 4NL4H 4OJNA 1QU2A 4DJDC 2V7QA 3HKCB 1VPLA 1NXXA 3S2GA 5TJHA 2FPRA 5B5SA 3M70A 3UWMA 1SG9A 1BDHA 2BMWA 3VI4B 4A0SA 2YWDA 1YZVA 1OGYA 1NZFA 3DGEC 3E9RA 5THXA 4GWKA 2G80A 4F6LA 3DXZA 5HF5A 2WSSA 2GWHA 4N0EA 3PT5A 5FUWA 2YJ3A 4MKIA 4BX8A 5KHAA 1PYOA 3ZNNA 2OB1A 2WK1A 3E03A 3PPIA 2XB6A 3ZI0A 2Y4NA 3HDGA 1TRKA 2V98A 2WJHA 3KALA 4PHTA 4C4YA 3G2JA 3WRYA 1Y8AA 5C1DA 1NXWA 3MSXA 2EG9A 1V43A 4X1YA 3ZEIA 1L7QA 1RWXA 2C2OA 3AUKA 3AHCA 3ECAA 3N2NA 3QNMA 3LLUA 3A1DA 4MUIA 3LP6A 4GNKA 1WHTB 3W1EA 1T36B 5L6MB 4KB5A 3N8HA 2AXQA 2JCSA 2O06A 1AXEA 1EVIA 1M2OA 3NHKA 4WLOA 1VL0A 4ZVLA 3ZNOA 2G5PA 3OQVA 5L3VA 2IC5A 4V0SA 2ODWA 3E5RA 4PZ0A 1WCIA 5M34A 1OBCA 5JFOA 2I78A 2X40A 1EX1A 3NKFA 5EIBC 4CIBA 3KOWA 3S27A 4ZOQI 2JLZA 4OIMA 2VBCA 4DTIA 3E5HA 3N87A 1FUEA 5IZCA 4GBMA 2O5EA 1QONA 1USKA 4L72A 4XDYA 1DKQA 2BEVB 2QXUA 5EMJA 3ADPA 3P9PA 4D41A 1QWSA 4PYNA 3ZGXA 2VZLA 4NPHA 1FP1D 4XSGA 3SLRA 3FOZA 1EQUA 2EARA 3PDJA 3S5UA 5K8JB 3ZDDA 2C4VA 2NT3A 4YP6A 5H5JA 1C41A 1WM1A 2XQKA 1U2TA 1P0FA 1RFGE 1VP3A 2GSDA 1V95A 2OV1A 2JIRA 4K7JA 5REQB 2W2XA 4CIVA 3ZXXA 5D86A 3F5FA 1BROA 1JR2A 2WIGA 2QAGA 3ORFA 3ZV5A 2CXSA 2B4TO 4RH0A 3JVEA 1F2TA 2BOVA 2IYRA 3S55A 2Y1WA 2JLXA 4RUKA 2F8TA 3FKJA 3RS3A 3U7RA 2ZSEA 3OEYA 1WUHS 3LWZA 1I13A 3LKDA 3L9XA 2V3WA 4O1HA 2BFFB 1ULUA 4M8NE 1ZZGA 2SCUA 2FSVC 3EC2A 3C97A 4A16A 4H7EA 4RD4A 1SUAA 3R3ZA 4NYMR 3UXEA 1BXGB 2DPYA 4BQRA 2QD4A 1E4EB 5ALGA 4X1KA 4CNBA 1XPOA 1QG4A 2F1JA 4XIJA 3TQFA 1RLUA 1XKQA 3FZGA 3PGXA 1OFVA 1T6XA 3AZQA 5J59A 2KMLA 3MGKA 3L5OA 1N1MA 2KBEA 4GZ5A 2PH1A 3LXUX 2XUZA 2ZPAA 3ABSB 2JK0A 2YKGA 2JCVA 4B6PA 1RHKA 2PGLA 3WQBA 2XWJI 5DT9A 4HR7A 5G1OA 3ZUPA 4TYPA 3K0FA 3WNBA 4PLTA 1MTOA 4TSKA 1MHPA 2VDNB 5KPJA 4NESA 1GEGA 1XDSA 3VRHA 3ZHQA 1KQNA 3GLFB 5DLEA 2R2GA 4JLOA 3VU9A 3CUSA 3TSAA 3KKNA 5EIHA 5IJ9B 1T2UA 2HU5A 4N5HX 5IF9A 3RM3A 1C9NA 1EVQA 3DMFA 1E9RA 4PR3A 4MRAA 4E4RA 4R8RA 3RWOA 3M83A 1Q11A 1LPMA 3KKEA 2IH5A 2V4MA 3EBLA 3FCAA 3GVPA 4QIHA 4WASA 1YBFA 3SC2B 1UEXC 3TKYA 2AR7A 1Q21A 4UM8B 3I0NA 2K7ZA 4FHCA 3U31A 3F9RA 3VR4D 1J8FA 3EAQA 4GICA 4DJAA 1G63A 1K75A 4O0LA 3QHPA 3A14A 4BY9E 3HL4A 3OP4A 2Y1OA 1NMYA 3D0QA 1G6KA 3LX8A 3VZDA 5LOVB 4M1MA 3ELBA 4G4IA 3S68A 4BYGA 2G17A 9ABPA 2C57A 1ZESA 1W9MA 1F0NA 2FW7A 4E6EA 3S28A 3A0RB 3E81A 3ESXA 4FXOA 5E6SB 3N0XA 3AJ9A 3SKXA 4D9NA 5KBYA 1IUOA 4JX8A 1DU4A 4BRWA 1H6DA 3B3FA 4CF3A 4LK3A 2OXTA 2VT2A 2GXQA 4HI0E 2P3QA 5GGYA 1ZD9A 3H9EO 3CH5A 1SB8A 4LZAA 4B6GA 2XF2A 3OZ7A 1D1PA 2MWMA 3RC7A 4FQ8A 3QUQA 4IX9A 1UOPA 3C70A 1T8TA 4CLDA 4G24A 2GO1A 1NVTA 1VE7A 3P9XA 2VXOA 3EZ7A 5CNJA 5FLEX 1B6TA 3DL4A 1XL1A 2Q7OE 4FI3F 1UOOA 3VZRA 4B75A 3GEHA 2GZ2A 2P4EA 3EGIA 1OUMA 3N2GA 3NBFA 2WR8A 3G2HA 5KSPA 2R6JA 2CXXA 3O31A 1NUPA 3H2IA 1SVMA 1D6SA 4TMFA 5HFNA 1ULAA 2JS7A 3IGFA 1NY6A 3JQBA 4DIOA 2P0AA 3FDIA 4S1OA 4CW7A 1FK8A 3K09A 4E5VA 1J8DA 3U5TA 1GGNA 4G1CA 4HV4A 1RI4A 1XALA 5I9LA 1BEZA 1PZFA 1VSUA 2ZUEA 1KY2A 1D2NA 2TRSB 2WVGA 3H4MA 1NF2A 4BKRA 2EX1A 4QLAA 3Q2IA 1BIFA 1P2UA 4A6XA 1RXIA 1USVA 3B1WA 4JR0A 4KAFA 3E8SA 1C7JA 3HZRA 1FE8A 2B9EA 5AHWA 2J08A 4IR7A 4N8EA 3L1HA 4QGSA 4EPXA 1PTJC 2MR5A 4IMIB 4KQMA 1K7EB 3H7IA 1RHUA 1M2FA 4UXJA 4KR9A 4HOYA 4NV0A 4E21A 1G8JA 1HURA 3RD5A 4FGJA 5CIQA 4L6IA 1BMDA 1JBKA 1NJ2A 1NJ6A 1Z45A 4YP1A 5ULLA 3HFRA 4I2NA 1JR3A 2LZ0A 1PD0A 4UC0A 3RUDA 4TLAA 3W5BA 4JMLA 3SDSA 5HCUA 3PUYA 3KYIB 1GL7A 2QLJA 3FXAA 5FF9A 1QX4A 4L50A 5EHQA 3DBOB 1ODFA 4ZIRB 1H2WA 3LK7A 2VP9A 4FTWA 4NAHA 1EFPA 3DBRB 4WGGA 1BWPA 1C2TA 1V1RB 1N8NA 2QQFA 4JHXA 1RBQA 1TUBA 2PQ0A 3HU2A 4NYIR 2GZHA 4LGCA