1KEVA

Structure of nadp-dependent alcohol dehydrogenase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
351
structure length
351
Chain Sequence
MKGFAMLGINKLGWIEKERPVAGSYDAIVRPLAVSPCTSDIHTVFEGALGDRKNMILGHEAVGEVVEVGSEVKDFKPGDRVIVPCTTPDWRSLEVQAGFQQHSNGMLAGWKFSNFKDGVFGEYFHVNDADMNLAILPKDMPLENAVMITDMMTTGFHGAELADIQMGSSVVVIGIGAVGLMGIAGAKLRGAGRIIGVGSRPICVEAAKFYGATDILNYKNGHIVDQVMKLTNGKGVDRVIMAGGGSETLSQAVSMVKPGGIISNINYHGSGDALLIPRVEWGCGMAHKTIKGGLCPGGRLRAEMLRDMVVYNRVDLSKLVTHVYHGFDHIEEALLLMKDKPKDLIKAVVIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADP-DEPENDENT ALCOHOL DEHYDROGENASE
publication title Crystalline alcohol dehydrogenases from the mesophilic bacterium Clostridium beijerinckii and the thermophilic bacterium Thermoanaerobium brockii: preparation, characterization and molecular symmetry.
pubmed doi rcsb
source organism Clostridium beijerinckii
molecule tags Oxidoreductase
total genus 110
structure length 351
sequence length 351
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.80: Isopropanol dehydrogenase (NADP(+)).
pdb deposition date 1996-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1kevA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1kevA01
3ICPA 3Q6IA 4BNMA 1KVSA 1RYDA 2BH9A 5DULA 1ZJZA 4RPKA 4GLOA 5JAIA 3GMDA 3GGGA 3VPSA 4XKJA 1YDWA 1NFFA 1K3TA 1QYCA 4YTEA 4PG8A 2FOIA 2ZJ1A 1T26A 4R51A 4CM7A 4CQLA 4DBVO 3JQEA 2EG9A 1YQDA 5JMPA 4DC0A 2WYVA 1P1KA 3VDQA 3O9ZA 4UEJA 2RAFA 3U0BA 4Y67A 5H81A 3HDJA 4DYVA 5TS3A 1C1DB 5CEFA 4BGIA 2BLLA 3JQAB 3Q3CA 3W8DA 1ZXLA 1Y8QB 2GASA 3WOHA 3A4VA 4I1IA 1ORRA 4YJDA 1CIVA 3U4HA 4NK5A 4OOFA 1GTMA 2VQ3A 1B8VA 5G0VA 2HJSA 4R5MA 1Y5RA 3DBHB 5T6BA 2ZB3A 3WNQA 4YQZA 4LMRA 3ANLA 1P1FA 4WGGA 2WDZA 1KEVA 3JYPA 2I99A 5B1YA 2VWGA 4H16A 4UAGA 1KEUA 2ZTLA 4KUEA 1C0KA 5DF1A 1H2HA 4XQCA 3UOGA 5IG2A 2ZIZA 3I5MA 3NX4A 4XQEA 5TRTA 1UJMA 2NQ8A 3TN7A 4BGVA 1CRWG 3DTYA 4HUJA 5EIOA 3TFOA 4BHTA 2PD4A 4XJTA 2XPCA 1X1TA 3H9GA 4O63O 3DZGA 1LSSA 3HQ4O 3W6UA 1YQGA 1R0SA 3I9NA 4J2OA 1JKFA 4PLZA 3WFIA 1UXJA 4R9SA 5TT0A 3GUCA 1H2BA 2O50A 4K28A 3OA2A 3ZHXA 3I52A 3B70A 2JFGA 2XXBA 1XSEA 3JQGB 3RAJA 3K9QO 2D4AA 3IDSA 3ONEA 2QIOA 3VAZA 4DYDA 4MDHA 2C59A 3W8EA 1C1XB 3E18A 2Y1EA 2O3RA 4RPHA 3GEMA 1WVGA 3JQ7B 4BVAA 1Q0LA 2X86A 1B8PA 4AFNA 1IYZA 3FF4A 4P22A 3RSHA 1HYGA 3IIEA 2HKIA 1ID1A 2LDBA 4N7RA 4D45A 1DPGA 1C0LA 1ZK1A 3Q1LA 1CF2O 3ADPA 4PVDA 3E8XA 2ZB4A 4RGBA 5T57A 3NDRA 1A4IA 3CTMA 3AM5A 3ANNA 2WD7B 2W4QA 3GPDG 6ADHA 2IYPA 5KVVA 1HLPA 4IJUA 2DTEA 3OF2A 2QW8A 2VOEA 3A06A 3LC7O 4IQ8A 4CUZA 1DSSG 4LGVA 2E82A 2IDZA 4JLWA 1IL0A 2GNAA 2GYYA 4Z9FA 3WJAA 5GZ1A 4D42A 4IQGA 1M6WA 2JD2A 1LDGA 4NJOA 3IKTA 2OORA 3O26A 4YT4A 1BDBA 2JFFA 2V6MA 3AM4A 3IQDB 2O3SA 4E6PA 1YL6A 1C3VA 2HK7A 4IM7A 2X5OA 3UCEA 5KKCA 3R6DA 3VZSA 2GERA 2JL1A 3NDIA 3NT5A 3RUHA 2DUWA 2OHXA 3DZFA 4R16A 1KVRA 4AJ2A 1A71A 1X13A 3H9QA 3INRA 2D5CA 1EFLA 4YJFA 2A4KA 3GAZA 3O8QB 3CZMA 5T8KC 1AXGA 4OXYA 1T2CA 5B4UA 2BI8A 3JQ8A 5CDUA 2TMDA 2WE8A 2HLPA 1GQ2A 1JQBA 4QX6A 4YAIA 1MA0A 5FF9A 4ALMA 4PRLA 1K2WA 1LC3A 3V2GA 2VNSA 3MJVA 1UR5A 2OOSA 4JGBA 5IF3A 2RH4A 3FNGA 2O7QA 3D4NA 1I24A 1V0JA 1J49A 1R4MB 1SAYA 4CM4A 1NWHA 1H9AA 1R4NA 3MEQA 3G3EA 3QY9A 4KQWA 3HN2A 2C5AA 2YFQA 4D43A 4IJVA 1PWXA 2DFDA 3VZQA 3PTZA 5ES3A 3ZWBA 5EINA 1CYDA 4BB5A 4MIYA 4BNXA 4LMPA 5JW6A 1HEUA 5JAMA 2Y1CA 5BSHA 1EDOA 4CM3A 1J6UA 2DAPA 3RIHA 2AQKA 4XZ3A 1R15A 4J9VA 4EEXA 4CQMB 5JY6A 4R41A 1RYEA 4HKTA 4NR0A 5K6AA 4WECA 1Y7TA 2A94A 1SOWA 5CPFA 4AJ1A 4PG4A 2AQ8A 1HDOA 3QQPA 3OJOA 3P7MA 3ZDFA 3QWAA 2Y99A 3E9MA 3KYDB 2CD9A 4D3FA 3JYLA 3PEFA 4GSKA 1HRDA 3P2YA 1RM5A 1JWAB 4L74A 3ENNA 3R3SA 4J7UA 2Y0CA 4E32A 3S2EA 3L4SO 3NTQA 2O3UA 1Q1NA 2I66A 4B4UA 2E48A 5JAZA 3AFNA 5FYDA 2UDPA 4M54A 2A35A 3CUKA 3E82A 3KLPX 2AG8A 1BSVA 1X0XA 5G4LA 1JTVA 4YQYA 1DIRA 4OIMA 1MP0A 4Y98A 1TT7A 5C37A 2PTGA 1P74A 3NJ8A 1WDMA 2D3TA 1Q7BA 4P4GA 5K6AC 1ISIA 4M55A 4RPGA 4AJHA 5BNTA 5DBGA 1KERA 4OSOA 4J90A 4FN4A 3VPGA 2RIRA 3AI2A 1NX6A 1T4DA 1NPYA 1NP3A 4UVGA 4EYEA 5I9MA 3TDKA 1K6JA 4PFJA 2AQHA 3I9OA 4ZVVA 4RQUA 4YAGA 3K5PA 1ADFA 4B7UA 5CDTA 4B8WA 1QYDA 1VRWA 2VOJA 2B83A 4RVFA 2PR2A 4XEHA 1MX3A 4CV3A 1BW9A 3H7AA 1PIWA 4FGWA 1H6DA 3JTMA 2HSDA 2NTJA 1S7CA 3OICA 4GBJA 5AXDA 3LC1O 3ZV4A 1OBFO 5IZCA 4RF3A 2PKRA 1B3RA 1NXQA 4BNIA 2J3JA 1R4NB 2Q2WA 4LRSB 4YYZA 4ZHSA 1NHWA 4IINA 2PD6A 2I3AA 4IDCA 3VVBA 2C2YA 1DIGA 1A9YA 3ETEA 5I9LA 4CV2A 1EBUA 3AY6A 4P8RA 3WICA 4DBZA 1DLIA 2B4TO 1KVTA 3TQHA 4NG5A 3BMOA 4M1QA 1NPTO 4TRJA 4BO4A 4HFMA 1XHLA 4MKRA 4CLOA 4J1NA 1YBAA 3BMQA 3ROQA 1G0OA 1YBVA 4JP3A 1N5DA 2GZ3A 1EUDA 2QQ5A 1GYPA 2VTEA 3BHJA 1QYWA 2VUTA 3DQPA 3TL2A 5I7EA 4LISA 1PS0A 4Y6PA 1GZ4A 4L76A 3CMCO 3U09A 4M87A 5A5EA 3FR7A 1HXHA 3QP9A 5IZ4A 5IZCC 4TKLA 3AI3A 1QLHA 4J1TA 2GF2A 2PGJA 2P9GA 2RH8A 1WLYA 4WCDA 4ITUA 3NT2A 1E6UA 4YACA 4WCFA 1DLJA 4KUHA 3ZNPA 4CMCA 2FY8A 3PLNA 3GY0A 4IGFA 3GGOA 1BDMA 5KNLA 1BXGA 2VWPA 1R12A 1TT5A 1Y81A 1XWFA 5L40A 3F6YA 4GX0A 2YHUA 3RWBA 3VVCA 4Z0PA 1M75A 2Y0EA 4QFCA 1RM3A 4G5HA 1PQUA 3WGQA 2WYUA 1MC5A 2B35A 2ZYAA 3MTGA 4BMNA 3OHSX 1PU2A 2XOXA 4DQUA 1IZ9A 3TF5A 1P31A 1NVTA 1B3BA 1ISHA 4NMHA 3H6KA 4B4WA 3GEDA 3SBOA 1SB9A 3CSDA 3EDMA 3WXBA 4M86A 5A9RA 1M2WA 3GNTA 4XYGA 4CM9D 3F4BA 3GNQA 4DMLA 1ADGA 1FJHA 1DJQA 1UDCA 3TPCA 5IJZA 3RUDA 1N2SA 4EJ6A 1V35A 3WQSB 4R3WA 2OO5A 3ZHZA 1LQUA 4FIZA 3JD0A 3M2PA 5I8ZA 4IJWA 4D7AA 4WCFC 4QSMA 4XGIA 3ZNQA 3LF1A 3DWFA 3MJCA 3CH6A 3WWZA 4MP8A 4YDRA 1VJ1A 2P4HX 3RFVA 4E12A 5CDSA 3S2GA 1E7MA 1DEHA 1T2DA 3OECA 1YGYA 4MVJA 4BKPA 1D1TA 4YJHB 1YRLA 1KETA 1LUAA 3BYZA 2VT2A 4S1VA 3KETA 1LQTA 2H5LA 1DRWA 5K0ZA 1K5HA 2AE2A 5GZ3A 1ZEJA 1KIFA 2YFHA 3JSAA 2PZKA 1E7RA 3EVNA 3TWOA 1JVBA 1U1IA 2F00A 3PHIA 4TZTA 1HLDA 3P2OA 1PQWA 1Q0HA 4XB1A 4ZQHA 3QA9A 4II3A 2E6UX 2IXAA 2V6BA 4N5NA 1MGOA 1KEWA 3ROPA 4XDZA 1XQ6A 3GMSA 4QFDA 3ICCA 2Q99A 2HQ1A 4R5HA 1V6AA 3ZU2A 1JAYA 5F5NA 2O3QA 1NVMB 3SJ7A 4GVXA 1Q7CA 4OSPA 3WFJA 2GUGA 1K6XA 5HA5A 3KSDO 3KEOA 3PZRA 1A7KA 4EJ0A 4XYEA 4CL8A 1EMDA 5IXSA 5TIIA 4A27A 5DCWA 5F1KA 3DZBA 1GQQA 5BSEA 2HK8A 3WGZA 3F4LA 1Q2XA 1TB4A 3NGXA 3TZHA 1LC0A 2DBVO 1EZ4A 1ZVMA 2V6GA 2Y67A 3BA1A 1I2CA 3QIVA 1U3VA 1EQ2A 2X6TA 3IS3A 4J6FA 5ER9A 5G4KB 1V3VA 4GPD1 5FEUA 1DJNA 1UXKA 4AJEA 2O3JA 4P38A 4X54A 1AHIA 2W2LA 5G0UA 1DC6A 1XEAA 5JSFA 1BXGB 1FDTA 1ZEMA 2OP1A 5DP1A 1DIHA 4RQTA 2O23A 1NBOA 5GY7A 4A03A 2NSDA 1YJQA 4RZIA 2QRLA 3INTA 3PYLA 3U49A 5FI3A 2VWHA 1E1NA 4BNJA 3GZNA 3L9WA 4PLCA 3ZHBA 3HDQA 2QYSA 3KUXA 2CF5A 2PKQO 2WMDA 4OYRA 3WYBA 1GPJA 2IZZA 3FSRA 3QWBA 4XCVA 4EUEA 4J4HA 1GFSA 4D44A 4INAA 5JS6A 5TT1A 1WW8A 4E13A 4DUPA 4L8VA 1XELA 1L7EA 1PX0A 2GDZA 5K1SA 2ZCUA 3IP1A 4BS9A 2CSUA 2I9PA 2E37A 3PRJA 2FMUA 2VHVA 1Z7BA 3DMTA 2C0CA 5KWEA 3E1KA 1PSDA 3V1TC 3TZ6A 2H1SA 3JCZA 1A5ZA 1VSUA 4MKZA 4U8GA 1BVRA 2GN9A 1KS9A 1P0CA 4DGSA 3EZLA 4OXNA 3TZQA 3H4VA 3BMCA 4DRYA 3F5QA 1ISMA 4RPLA 4DLBA 3OETA 1ZMOA 2OBNA 4IIUA 1HF3A 1NFRA 5MDHA 1JVSA 2QHXA 4W9NA 4LK3A 3UHAA 4M8SA 4UVHA 4QXMA 4EITA 1R37A 4WNCA 2Q1SA 1B2LA 2PY6A 3FWZA 5AXBA 3PLRA 1U8FO 3GHYA 1DXYA 3ROKA 4BNVA 3DZHA 1LBEA 1N9GA 4TMFA 4GAEA 1T2EA 5L45A 5L7WA 1P44A 3HDHA 4HNGA 3ZWCA 1T4BA 3RBZA 2HJRA 4NBUA 4D41A 3MJEA 4Z9YA 3QE3A 1PZEA 4FW8A 1QG6A 3PFFA 5A9TA 3HB4X 1F8FA 4E33A 4R01A 1PJTA 2C54A 2P68A 4E21A 5CFZA 2Q3EA 5LCXA 1ZXBA 2YHIA 4Y8VA 3EVTA 4LCJA 4W99A 1LDMA 2Q4BA 3EY4A 1UP4A 2NTNA 4NBRA 4BOYA 4DVJA 2IEDA 4A2CA 1E3LA 4UEOA 4A26A 4YAJA 2PA3A 1LA2A 2QX7A 3VPHA 2CVZA 3I6IA 3MCVA 4B3JA 5THQA 3NTRA 1DHRA 5COAA 4ILKA 5A1TA 2NU9A 1GYRA 3WGYA 1NYTA 4PZCA 2UVDA 2DBZA 1U2GA 2VZ8A 2FWMX 1IHYA 3NRCA 4DPMA 4Z3KA 2F1KA 4MIOA 1UDBA 2HUNA 1X14A 2XXJA 1FMCA 1EVZA 4IXWA 1X7DA 4LCEA 4BO1A 1R0LA 3BIOA 1YWGO 4CM8A 1NPDA 2BKAA 4UUMA 3K6JA 3FBGA 4B3IA 2UV8A 5ILGA 1D1SA 3VPXA 4R4JA 4YAEA 3WQQA 5DT9A 2GLXA 4GWGA 4ZU3A 5EMHA 5U9CA 4IY1A 3AUTA 5KJFA 2FPIA 1I33A 2GO1A 3RD5A 2FZEA 4ZA2A 2AW5A 3JQDA 3KYCA 3ASUA 3BHIA 4ND4A 3ONFA 3WGHA 2R00C 1Y8RB 1EVIA 1ZCJA 3PP8A 4PRKA 2Q1TA 2NVUB 3WMXA 3I23A 4D0SA 4YRDA 2I3GA 4YEDA 1I0ZA 5EESA 3PGXA 1TA4A 2HRZA 5TSDA 2C7VA 3ZWPA 4UUNA 1U8XX 3D1LA 2I67A 4KP7A 1P1IA 2XAAA 1B16A 2DKNA 3D4PA 1WWKA 1WP4A 2Q1UA 3KM0A 3ZWXA 1B26A 2CUKA 2D2IA 3SX2A 3VH4A 3PQFA 1ENZA 3VH3A 4R3NA 5CP8A 3F3SA 1ZSNA 1MLDA 3WX0A 4PLFA 3BHMA 3GT0A 4YT5A 4GX1A 4FFMA 3DFUA 1LTHR 3OSUA 3I4FA 5A9SA 4Q9NA 4DIOA 4F46A 3HFGA 1LSJA 2BFOA 3EGOA 2A9FA 3W4JA 2PH5A 4NJMA 2Q50A 1LRKA 5IFLA 4IS3A 4TRNA 3IUSA 3AW9A 3GDOA 3HFSA 4ID9A 4Z0HO 4ND3A 1LEHA 1E3SA 3WBFA 2D8AA 3B20A 3V1UA 1PJQA 4IMRA 4CLRA 2BFAA 1DRVA 1BMDA 4MVJI 1M76A 4C7KA 2X9GA 4BQRA 3RFXA 1ZIDA 5TQVA 3HE3A 1GR0A 1XDWA 4OHUA 3I83A 4PCVA 3ZNNA 1LX6A 3PGJA 2C7GA 2EKLA 3B1FA 5JMWA 3R1IA 3GQVA 2X23A 1JAXA 2AQIA 1EE9A 1U4OA 2AEJA 4WPGA 5B4TA 3AOGA 3O38A 3ZWVA 2BMAA 1PEDA 2EEZA 4BNHA 1XKQA 4XIJA 4RDHA 2EERA 1XIVA 3N7UA 3SC4A 3U4CA 4CV0A 4CPDA 5TX7A 1NASA 3D3WB 1BHSA 1NAIA 2YDYA 1Z74A 4KQXA 3OIDA 3OIFA 1QSGA 1V9LA 2YV1A 2JJYA 3D0OA 1HTBA 4A10A 5ILOA 1E7QA 5CDGA 1PGJA 3UH1A 3E9NA 1EFKA 3DAGA 1IULA 4UVEA 4NIMA 1VL0A 4J91A 2VHXA 3T4EA 1A7AA 1WMBA 1A9ZA 3MTJA 1H9BA 3GVPA 2GPTA 4OL9A 4FFOA 2V65A 2O4CA 4IDGA 4RLHA 4ZICA 3G49A 1PJSA 1LDYA 3DC2A 3C3XA 1MUUA 4NZ9A 3PJEA 2EF1A 2NACA 1WMAA 4DIBA 3EW7A 5T8KA 3PQEA 5G0SA 1M67A 4I5FA 4FFNA 2C07A 1D4FA 1AN9A 3JQ6A 1OI7A 4J2HA 1E1LA 1EBFA 3AY3A 4CM5A 1GUZA 4DQXA 3TOXA 3QW2A 3HHPA 4XYMA 4IDAA 3PWKA 1ULSA 2JHGA 4PGFA 3RJ9A 4CMJA 4HV4A 4C4OA 2AXQA 5JC1A 1ZZEA 3GRKA 4OKIA 2HRBA 1UXIA 3PI7A 3FCOA 3ZW8A 3EAGA 4YT2A 4UEKA 2G0TA 5ITVA 5B12A 2Q1WA 4CQLB 1SEVA 4IIVA 2JAHA 3N74A 3HNPA 4WOJA 1KVUA 4RCVA 3CEAA 2OMEA 3NV9A 2Y1OA 2J5QA 4J4BA 1HSOA 1PZHA 1QV7A 2O3TA 1ZFNA 2EWMA 1RM0A 2NVBA 4BIIA 7MDHA 1XU7A 3RUEA 5L4NA 1ZNQO 4BKUA 4HNHA 5K9ZA 4MVJD 5HS6A 3DHYA 3E9QA 6LDHA 5LDHA 2NTVA 4DWVA 4QECA 1PJ2A 3QVWA 1OAAA 1E3JA 1PGPA 1T2AA 1XLTA 3H9EO 4LSMA 2ZCVA 3DXFA 3NUGA 3DEYX 3PPIA 4TRRA 2CFCA 3C85A 2BFMA 5HWSA 3GOHA 1PZGA 4Q3EA 3DTTA 2DUUA 3KOUA 2Y0DA 1UDAA 4N5MA 2ZTMA 2UAGA 5HM8A 1FDVA 2EJVA 4WLUA 1G6KA 4GH5A 1L7DA 4E2ZA 1M66A 1FDWA 3OJLA 3DBRA 2HMSA 3K96A 2P9EA 4UUOA 5JBIA 1X0VA 2DBQA 2ZATA 3F47A 5EPOA 1ZK4A 2PK3A 1ADCA 4ALIA 4E30A 4QTZA 2X58A 1KYQA 5JC8A 1LU9A 3NKLA 1HWYA 1ZMTA 2Y93A 3BTUA 4HX5A 3K30A 4LVCA 2PZLA 5T67A 4ZGWA 3OQ1A 1PZFA 3Q9NA 2NVWA 3LQFA 4AG3A 3MJSA 1CERA 4Q3AA 4U6QA 1LRLA 3JD1A 5TNXA 1ZK3A 1DFHA 3CKYA 2DFVA 3E6AA 1B14A 3IKVA 4ZQGA 3LVFO 5EN4A 2EP5A 5KTKA 3RUIA 3ZU4A 4MJLA 1OC4A 2C82A 2W2LD 2ZTVA 5IXYA 1ZUD1 5AYVA 5CAEA 2IODA 2JKVA 3AU9A 4NBWA 1QLJA 4WLVA 1ENYA 1Q0QA 5L9AA 4ZN6A 3C8MA 3F1KA 4O6VA 4A5OA 3EHEA 3LT0A 3BTVA 4KWHA 2WYWA 4BMSA 1YONA 3AM3A 1JLLA 4GKBA 4E4YA 3OMLA 4BO9A 4E2WA 4RF5A 3Q2IA 4CMAA 4JXKA 3RROA 2FP4A 1BXZA 3ZN2A 3WLEA 3BMNA 3AFMA 1E1MA 1W4ZA 1SOVA 2IEBA 3AU8A 3I9JA 3DL2A 5ICSA 3GEGA 4CM1A 3A9WA 4E31A 4GVLA 4EGFA 3CIFA 5T64A 4XR4A 4UREA 4MO2A 1N92A 3C7AA 3S1LA 3D4OA 3QVTA 1VL8A 3UUWA 1XU9A 3ZWAA 1E7WA 1V8BA 2ZK7A 1YH3A 5CG1A 3K31A 1ISFA 1OMOA 3HSKA 3HG7A 4NI5A 3H3JA 5IN5A 3UCXA 1LDNA 4JIGA 4CV1A 1T1RA 4ALKA 2QZ9A 4J43A 3RU7A 4NFSA 4XR9A 4CR6A 2DC1A 1QRRA 1DDOA 1SNYA 1YQXA 4YJFB 3DOJA 2EKPA 3FN4A 4B3HA 1V3TA 1T1SA 4S3MA 3VZRA 4DREA 1U9JA 4O1MA 4KMSA 1LLQA 3JQ8B 1JKIA 1GZ6A 3DDNA 4GL4A 4XRRA 1O8CA 3ETDA 4IQ0A 3RC1A 3JQCA 3L0DA 3LC2O 4JCOA 1P77A 4IDDA 1IY8A 1LDBA 5KJCA 4CM4B 2RBEA 3O03A 4RF4A 3GDGA 5COBA 3GG2A 3TL3A 1E5QA 3RFTA 1U3UA 5LDGA 3TOZA 4BO7A 2JCVA 1MB4A 4GI2A 4KDEA 3JQFC 3CXRA 5JDCC 4YCAA 4QUKA 4ALJA 4HP8A 4B79A 3U4DA 4PLTA 3ITDA 3B1JA 1EDZA 2VUUA 1VSVA 2H63A 2NQTA 4JROA 2PLAA 1GL3A 1LJ8A 1E77A 2JD0A 2W8ZA 3FD8A 4WOKA 3V2HA 4MVJP 4BO5A 3EK2A 1I01A 3GGPA 1MXHA 4XA8A 1VJTA 5HS4A 1O94A 3QHAA 2ZQYA 1WNTA 2W2KA 1WZEA 1F0YA 1AUPA 2B36A 1N8KA 4D79A 5I7FA 4BO3A 4GMFA 4EZBA 2UUOA 1ISJA 1VKOA 4R1SA 2HAEA 2VYNA 5MGBA 4Q39A 3UXYA 5KIAA 1DAOA 1OOEA 2NU7A 3NT4A 3L9XA 4PLVA 3AI1A 3DBLA 4AJNA 2DTDA 4IDFA 2J3HA 3OQBA 4XIYA 5JLAA 4ESOA 3M2TA 4IDBA 5H82A 2NU8A 1HE2A 2FR0A 3KEQA 1ULUA 2J6IA 4I9NA 2Z5LA 3OP4A 1D8AA 2ILTA 4CMIA 3F1LA 4MVJF 4IZHA 3I6QA 4N5LA 5JXWA 4R68A 3DBVO 4GGPA 4HXYA 4CLHA 3U4IA 1W8DA 3ONDA 4QO8A 2X5JO 4TVBA 5A05A 4CODB 4WLNA 5KCZA 3ZU5A 1VPDA 1HYHA 4BNUA 5L7YA 4QO7A 3R0IA 2P5YA 1YB5A 4RLSA 1B0AA 4KZPA 4EUFA 3KZVA 3R3JA 1GEGA 1C0IA 1SCUA 3FRJA 4FJ0A 1GQYA 1KOLA 5BR7A 5G0TA 4J9UE 5L7TA 5KJ1A 3PXXA 2W98A 3ABIA 2BELA 2HK9A 2DVMA 4J0EA 1BW9B 4DIFA 1U28A 2HDHA 1ZK2A 5L3ZA 2X0RA 1HSZA 2P5UA 3N58A 5EJ2A 1X15A 4BNLA 3TZKA 1IUKA 2PD3A 1Z6ZA 4YRBA 3SXPA 2G82A 1KY4A 1P33A 1XG5A 1B7GO 1E3WA 2Q2QA 3IUPA 2AA3A 1ARZA 1HE5A 2DBRA 1GUFA 3WIEA 2P2SA 1ADBA 3C7DB 4BNKA 4WK6A 3FNHA 3NDJA 4ALNA 1PJLA 4QEDA 5AXAA 2EV9A 1GV0A 2I76A 4I9HA 2NNLD 4OO3A 3BMOB 1UP6A 2PNFA 4PLPA 5JE8A 3E5RA 2B0JA 3B6ZA 4CLOB 4TSKA 8ADHA 3DZIA 3GN2A 1AGNA 3BMQB 3UVEA 2CVOA 5DBFA 4J49A 1JU9A 1P1HA 1SMKA 1U3WA 3Q2KA 2OXIA 4CR7A 3DMYA 3ORFA 2AG5A 2V7PA 4FC7A 3WBBA 4LRTB 1ZH8A 1NHGA 1RPNA 1U4SA 4Y6SA 4DA9A 4FJ1A 3HJAA 2HMVA 4ONEA 3RUFA 1SPXA 4ZJUA 4MIEA 2X22A 3AUSA 4TZKA 4DTIA 2GZ2A 1BWSA 4Z0TA 1CDOA 1RM4A 4IDEA 1G0NA 4JK3A 4KUGA 4UUPA 3ZNOA 2IZ1A 1F17A 4IS2A 4WCFB 5TJ9A 4YRAA 1CWUA 3KHUA 5LC1A 1ZJYA 4PLWA 1UAYA 1NR7A 4FDAA 1PR3A 4D3SA 1TT5B 1TVEA 1P3DA 2VT3A 1U3TA 3RU9A 3T7EA 1YL5A 3W6ZA 3MJ4A 3QSGA 1AE1A 4C7JA 1DBVO 1SBYA 3RBVA 1N7HA 1UXHA 4JN6B 2JHFA 4NH4A 3PHJA 1MC4A 1LLDA 4JNKA 1B15A 1KVQA 3LF2A 5KVQA 4U7WA 1R0KA 3MZ0A 4UVIA 5B4VA 5JYEA 1GCUA 2HO5A 3H5AA 3ZWWA 2UUPA 3KSUA 3WG9A 1QMGA 3TSCA 4AICA 3HB5X 3JD4A 4XDYA 5DBIA 5FFFA 4EW6A 2PV7A 2PFGA 2QRJA 3MWDB 3VKUA 2AHRA 4OM8A 2Q49A 3FNEA 1YOVA 4OXKA 3V2UA 2D0IA 1LDEA 4J1QA 5CPBA 2J8ZA 4YJGA 3DHNA 2Y05A 4NBTA 1LSOA 1DB3A 2HMTA 2OBYA 2O7SA 2FZWA 2VYVA 3JD3A 5GMOA 1I8TA 2CF6A 2YZ7A 3IP3A 4FQ8A 1O5IA 3ST7A 5C3MA 1JA9A 5KVCA 3I9KA 5JO9A 4RF2A 5I7SA 1ONPA 3RUAA 4TROA 3OJEA 1VL6A 1A4UA 2GZ1A 1UXGA 4BO0A 4E3ZA 5HBRA 4FBGA 1F8GA 1SEPA 4A7PA 4PLYA 4FR5A 4XD2A 4YWJA 4BQPA 2X7HA 3COSA 3QWHA 3NYWA 3HADA 3W4KA 2GN8A 4AJ4A 3OEYA 1VE9A 1E92A 4B4VA 3U9LA 5CDYA 1S6YA 1CQJA 1DHTA 4D46A 2Q2VA 1PJCA 2Y1DA 3PJGA 4IMPA 4CMHA 2VN8A 3OM9A 5DNAA 1U2DA 1XQ1A 1N1GA 2HCTA 5DZSA 1AXEA 4E5NA 1WZIA 2OGUA 1VC2A 4LN1A 1GV1A 2BD0A 3NAQA 4GGOA 3FNFA 1BVUA 3OIGA 3ROMA 1WPQA 2R00A 1Z73A 2B4RO 1GEEA 1C1DA 3PYMA 4LSWA 1I3LA 3K73O 3JQAA 2D59A 2Y66A 4Q3BA 4OH1A 3RJ5A 3WWYA 1Y8QA 5JYDA 3ZWYA 3WGIA 1A72A 3Q9UA 2X8LA 4FOSA 3INGA 4RZHA 5AOVA 1HETA 2VRBA 4TKMA 3ZV3A 3AWDA 1DO8A 3DBHA 1ZK0A 1UP7A 2CMDA 4XYBA 1YL7A 3KB6A 5GZ6A 4U6SA 4QT0A 2RHCA 1EVYA 4CMEA 1HZJA 4BV9A 1EUZA 4K9DA 4RJTA 3KO8A 1T24A 4YXFA 1HYEA 3H2ZA 4AJIA 3FBTA 3FPLA 1GADO 5A06A 3QVXA 3GZNB 3VH1A 5I7VA 4NQZA 1Y5MA 4PN3A 5A5FA 3W1VA 2QZZA 3DZKA 3KLMX 3L6EA 5EQDA 3GK3A 5F5LA 3LT4A 3LLVA 3VH2A 4D0RA 1GU7A 2YJZA 2BGLA 1GZ3A 4JBHA 1HT0A 1HDYA 1PWZA 1Y9EA 2W90A 1KEPA 3WJ7A 1RJWA 4Y6RA 3JV7A 2P9CA 3GAFA 2J3IA 4HY3A 4J7XA 4TWRA 2HMUA 2DU8A 3JQGA 2OZPA 3LZ6A 2DTXA 3GLQA 3IC5A 2Z1NA 3DOOA 3ZWOA 1C1XA 4NPCA 1JW9B 3BMCB 3JQ7A 5A3VA 5DOZA 5DDIP 3PK0A 1F12A 3H65A 4L4SA 4CMEC 1P1RA 5C7LO 2FSSA 3LYLA 1VLLA 1K0UA 1I5RA 1ONOA 4DLLA 5IDWA 4NU5A 1ISGA 4Z6KA 3HDYA 4R9RA 3S55A 3BAZA 5TC4A 3K8ZA 3C1AA 5F3RA 4CLEA 4CJXA 1LI4A 1YB1A 3CPSA 2NUAA 1Y9AA 2Y1FA 1N9GB 2WD7A 3GZ4A 5BQFA 2B5WA 5T5QA 5TJHA 4RVDA 1UZMA 3GF4A 2WM3A 4CMBA 2RCYA 3D5TA 5F1PA 3S2FA 3JQ9C 3T4XA 2FRDA 3AK4A 2I6TA 4L73A 4ND1A 2AE1A 1LRJA 2YHIB 3BTSA 4PG7A 1IZ0A 4E0BA 2R2GA 1XA0A 1GDHA 4RVUA 3GVXA 1FF9A 4W82A 2C20A 1C0PA 2IZ0A 3PDUA 4JBIA 5F1OA 3L6OO 5IDXA 5FWNA 3DR3A 1PR9A 4B7CA 1D7OA 2NM0A 4I8XA 4OOEA 3TJRA 3VTFA 3ZWNA 5KOIA 3LDHA 4PLHA 1HE3A 2IXBA 1EEHA 2B5VA 3O8QA 2G17A 2O2YA 3DHEA 3OJFA 4A73A 4JBGA 3M1AA 3L07A 4PLGA 3X2FA 3GVHA 2PKQP 5ENDA 1VJ0A 4OMUA 5KKAA 2ZYGA 3H8VA 3LLSA 4TRMA 4ZQEA 4ZD6A 3RCBA 3D5QA 4OGWA 5IDYA 3VPFA 4CM8B 4DQVA 2GSDA 5ADHA 3G17A 1NFQA 4R1UA 4HBGA 2CDBA 1NQAO 1R4MA 2QRKA 5EQFA 4PVCA 1K6IA 4JX8A 2VYND 5C7IO 1R66A 1DRUA 3GVIA 1YBMA 1DOHA 4LVUA 4U5QA 1OZAA 1QXSA 1V3UA 1ENPA 4EUHA 2H6EA 3KYCB 2Z1MA 4L4RA 3OBBA 2Y1GA 1DIAA 1N1EA 2D5AA 2WEKA 2G1UA 4WEQA 4BGEA 2YW9A 3HUDA 1E5LA 1CQIA 1P45A 3P19A 4G81A 4MVJG 1SO8A 4JJIA 4CQMA 1I3KA 4EI2A 1LSUA 4E5KA 1CETA 2DT5A 3AUUA 1JKJA 1P9LA 3VTZA 1IPFA 3KYDA 3GFGA 1H5QA 4W7IA 1YJ8A 3RC9A 1EVJA 4R54A 1NTOA 1NQ5A 4NHEA 3EUWA 4XJSA 2B4QA 2FHSA 3ZHYA 5I9NA 3Q0EA 3OFSA 2EW8A 4I5GA 2ET6A 1ENOA 4YBZA 1WDKA 2JCXA 2I65A 3A28A 4WJZA 3VDRA 3UN1A 5A9SB 2AEFA 5KVSA 4IXTA 4ND2A 2VTDA 3GNSA 4WE3A 3GH3A 4FFLA 1I3MA 3ITKA 3AOEA 1FDUA 4NJMB 4GMGA 5BNFA 2IE0A 4Q3CA 1CEQA 1W0CA 1SZJG 1DC4A 4GKVA 3U62A 4E5PA 2YV2A 4KWIA 4AJPA 4WNIA 3X2EA 1Q7GA 4QQRA 1HDRA 5JCJA 1HDCA 2E4AA 4CLRB 1DAPA 1H0KA 4IJKA 5ENVA 3UGKA 3FPCA 1ZBQA 2BGMA 1UAGA 3PQDA 4IZIA 3BXXA 1O89A 3ASVA 1EUCA 3RC2A 5IN4A 3ZCXA 3AY7A 3WTCA 1U5CA 1H6AA 5CEJA 2G76A 4J7CA 3KRTA 2QG4A 4H3VA 4DXHA 4B8ZA 2ZYDA 2EJWA 2NV6A 1D3AA 3QVOA 3QV1A 1Z75A 1U7HA 3GVCA 3EYWA 4MPDA 1PS9A 3SC6A 2VHYA 4CMGA 2HMWA 3GN1A 3AOEC 4Q3NA 3G1UA 5B37A 4W7HA 3FTNA 4RV9A 3IL2A 3CMMA 3RUCA 3JYNA 4FCCA 3STHA 1JN0A 1F14A 2DQ4A 1LXCA 3WYEA 4URFA 3WTBA 1P1JA 4BNWA 4MKXA 1LLUA 2YUTA 2ZB8A 4I9UA 4L9RA 3M1LA 1X7HA 4XB2A 3B1KA 4RO0A 4XGKA 3WNVA 3PFWO 5HRUA 1CJCA 1GUYA 2CDCA 2O2SA 4UVDA 2C2XA 4ROSA 1TXGA 4FB5A 3WGTA 3SVTA 2P4QA 4ZQFA 3ADOA 5G2OA 3V5NA 4CM6A 4E5MA 3PJFA 4ZQBA 4Z3DA 4AJKA 3BTOA 1Y1PA 4F3YA 5AXCA 4XX0A 3W4IA 4F6CA 4U0JA 4HFJA 1XYGA 2YQ5A 2J5RA 4F45A 2EHDA 4J16A 4BMVA 4IGEA 3MOIA 4WASA 3U5TA 3GR6A 3AUAA 2TMGA 3WB9A 1I32A 1PJBA 1TI7A 1WDLA 4OJNA 2FR1A 2X9NA 2IYOA 3JQFA 1J4AA 5TLSA 5JDCA 2Q4EA 4GWKA 2BGKA 3RKRA 5L95A 4E5YA 1BTOA 1E3EA 3W8FA 1X7GA 5L51A 2EGHA 5H83A 4FSHA 3GFBA 5JO0A 2VNAA 4CLXA 2VYVD 3DFZA 1HDXA 4XGNA 1GCOA 5DOVA 1QP8A 3PDJA 2YQ4A 1T2FA 3DAFA 4NFHA 3LK7A 1ZKMA 4PIVA 3F9IA 4B4OA 5L4SA 1QV6A 3WS7A 1NM5A 2VRCA 1JWBB 3O4RA 3LSYA 4MVJH 4F6LA 4FS3A 5TF4A 4EDFA 2OFPA 1ZSVA 4B7XA 1XCBA 1YDEA 4NDNE 4EBFA 2WSBA 4FGSA 2DPGA 5I8WA 5AVOA 3V1YA 3HN7A 3DBRB 3F46A 2XF8A 4FPXA 4H7PA 4MP6A 1YVEI 3UKOA 2JAPA 2BI7A 3K2EA 2VZ0A 4JQCA 1LNQA 1O95A 5BT9A 1IE3A 4WUVA 1R16A 3PHHA 4K1LA 3E03A 4BUCA 4G65A 3KVOA 3SEFA 3LU1A 4FFRA 3S8MA 4YJHA 1O0SA 2GN6A 2OUIA 2ZJ0A 3U3XA 1PJ3A 1GYQA 4HWKA 1T25A 2FPPA 1I2ZA 3E48A 3EZYA 4DPKA 4BNGA 4WLFA 2JCYA 1FXSA 1DIBA 3UW3A 4ZRNA 4CL3A 3DAPA 3JQAD 2X5KO 1PL7A 2DM6A 4KTVE 1J5PA 2PZJA 3QLJA 4BV8A 1PJ4A 1MFPA 3JQBA 4ZRMA 4BKOA 1PQPA 5J23A 2VUSA 3P5SA 5HTOA 4K6CA 2NLOA 2GR9A 5ITWA 4BNNA 3RASA 2PH3A 1QORA 1AHHA 2GD1O 1GPDG 3S2IA 4MOWA 4BNZA 1SB8A 2YYYA 2JD1A 5COQA 1KY5A 4YB8A 5JNLA 3C1TA 1H6CA 1VM6A 3OJ0A 1HE4A 4FD3A 3WR5A 5G0WA 1QYXA 1Z45A 5FI5A 2CZCA 2X1HA 3CZRA 1TLTA 4M89A 3BMNB 4BB6A 4CUJA 3CINA 5EERA 4N18A 4NK4A 4H15A 1I36A 9LDBA 4HFRA 2Y68A 5G4KA 4DPLA 9LDTA 1VKNA 4R1NA 2BFPA 4M49A 4YPOA 4Q3DA 2UYYA 1PGQA 2ZKLA 3JQBC 3PHLA 4YR9A 1HKUA 5CEEA 2QYTA 2X0IA 1NAHA 5U4QA 3K92A 3MWEB 2X0NA 1X1EA 2EP7A 2AMFA 3PWSA 4HFNA 5BSFA 1PS8A 2WTBA 2BRUA 1MV8A 2YV3A 3GUYA 2JFHA 4RVHA 8LDHA 3WIDA 3ZW9A 1U5AA 4RVSA 5THKA 1OC2A 4AJLA 4HADA 3I4CA 3QWIA 4BO6A 2Z95A 1XR3A 3IJRA 1C14A 3PWZA 1E1KA 3KYBA 2CY0A 4GSLA 4BL5A 1HDGO 4E2YA 4WEOA 1YKFA 1J0XO 3KBOA 3VOSA 1RKXA 2ZTUA 3ENKA 2EW2A 3OH8A 3OQ6A 3TZCA 3WDSA 2R6JA 4GX5A 3NGLA 2CNBA 4J0FA 3GPIA 3KTDA 1FK8A 2Q46A 1Y6JA 1HDZA 3I9LA 5JCXA 4PZEA 1DFGA 3ZH2A 2J5KA 5JY1A 4L4XA 2H9IA 5ER6A 3ON5A 7ADHA 4MP3A 1EK6A 2EIHA 2V6FA 3L4BA 4CMKA 4L0QA 2C5EA 2FSVA 1Z82A 1OFGA 1UZLA 1B8UA 2I5PO 1EE2A 4YVFA 4NU6A 3QRWA 1FDSA 2GN4A 5BSGA 3ZV5A 3DOCA 3FTPA 3DB2A 4BKQA 1MG5A 2VHZA 4CR8A 5JPIA 3WQRA 4RDIA 1H6BA 1MXFA 1HL3A 4DL9A 2EKQA 1IB6A 3Q11A 5KJEA 5CHEA 5JFOA 3TRIA 3QVSA 2X4GA 3NTOA 1PL8A 4JP2A 4I08A 4Y9DA 3MJTA 1DFIA 2W2KB 2PGDA 1K89A 1YE3A 3D64A 3DO5A 5CG2A 3HZZA 4G2NA 4XQ9A 4AJOA 4EEZA 3LT2A 3JYQA 4YT8A 1BGVA 3D3EA 4DC1A 2GCGA 3UF0A 4IBOA 4RL6A 2O4UX 5KJ6A 1UUFA 3DBLB 1E0DA 3ANMA 3PVZA 4R1TA 1RWBA 2DPHA 2Q45A 2GRAA 4PZDA 4BNFA 1DC5A 2IRWA 4R69A 2B69A 3L4BC 1WXDA 3NJ4A 4GX2A 5A03A 5A04A 1KC1A 3A14A 4P4LA 4RVGA 1VI2A 4GQAA 5C7OO 4TVOA 4CMIB 5IDQA 4FFPA 4AJJA 2A92A 1PTJA 5BNIA 2PWZA 4N54A 2FR8A 1W73A 4W6ZA 5A02A 5L4LA 5JDIA 4YA6A 3RKUA 2EGGA 3I1JA 3GA0A 2CVQA 1GD1O 3FI9A 4XWYA 1DC3A 1EK5A 3IAHA 4CQMD 4J3FA 3SJUA 3H9JA 2D1YA 2LDXA 2WWRA 1E6EA 3PIIA 3PZBA 5F21A 2WE7A 3RI3A 3IOYA 3BZUA 1I30A 1GY8A 1IOLA 2WJPA 1ML3A 3SLGA 3H9UA 3VKVA 3WGOA 4NFYA 3A1NA 2FN7A 3KSZO 5AQ1A 2J3KA 1WAMA 2O48X 4A0SA 3RVDA 3PYXA 3AJRA 3WSVA 1I3NA 3L6DA 1NWCA 2OL4A 3H5RA 3LT1A 3NEPX 4NBVA 1KBZA 2C29D 1ZSYA 3GRPA 3PHGA 5IAAA 3K2BA 1EQUA 2ZB7A 5JAQA 3TNLA 1Y8RA 2NVUA 2NU6A 3FR8A 2X9VA 3PJDA 1E3WB 1GAEO 3I9MA 4P4NA 4UULA 4BKRA 5ICMA 5JDIC 3C1OA 4IPTA 3HWRA 3PIDA 5TGDA 3WYCA 1F06A 4YAKA 2VWQA 2ZQZA 3VZPA 1PL6A 1U7TA 2NADA 3G0OA 4O5OA 1QYVA 1JDJA 2BHLA 2GGSA 3G79A 3FWNA 4EJMA 5JCJD 3DONA 3ZWMA 1NNUA 3GDFA 4K26A 4KTTE 5U1PA 3UAGA 3EC7A 3EMKA 1KC3A 3SLKA 5DN9A 3MOGA 4DMMA 4WLOA 1NVGA 3RQSA 4BO8A 1BRMA 3UCFA 1NQOA 4JJGA 4II2A 4KOAA 4OKNA 4J4TA 5EL0A 1H93A 4CUKA 1ZO8A 3IMFA 2BF7A 4O59O 3ZI0A 4OAQA 1SC6A 2YDXA 4ND5A 1ZW1A 4BGUA 1E6WA 3M6IA 4TQGA 5DCYA 2P91A 4NNJA 3JD2A 2HU2A 2NWQA 1P0FA 2PGLA 1NQTA 4I5DA 4O0LA 4W4TA 3VHRA 2VHWA 1Z7EA 1MG0A 1A27A 3C24A 4IUYA 4MINA 2X0JA 3OEWA 3DZJA 3DMTC 1TEHA 2DLDA 2VCYA 1YO6A 1BXKA 3H5NA 3ETGA 3VC7A 4CLDA 4J1SA 3RBXA 5A4DA 5L53A 1O6ZA 1YXMA 3D7LA 2WD8A 3IJPA 1YS4A 3GG9A 1XGKA 4RORA 4L75A 4BNTA 3WMWA 4DLAA 2G5CA 2OP0A 1LLCA 4MVJE 3CE6A 2POQX 4W9NC 3WSWA 1IHXA 4WLEA 3I3OA 3F5SA 1L1FA 4K6FA 4D3DA 4ALLA 4AVYA 2FPGA 2B37A 3ZGYA 1G1AA 3QJ5A 4FC6A 4I5EA 4XQGA 2E49A 4AL4A 1YB4A 4WKGA 1PGNA 1W6UA 3UICA 1E7SA 1QR6A 2PZMA 4U0KA 3OA0A 5A3JA 3V8BA 3D3WA 1UZNA 3E5MA 2CDAA 4XYLA 2AEMA 3ULKA 4RPJA 3GC6A 4XRGA 4MVJM 3TFQA 3C7CB 4BNYA 2SCUA 1YOVB 3GHHA 2YY7A 3JQ9A 4JJFA 3ZU3A 3FHLA 4E2XA 5DCUA 3QWFA 3H2SA 1ONNA 1E3IA 4KDFA 3WGGA 4YJGB 3ZZNA 1UH5A 4GLLA 3RC7A 1E7YA 3KV3O 1M6HA 1I10A 3JYOA 2EXXA 5C5IA 1PGOA 4PG6A 3WLFA 1MFZA 1NR1A 4OQYA 1N7GA 1R6DA 3G1TA 3H3FA 4BO2A 4OQZA 1IPEA 3L77A 1H94A 2RHRA 3ZV6A 3T7CA 4LW8A 1O9BA 1QKIA 1HZZA 1BG6A 4FJ2A 1I2BA 4CM9A 4PG5A 4FOOA 5DP2A 3KXDA 3UFXA 2VRCD 4Z9XA 2VZ9A
chains in the Genus database with same CATH superfamily
3ICPA 2QMHA 4EG7A 1XMXA 1YZYA 5GIOE 1ZICA 2BH9A 2IBMA 1ZJZA 4RPKA 5FWYB 5A7FA 3IT0A 2D0DA 5K3EA 3EXG2 2J3EA 3GGGA 4H7JA 3HP1A 1YDWA 4I66A 4XKJA 1QYCA 4HYTA 5JQGA 4X41A 3RSQA 3E3NA 2XZDA 1T26A 4R51A 4CM7A 3I2JA 3E1SA 4QDUA 2AG1A 2EG9A 2Q5LA 2IWHA 3ID6C 5D3MB 1HE1C 4A2PA 1WSAA 1CUZA 2I4IA 3HXKA 3T1TA 3D6VA 4OPMA 3O9ZA 3U0BA 5ERGB 1O95D 2WJVA 4O4JF 5A3QA 4NBKA 3D7RA 1KL7A 1PJ8A 1ESMA 1VMKA 2ATEA 4NSNA 2XMRA 4I55F 4BGIA 2CN1A 1QOZA 2SKCA 3UB4A 3W8DA 1ZXLA 4ARCA 3IQIX 3X3HA 1CSEE 1VE5A 2GASA 2O1XA 2V7UA 4HDKA 5DU2A 1JHZA 2DWOA 4YJDA 2UVQA 2I1LA 4BLRA 2VQ3A 5G0VA 3E81A 3A04A 2C0QA 3WXMA 1ZI8A 2M1ZA 3DBHB 1CUXA 3IHTA 5BYAA 3DXZA 5KQPA 3UOAB 4RULA 1FSGA 2Z2JA 3THOA 4DCPA 4WRRA 2WDZA 1KEVA 2H9YA 3JYPA 5ALGA 2ZUTA 3MCUA 3RVSA 5B1YA 4R2KA 4UMFA 2O8EA 1X94A 2FAXA 1C0KA 5GJBA 3NASA 2PQ6A 2QY9A 1H2HA 1BS2A 3OLVA 3BM5A 3UOGA 3I5MA 3NX4A 5IG2A 1R6BX 3A31A 4XQEA 1KMNA 1OFVA 2ISSD 3HVKA 1TVKB 5LP6A 1VZ2A 4P58A 2SKDA 4L5YA 4QPNA 1CRWG 2QZ4A 1ORTA 5EXEA 5I7WA 1P80A 4F4UA 1ZJWA 3TFOA 5DBHX 1GCAA 3WK7A 4ZO6A 5D8DA 3M6FA 1YIOA 1MB9A 2V3WA 4U9IS 5EMNA 3C6KA 2ID8A 1X1TA 1QNFA 4GPZA 4RUKA 1Q74A 1WF6A 4MUXA 2WIBA 4BN0A 1V1RA 1Z5OA 3PUKA 3WFIA 1UXJA 3DE1X 4A16A 3SGLA 1PJZA 3ZHSA 5LFAA 4TSFD 1OB2A 2O50A 3GEPA 3L84A 2WW8A 4EJSA 2EBUA 1J22A 3HZHA 3VAZA 4DYDA 2HD4A 3C6BA 3FOCA 2IHUA 1COWA 4RHTA 1P60A 3W8EA 1C1XB 2Y1EA 1JECA 4RPHA 2VVTA 4N4AA 5DISB 3RIEA 5L3VA 1Q0LA 1EWRA 3G8CA 3L0CA 1GG9A 2X86A 2HA0A 4IGAA 4OJTA 4JYMA 4LJKA 4XSGA 4AFNA 5INTA 3FF4A 3RSHA 3FYCA 3OCJA 4F6RB 3PVCA 2GJAA 3K9WA 4HPXB 4K2AA 1CE8A 2LDBA 3AXTA 2EX4A 1DPGA 3SMQA 1CDEA 1RWNA 3Q1LA 5LP6C 5C9ZA 3P2EA 4OGFA 3AEYA 3T3HA 2WPDA 2OYCA 2ZB4A 3VYWA 2JIPA 1A5TA 3V32A 4UZFA 1A4IA 3DE5X 4EY3A 1J2JA 1F2TA 3AM5A 2NUAB 2PX5A 2WD7B 1RYBA 1VJDA 4OG2A 4ZVLA 4S24A 4GWLA 4IJUA 6ADHA 4TV8F 4CUZA 2VOEA 4IQ8A 3A06A 5FUXA 1R8QA 4JOBA 4ZYLA 2CEKA 2FPRA 1T0IA 2E82A 1JAZA 1CDZA 4EJSC 4YRZA 4OMCA 3LSTA 4NYJQ 3CCBA 2JH8A 5EP2A 5GZ1A 5JJ5A 1KDVA 4JLVA 1N6NA 3TL6A 5E7QA 1W76A 2JD2A 4JBXA 3RAGA 1U2PA 3F97A 5AVKA 3RNOA 3OQIA 3U7RA 1QVAA 4AMBA 4F7DA 1YL6A 1G55A 1N2CE 4QJ5A 4IM7A 2BZSA 3HKBA 4ZOCA 4DA7A 5A0VA 3R6DA 5GP1A 3L4JA 1N2ZA 2JL1A 4RELA 3NT5A 3V9AA 3VGJA 2OB1A 3CG4A 5LYYA 8ABPA 2XIJA 1OWLA 1KVRA 3DM5A 1A71A 4X7RA 1WS6A 3WZMA 4CQNA 2D5CA 4EY6A 2A4KA 1ZQ9A 4RTPA 3G23A 3O8QB 1V4NA 2V7XA 1AXGA 4ERXA 1T2CA 2C94A 1O5TA 5T4FA 5B4UA 1PNQA 2HPHA 4BEJA 4M1EA 4UNRA 1GQ2A 3NPMA 2TSYB 4R7TA 4WNAA 1KI9A 2QN7A 3PUHA 3V2GA 1LC3A 2CHGA 4J3NA 4KXQA 1UR5A 3H2YA 4LY9A 1LBTA 2VDWB 3V8VA 2RH4A 1RLJA 3D4NA 1Q0TA 1O6CA 1ZM4A 5MHTA 3EGXA 2J85A 3G68A 2QLNA 5FFNA 1NWHA 3MEQA 4E5SA 3G3EA 3PDCA 1FX1A 1OREA 3U7EB 3UPUA 1CJMA 5G3YA 3GIDA 4QM7A 4IJVA 3QXGA 3PSAA 3EZ7A 4YLGA 4MJ3A 4AWAA 2VQFB 2JBHA 4RHEA 3JAWB 3D3KA 2P0EA 1RACA 5D5HA 1NUAA 1SD2A 2VP3A 1ECCA 4ZI2A 4S04A 3QFFA 3HM9A 4I19A 3P96A 4AF8A 4L02A 2J6CA 2GK4A 4CM3A 2I91A 1TQ4A 4TKUA 4ZDIA 4XZ3A 4IRMA 1EH5A 3R3YA 4R41A 1RYEA 4NR0A 2MSDB 2A94A 2R8EA 4JLBA 5CPFA 1L8OA 1US8A 2AQ8A 4LDZA 4BQIA 1MNQA 5JSZA 2CCGA 4BC0A 3OJOA 5FPKA 5IJ0A 4R83A 2VAPA 4EF5A 3NH6A 4K9OA 4BECA 3ZDFA 3QWAA 2Y99A 3H0CA 2HHLA 1VJ5A 3JYLA 2IXTA 3EOAI 3PEFA 5CJ2A 4ZOLF 1KPHA 2QRZA 3P2YA 4B75A 1RAGA 1RM5A 2QD5A 4HQKA 4WT7A 3VJRA 1M6VB 3L7LA 4N7BA 4A8TA 4A92A 4J7UA 2PUAA 2FG5A 2PX2A 4MB0A 5JFGA 2O3UA 1NY5A 1Q1NA 2FJ0A 4NY1A 1Q17A 4NF2A 5JAZA 5GVRA 2GVZC 3RKSA 1EPUA 1EIWA 2BTOA 3NNDA 3AFNA 2ZIWB 1FUYB 4KRXA 4RS3A 2PUEA 2PBLA 1JS1X 4UHBA 1L4MA 2O2ZA 2PRIA 3ND5A 3HJHA 2WTXA 4E22A 5G4LA 2OCDA 3ZY2A 2PMBA 2A0XA 3WKDA 1DG3A 4ADSG 1K3FA 4YQYA 1DIRA 5B6JA 1Z29A 3PXUA 2IHKA 3E7FA 4TTRA 2XDWA 1YMQA 3PPYA 2RD2A 1TT7A 2B8JA 1IMJA 2O0JA 3AL0C 2D3TA 1RQ7A 2GA9A 2W6IA 2NYUA 2ZUCA 1D6MA 4N7MA 4M55A 2CE7A 2O05A 1H4QA 5BNTA 4MW6A 1YZ3A 4I8DA 3T3MB 5DBGA 1J39A 4FN4A 1WO8A 1E9SA 2AUNA 2REQA 3AI2A 4INOA 4QREA 2DH6A 4EY4A 2VYCA 3E9EA 3AH8A 1MB2A 4IAOA 1J97A 4EYEA 2QQEA 4PFJA 3UH0A 4JWKA 4RQUA 4B7UA 1DX4A 4B8WA 3L8CA 2JHPA 3TX2A 2A5FA 2P9ZA 1H2ZA 4C22A 2QBYA 3NBMA 2AOTB 3IAXA 4MDYA 4HX2A 1A0OA 1TCBA 4HNTA 4DDMA 4XEHA 1DEXA 4EF4A 4FQ5A 3I3SR 5E6SB 1BW9A 2DECA 4YAIA 1MPTA 1WW3A 4K9KA 3SIXA 4K6GA 3WV4A 1C1HA 4LRWA 3HBNA 1H6DA 4JT2A 3SF8B 5FOQA 4NWIA 1AGPA 4FSXA 2HFKA 3OICA 4OTZA 3LHDA 2WUGA 3TXAA 4ER0A 1QHGA 2DQSA 2NSLA 4P92A 2X4DA 4RD2A 1WABA 2HIMA 2NOAA 3JZAA 4YYZA 4BNIA 4ZHSA 1Z0SA 3BPSA 1NXSA 4IINA 1F4PA 4D0NA 1B41A 3KEFA 1CB0A 1RWPA 2ZWAA 5I9LA 1ANKA 1ILWA 1Z0DA 4X00A 3IRVA 1Q22A 3VR5D 1EBUA 1A9TA 3AY6A 4DBZA 3RVPA 3BGOS 2PUBA 4TLEA 3QUSA 1UKYA 2WSYB 4P6VF 4NG5A 2JGDA 3ZWDA 5KQGA 4M1QA 1NPTO 4KODA 4IZ6A 4C3UA 2V7VA 3OQHA 4BU1A 2ZW9A 3IVXA 2F1JA 2V9CA 2Q3FA 4J1NA 2BUAA 3T7TA 1STOA 1YBAA 4RWEA 3BMQA 3OOJA 3QTBA 5CJPA 2CXNA 1I80A 3GT7A 5JSYA 4N5DA 5HBGA 2QQ5A 1RD4A 4HWGA 4XSHA 1GYPA 5SV2A 3A05A 5EE9A 2R5FA 1XDBA 2BH2A 4TZ0A 1E0SA 2NPIA 4ZC1A 3DQPA 2JHAA 1VHTA 2QORA 3LWZA 4IXNA 5TARA 5IUJC 2NUPB 3SY8A 4XTCS 3PGKA 3K5HA 5AKHA 4L0DA 1HXHA 1TZMA 3I2GA 3LT5A 4C20A 2IFTA 3MJDA 3QP9A 3M6WA 3SZ3A 5IZ4A 4W7SA 2JIMA 3FYHA 2WPNA 2P9GA 1A5AB 3K0FB 3HXOA 4N3NA 5J5CA 2HWUA 1BCRA 1ES9A 2VUIB 3LA8A 1E6UA 3H42B 3A6PC 5IVDA 4F5YA 3ML1A 3EZGA 3BIWA 3GUZA 4KE9A 3ZNPA 1H65A 4GMKA 3GY0A 2D5LA 3OZWA 3F8SA 4B0OA 1CVRA 1Q21A 2RHWA 1BXGA 1N6OA 1CUEA 3I2HA 1HK7A 1TT5A 1XMSA 2HQBA 2X2EA 4M6WA 3F6YA 2IPNA 5AM4A 1RZRA 1ZL2A 4G9BA 1O58A 3T38A 1DKMA 4ZDJA 3CLVA 5KKNB 1T9KA 4IEIA 5KSYA 4FVTA 2O8CB 1DRJA 4QFCA 1T91A 3DMPA 1JSCA 3IAFA 3MJHA 1V4BA 2BKUA 2B35A 4GGMX 4PTYA 4MUMA 4B3MB 1UBFA 2H4JA 1V1MB 4V0KA 4YJ3B 1EDDA 1NRIA 1Z6PA 2EFHB 3N87A 3HUFA 3OHSX 4DQUA 4EHNA 2R4UA 2VHQA 4XWTA 2GM3A 3TLGA 2Z8XA 1W49A 3IBCA 4L08A 1YA6A 2EJBA 1WPRA 2HNAA 1VE1A 2VJOA 4EW2A 1SB9A 3OSZA 3KX2A 4O8CA 1UZUA 2O7RA 3UUEA 4CM9D 1DJQA 1ZY2A 4N0QA 3RUDA 5IASA 3C5VA 3WQSB 4B17A 1ZN8A 3I01A 5J5VA 1VHLA 1UM9B 2QN2A 4LHSA 3M2PA 5CXQA 4NCBA 3UNXA 3TSZA 1JQKA 4BMDA 5FX2A 4XGIA 3KQWA 3DWFA 2BE9A 3LF1A 3MJCA 3G2IA 4M7OA 3AO0B 2PBFA 1U0BB 3FVVA 4URUR 2HZ7A 3ZZUA 3R6TA 4QZVA 1E7MA 1T2DA 4FW9A 1K7YA 4MVJA 1JG4A 2EC5A 4UM7A 1U0HC 1YRLA 1KETA 2B2CA 3SVLA 2J0VA 3OZCA 4LF7B 3CGWA 3KETA 4IX1A 1SUFA 3EDOA 4HCJA 5H59A 5K0ZA 1NMXA 1E6MA 3PX2A 4MKGA 4KV9A 4W5NA 1G60A 4JZYA 4P7JA 5AKGA 1O2DA 3TWOA 1RFGE 3V34A 5NULA 5KNBH 3DGEC 4RX1A 1P73A 4N1AA 2Y92A 5JJBA 3O9MA 3R3WA 4RJ2A 2FW9A 1KPIA 3RJMA 3C3WA 3F5FA 4HN2A 3GLKA 3QA9A 2W48A 2XSZA 4II3A 5EIEA 1G20A 4N5NA 5HM6A 1ISPA 1UQRA 1NONA 3ROPA 1V5WA 3F74A 3WIOA 4QUGA 1FP4B 3G2NA 3HA7A 1NJ8A 2XKAA 3MUNA 1W0JA 4WMLA 1LX7A 2DWQA 1NVMB 5I5GA 2WTMA 5A4JA 1Q7CA 3D6HA 3ETLA 3MAGA 4OHCA 3IBGA 4OSPA 4YH1A 3ZKWA 4BDSA 4EJ0A 3KXKA 3GLUA 3L49A 1L4EA 4CL8A 2BFEB 4BBJA 1VTKA 1TGYA 1D0VA 1FS5A 5BSEA 3Q0IA 3MUOA 4OP2A 3WGZA 4C0BA 2HTFA 3F4LA 3ANSA 3CR7A 5EMMA 1O0CA 3KKQA 3RYIB 2DBVO 1JDPA 3GMIA 3TNLA 1R8XA 3VI4B 2E7ZA 1U3VA 5KTOA 1SCKA 3VRHA 5BN4B 5TEVA 1TQ8A 2JATA 1DJNA 3AKZA 4JHXA 2KW5A 4NESA 5KZMB 2GVNA 4JVNA 1JHPA 1DAFA 2W2LA 5G0UA 1DC6A 1CR1A 1QGOA 2V54A 2CXTA 1EFVB 3UJ8A 1E59A 4RQTA 2NZUG 3VTKA 3P71T 2FK8A 4UTXA 1AHPA 1AUVA 4A03A 4IV0A 1RWMA 2WLSA 2QRLA 2VDRB 5PGMA 5HZKA 5I51A 3HP7A 3U49A 1IWOA 1WQ1R 3M4ZA 3I2YX 4IJ5A 3V7WA 4ZYWA 5C4MA 1S2IA 2ZIXB 1A82A 1PVDA 1QIJA 2I55A 3ELUA 3WVNA 3TLXA 5JSUA 4L85A 2Y27A 2WMDA 2E4YA 4ZRDA 3NHRA 2OK8A 3NTLA 3OCCA 1UK8A 1E9AA 1XDDA 2A84A 4XCVA 4EGCB 4EUEA 2H1CA 4J4HA 1XXHB 1JL3A 2QT1A 3WKEA 4QU8A 2QUZA 2YJGA 4D44A 3DD5A 3CUEF 1CP2A 4JLOA 4L6CA 5HQTA 4OAOA 5JS6A 1NKVA 3VQTA 1Y8AA 1JHXA 1JIVA 1CDDA 1Z16A 4CG2A 1XELA 8ATCA 4U7FA 1TJNA 4C5BA 5AVUA 4TYYA 1E66A 4RYDA 2H07A 3IP1A 1TLFA 3CF4A 2CSUA 3OIUA 4OHKA 5DMXA 5HRCA 3U3KA 5LQCA 1KZ7B 3N0XA 3ZDZB 4DIUA 3HPQA 3IAM6 1Z6GA 2MDTA 1KH2A 1MEOA 5AP9A 4F93B 1P1BA 4YMLA 3KWFA 4QDTA 2EOAA 4FOPA 5TVKA 1Z13A 4IGKA 5K0TA 2IPMA 3FFTA 5EZQA 4ECAA 3I58A 4DGSA 2QX6A 4OJMX 1HT1E 1S01A 4YAFA 1OHHD 2W6CX 1CFJA 2D00A 1QQ7A 3NVAA 3HXLA 2J7PD 3FDFA 4QBHA 4RPLA 2IC5A 3OETA 4JXZA 2WFZA 3G85A 4X1KB 2IEZA 5MDHA 4NE2A 3PKZA 4WZBE 3IUJA 2NZWA 4Y6GB 5AIBA 4UVHA 4QXMA 5DBOA 1J1UA 2ESRA 4FNOA 3PEEA 4QOIA 2JLWA 1MIOA 3PFKA 4JENA 1B2LA 2PY6A 3VFDA 4DLVA 3OQPA 3PLRA 2JIOA 2XR1A 3GLIB 2ORIA 5L6MB 1Y9ZA 1DTWA 1L7NA 3ORYA 3FMFA 3II6X 5L7WA 5I6DA 4F4CA 1R3UA 1RR6A 2MWMA 2Q3HA 4ZFNA 1XVIA 1T4BA 3WO1A 3GNLA 2HJRA 4GM4A 4NBUA 2YWJA 3MJEA 4FHEA 4L50A 5FPTA 2QPAA 2IUSA 3A9CA 3QE3A 2WKRA 4P2GA 1T9GS 4LECA 1JTEA 4U3JA 4FW8A 4WK0B 3QU7A 3N59A 3CONA 5A9TA 3BBPA 1F8FA 4R01A 3R7BA 1IBRA 2P68A 3TVYA 5CFZA 5LCXA 1A7UA 2H57A 3KFXA 3NDPA 4PM4A 5I9TA 1UP4A 2AS0A 2NTNA 1YF3A 3EEQA 1NZFA 1E3LA 1T9GR 1NMYA 5J40A 1G18A 1IK6A 1C7FA 1P0PA 3CNLA 1D4OA 1H2EA 4N5IX 2ASEA 4IHAA 3CYFA 5KBYA 3MCWA 3FZNA 3NTRA 1DHRA 1E2LA 4P81A 4BJ5A 2QP9X 5A1TA 1GYRA 2A9KA 3F2VA 4HTFA 3WGYA 4KXYA 1IAVA 2PGNA 4A0QA 1R0RE 1KIAA 2IUTA 1OZ0A 4WJLA 5M34A 3QBEA 4UBNA 1U2GA 3ODPA 2FWMX 1C3JA 1AVTA 4ER3A 1JH8A 1UDBA 4DA6A 4DA8A 1EVZA 1JMVA 13PKA 1VIMA 3F3KA 4X93A 3TR0A 3W6PA 4URZR 3F0TA 2DSNA 4UUMA 2OCKA 2N3ZA 1CIJA 4XM2A 1XRRA 2QSYA 4B3IA 5ILGA 4H60A 2OY0A 3N53A 2CLSA 4R4JA 3OU7A 1KZ1A 8GPBA 1S9HA 1X86B 3QF4B 4GWGA 3L7OA 1V2GA 3KXLA 4PNHA 4G4GA 3WQQA 3BF7A 1NJFA 1NJ1A 3SJCA 3Q72A 2OLJA 3P2MA 1SXPA 1KAQA 1Y6FA 3T95A 1V25A 2J09A 2ZUSA 3JQDA 5TGZA 1NBMA 3WGHA 1OW3B 2W9XA 4NH0A 5AK4A 2H7VA 1RHMA 2Q4OA 2Y71A 2WUVA 4PQYA 5BWOA 5IX8A 2XE7A 5FUBA 4D0SA 3WO0A 1FXWF 3FVQA 4YEDA 1P39A 1CUGA 1CZNA 3HA2A 3R24A 3N8HA 4X95A 5EESA 2HRZA 5TSDA 4AN4A 4DCGA 2VSFA 4UUNA 5SZJA 1OFUA 2QPLA 3DKKA 2I67A 3BXFA 3KFLA 3KSRA 5ALNA 1CJKC 4P4TA 1LPNA 4UQPA 3ZXUB 4D5GA 1L5HB 1B16A 1U2GC 2C57A 2HWKA 2WJGA 3D4PA 1FSSA 1NQXA 2OG2A 1WWKA 2GVDC 3C7KA 3P9XA 5HGJA 3IBSA 4HDNB 4RA9B 5CB4F 1Y9DA 5CT9A 2Q1UA 3OLCX 5SICE 3RTGA 3UBMA 1U3FA 2D2IA 3KZMA 1FFHA 3HP4A 3VH4A 5DM70 4K03A 3VH3A 2EFCB 1SCQA 1ZSNA 3F3SA 4Q3KA 1L7QA 1NJ5A 3C8ZA 4R9NA 3WX0A 1ZVVA 3WLLA 3IOBA 3D6TB 1G64A 2YHAA 1M7HA 3BHMA 3ZOZA 2BBSA 4GX1A 4ZEMA 4FFMA 5JLJA 4V3BA 4B83A 1LTHR 3IP5A 4EB6A 3U3ZA 1E2FA 2FLVA 3B2NA 2QP3A 3HFGA 1LSJA 5E7JA 5H16A 5HJEA 1Z6XA 3DE6X 3ELWA 4QUHA 5K0CA 2IS1A 3UJHA 3V8MA 3EGOA 1LV8A 1JDZA 3PD1A 2YVLA 4RSRA 4D3ZA 2YVAA 2I3ZA 2R8BA 4NJMA 2VP5A 3BGIA 3N2KB 4URYR 3DNFA 1W8IA 5IFLA 5BW8A 2R85A 2CNWD 3PG5A 4U7DA 3EGDB 4WA7A 1QANA 3L6CA 4W1SA 1XEXA 2C9ZA 3GDOA 4ID9A 4XWWA 421PA 5IKEA 3FOAA 2ZE8A 3S2YA 3WE7A 3UC5A 1AHNA 2D8AA 3B20A 1ND5A 1FFXA 4KJZA 1RJ9A 4D3YA 1H5NA 4GUDA 3A3YA 1WY5A 4CLRA 4IMRA 4S05A 5FPSA 1DI0A 3Q7PA 4PGHA 2DQYA 4BVGA 1DQSA 4FYHA 2PIDA 3O4JA 3RS4A 3TSCA 1FBTA 3PBKA 4FCTA 4Q34A 3VVLA 4BMYA 4DM7A 1XPJA 1K8QA 2DPYA 2X1MA 4TXJA 5EQTA 1Z5ZA 5A5EA 3IE1A 1VG9B 1LX6A 3PGJA 3QLVA 4G0NA 3V3KA 4MS1B 5JMWA 2X23A 3JVDA 1D2EA 3PD7A 2QE7A 1EE9A 2GEJA 3D5EA 3S2ZA 3S5JA 4W5OA 4URXR 2OLKA 2KPOA 1L8XA 3AOGA 3FPFA 1I9GA 2NUTB 1TCVA 4U7HA 4HQOA 4XIJA 3SIRA 3TNJA 4AP5A 1CG6A 5PNTA 1JQJC 3ROTA 1EVLA 1S2LA 2ZBVA 3FGPA 4U5XA 3RRYA 1RKQA 5JMOA 1JHUA 3EIEA 1C9KA 1GGMA 4KQIA 3ZGZA 2R7MA 1YRAA 5LLTA 1IN1A 3DOIA 3GRYA 2FVYA 4EJFA 3B8EA 4WKNA 2QDKA 3TVTA 4LXGA 4HS4A 3OUTA 5I8PA 1O77A 1EFPA 5CDGA 3SF0A 4JI0B 2A4MA 2FX5A 3H8JA 1UKAA 1ZNZA 1NT4A 1PV1A 2FPIB 1PFYA 2F3PA 3DVQX 3QJYA 3KAPA 2GH1A 3P0IA 4GD3Q 1YUBA 4NIMA 4X6XA 3HB1A 4HAIA 4J91A 3SFTA 5AICA 4RTLA 3LPCA 5LIRA 1A9ZA 3A9UA 1WKBA 4TWBA 3GVPA 4NBNA 2GPTA 5EPEA 4FFOA 4P4UA 4LYGA 5AW9A 1QHEA 3DFKA 4CHGA 4ZICA 3LVRE 4ZALA 3DC2A 3T5MA 3C3XA 3C15C 1MUUA 5C0OE 2WWTA 2X3UA 1LH0A 2YWFA 3BCHA 4R8LA 3RT9A 5G0SA 3CUVA 1M67A 4EABA 2E1PA 4QU5A 1R6VA 3OJXA 1AN9A 4J2HA 4TLAA 5DASA 4HYYA 2J0SA 3ZJUA 1GUZA 2FXVA 4JSYA 3PGVA 3QW2A 2YICA 3ZX4A 4DQ0A 3PWKA 4WIAA 1ULSA 3RJ9A 2QRQA 5JC1A 2OAQ1 1W4CA 2B9EA 4YK7A 3L0IB 5TQ0B 2CLIB 3ZY6A 2VP0A 3MS2A 1XZKA 2X8JA 4AF7A 3GELA 3FCOA 3H5TA 3N7AA 1BEEA 2G0TA 4FEAA 2BE7A 5ITVA 2OO3A 2VR1A 3G9UA 4D74A 4KAAA 1FNNA 2JAHA 5D5QA 1K66A 2GXUA 4RCVA 4WERA 3VMMA 1LZKA 4PZLA 3OF3A 3Q5GA 4OK3A 2ZPUA 4F0JA 3W6OA 3NEYA 2Y1OA 4HXFB 3J81k 1WIWA 2V98A 1XAIA 2O3TA 1ZXXA 1YMUA 1UKEA 2EWMA 3IBFA 4Q4JB 4BKUA 4A23A 2HBZA 4KQHA 1S8AA 1JBEA 5CLJA 2TECE 4KYTA 1JSXA 1X1RA 4EA8A 2JCBA 4DWVA 5KTSA 3EA5A 1W4AA 3QVWA 4IIEA 1OAAA 1PGPA 1T2AA 3DMNA 2RBKA 3W78A 1M7BA 2G9ZA 1CJTC 2ZCVA 3NUGA 4HDMB 3L1HA 3TBKA 2BFMA 2Q5IA 3GCZA 5F2KA 1YE8A 4MUKA 2PT5A 4C6HA 1KOJA 3COWA 1T4GA 3DTTA 2W83A 3IEUA 4K9NA 3LA6A 5AKZA 4H3SA 4KHZA 3AEKB 1UDAA 1GSHA 1JX6A 2VJYA 2ZTMA 4N5MA 4ZVUA 1QHIA 4G56A 4DY4A 1G6KA 4GH5A 1L7DA 1S2DA 1G59A 2FPLA 4UNSA 1GARA 2DKOA 1XD9A 3OJLA 4NNPA 2F6RA 3EA4A 1JDVA 5KTNA 5HZHA 2P9EA 1QDUA 4L51A 5JBIA 4HZGA 4TGLA 5K3CA 1P7ZA 3NEJA 2G70A 1PSWA 4JC0A 1B73A 2PK3A 1L4GA 2D06A 4HO1X 3PA8A 4TMXA 3DTVD 2MINB 2VK8A 1D8TA 1KYQA 3E2PA 4D6XA 1N4AA 1HWYA 3DQZA 3BTUA 5T67A 1UMKA 1Z28A 4IIXA 4ZGWA 3HUEA 2GPAA 1KQPA 2H8GA 3ZS9A 1XZBA 4BE4A 2NVWA 2B4AA 2QK4A 3ZD8A 1BDIA 3GPCA 1KDRA 3ELYA 5IK2D 2YFYA 1XDUA 4ZT4A 1RI2A 3EVGA 2R4TA 5TNXA 4Q1BA 5JZSA 2GD2A 2QN3A 2VXCA 3H9CA 2BKXA 1UJ6A 2XYVA 3IKVA 2YIDA 2PG3A 5EN4A 2HA5A 3LCRA 4HDSA 4YO8A 2EP5A 1FY2A 5KTKA 1CB7A 4INJA 4X7BA 3Q8WA 1P29A 3ZU4A 2P62A 3FKSA 1OC4A 2C82A 3SQOA 2ZTVA 4PX5A 2E21A 1GQOA 5K0GA 3FTEA 1YAJA 4F2PA 1S3SA 2JKVA 4NBWA 4BLUA 2ERCA 2XMCA 3C8MA 2RAVA 1DS6A 3I37X 1IBCA 3LT0A 2RKWA 4YRQA 4B74A 1VLQA 3K6KA 3VNUA 5ARBA 4TX1A 1EXWA 3AM3A 4BQOA 1ECFA 4QEKA 1SIWA 3AUKA 4IWNA 4PRYA 4EI9A 4IFIA 4MQEA 2FH5B 3U7JA 4LK2A 1K86A 2QAGC 2QX9A 3SM3A 4MVJG 4TWZA 4EEKA 5FKJA 2O0MA 3R7SA 4LXYA 2IYXA 5K0BA 1F0KA 1RHJA 1RLMA 2JRCA 1G2PA 1E1MA 4FDUA 5FWXB 2J3DA 1SCNE 3KAJA 4HSEA 3ZOKA 4D8WA 2PSFA 1W35A 2Z04A 3UG7A 4GVLA 3CX6A 1XCMA 1MENA 5TVGA 4MO2A 3QUCA 2FPMA 2VYFA 2VTBA 3D4OA 1M1ZA 1W9HA 4ZOBA 1OZFA 4D92A 1VL8A 1XU9A 3ESZA 1ETUA 1V8BA 4YDQA 2R4QA 1KP3A 2ZK7A 3EVCA 1NI5A 2RIPA 3FDIA 1YI0A 3G6KA 3HSKA 1P5HA 4YECA 5LYJA 5BN5A 1U6KA 1CY7A 1EHCA 1LDNA 3MWEA 1M8GA 3KTFA 3VSAA 3TNYA 2QZ9A 4ALKA 3L06A 5DM2A 1MR3F 1V11B 1C3OA 4H7DA 1Z07A 2DC1A 3DOJA 2EKPA 2RGWA 1JLRA 3FN4A 1K3UB 1L5SA 3IVCA 5F35A 3E22B 3DDZX 4CRWB 1NBEA 3LBIA 5I4KA 1T36A 3JQ8B 1O97C 5LQKA 1JKIA 1P5FA 1DBIA 3DDNA 3P9SA 4GL4A 2ZP1A 3BH7A 4TV8B 2I7CA 3P4XA 2VP4A 2WNSA 5HCNA 6NULA 3T7JA 1CZKA 3JQCA 3OIWA 2F3RA 4I4TF 4QTTB 5FPYA 4XLLA 1X1CA 3NHSA 4YQFA 2IPOA 4AXBA 4CM4B 4GOND 3AESB 4Q7LA 1E2IA 2JGAA 1CVIA 5EE0A 5HFNA 5COBA 3TL3A 5D5PA 4CKCB 4UUAA 1MJFA 3OZ7A 1GPYA 2PS9A 4WOPA 1Z4NA 4B6RA 1MB4A 4F97A 4FWTA 4E4RA 3MB8A 3CXRA 4MULA 4MARA 4UNPA 3M33A 5E3JA 3VTAA 1JEQB 3C5EA 1YNSA 2E18A 3TSWA 1Y3CE 5L6LB 4GL2A 3NM5A 4F9TA 1EA7A 2W4MA 4HRAA 2GZMA 2J9RA 2H52A 1XAHA 1C41A 2HU5A 1CD5A 2NQTA 3ZY5A 1LJ8A 3VR2D 4A6XA 3CTPA 5J1SB 5ALJA 3ZGOA 2GNPA 3IA2A 3B7GA 4BFXA 5FAXA 1XCOA 3V2HA 1SZPA 3DDHA 3GLRA 4XUCA 4QHSA 3A32A 1I01A 1GNTA 3GGPA 4GSYA 1MXHA 2ODEA 3HCRA 3IV6A 3GD5A 4K9SA 2CDNA 2ACVA 4IFTA 1I6LA 3UGQA 1RJGA 5FD8A 3QHAA 1JILA 1XBTA 1RQXA 2JS7A 2VF4X 2ZQYA 3ESYA 1WZEA 4FEYA 1AUPA 2C4WA 1U7WA 3Q12A 4FYJA 1N8KA 1A2KC 1ZZGA 4KLZA 4QXPA 3QLUA 2P2NA 3BFVA 3ZK7A 1V7QA 5DVZA 2IW1A 4R1SA 1G19A 2VYNA 2IHJA 1WXEA 3UXYA 2P11A 3DEFA 3Q4GA 4LTMA 2NU7A 5SYAA 3AI1A 2BSXA 4GE3A 4P5DA 5DNDA 5FHRA 1QU2A 2J3HA 5E4JA 3VOAA 3ZDXB 1YCGA 3M2TA 4NOKA 1O95C 4IDBA 4OXRA 3SR0A 3FWPA 3CV3A 5CX1A 3W2GA 2FUNB 2GNOA 4DADA 3OKPA 4Y2RA 2FX2A 2X0EA 4BXOA 3JPYA 3M4JA 1N2XA 1TIBA 3PQ7A 1UODA 3FSGD 1QH8A 4GGPA 1DQYA 2JANA 3HY3A 3U4IA 2VHTA 2NPFA 2CSXA 3GRUA 4TVBA 4CODB 1U63A 1QHSA 3MAJA 4QUAA 3V42A 2UZ4A 4N39A 1E0AA 3P27A 4UDYX 1D2NA 1HYHA 1UPAA 2ZWVA 4RKWA 2P41A 2W2XA 3D81A 2P5YA 3AKEA 3F6BX 5L7YA 2Z6UA 4UPDA 3D59A 4KNWA 5L3SB 4TKVB 3A4TA 1PBTA 3HR4A 5JG7A 4D4MA 1W87A 4PBSA 3B1YA 3QLUC 3DLPX 5BR7A 1K8YB 1R5JA 1X7XA 2JASA 2JB9A 4ZU1X 5HKOA 1OV6A 2RB5A 5L8VA 1DVRA 4KQEA 3T5CA 4N8EA 3G0GA 1N0UA 3O4HA 5J2TA 1H23A 1O96A 2ZWOA 1K75A 3OWHA 2D0PB 4EUKA 1L6IA 1FTQA 1ZK2A 1IVNA 2R1VB 5L3ZA 2X0RA 2ZRLA 3H19A 1HSZA 3IP7A 3N58A 2RGRA 1TF5A 3R7WB 3Q3HA 4JB3A 4A5SA 3TZKA 1IUKA 1IH8A 1IY2A 1JE1A 2F3SA 1I4WA 4MR7B 4OK5A 2QM0A 4QL3A 1GO2A 5JNSA 1H2RS 1T3TA 4Q4AA 3IUPA 1KKMA 3HJGA 1AD2A 1P4GA 2Y6VA 1HE5A 4WBNA 4FWBA 1CLUA 2DBRA 3H5LA 3ILYA 2P2SA 3IAAA 2VP6A 4R7GA 3RR2A 4IUBS 4CT5A 1PJLA 5TPWB 2CLKB 3UJNA 3OD1A 3LPDA 1JTFA 2NNLD 1JG3A 2HIGA 3BJZA 3BMOB 4H6PA 1EXVA 5DK6A 4Y2UA 3E5RA 3ELDA 4IKEA 4N41A 4L7VA 5FL7D 3QUBA 1PYOA 3GRZA 3VR5H 4AIIA 1ZCFA 4O2AA 3QKSA 4MPPA 5DBFA 3DJFA 4J49A 1JU9A 4MSUA 2YYAA 3VR1A 4OHMA 5ICFA 5FPQA 3DMYA 3H84A 1VFNA 2VLBA 4FC7A 4YAWA 4WESB 1NHGA 1RPNA 4DA9A 3K70C 1W36B 4Z1MA 2GM4A 1CK4A 1VPTA 1IOVA 4N8SA 4JI5B 3WWOA 4ZTZB 4BEVA 1ND6A 2NZ8A 2GK3A 5JD3A 1YR6A 2P5TB 3OCWA 3EW9A 4MIEA 1GTJ1 1SCJA 1PEAA 4DTIA 2IF0A 3L1VA 3SXUB 4OHBA 2MU1A 1K92A 2JI7A 2FQ1A 2AIRA 4Z4GA 1EFTA 4Z0TA 3USES 4IDEA 1RQPA 2O6HA 1R8SA 3ZNOA 4BFVA 3EBPA 1JAIA 1RXIA 5ITZA 1VGVA 3LK6A 4I36A 2WFAA 4YRAA 1XCPA 1RRKA 1EP1B 5JXIA 4R2MA 3CHYA 1G21E 1G5RA 1ZJYA 1UPBA 3HBAA 3PT9A 4Z4CA 2ADFA 1DGQA 2WWVD 1C5KA 2I2DA 5D7BA 5EJ6A 2GJ8A 2R68A 4D3SA 1M2VA 3RANA 3T1NA 1T5DX 2IOFK 3ITEA 1BN6A 3OFND 2Z6QA 2GPWA 2NYAA 3RU9A 5IKOA 3W6ZA 1Z8NA 3U60B 1W19A 2BP7B 3CLUD 2EQ5A 1W36D 1JZSA 2ONKA 3L7MA 1M10A 4HUQB 4JN6B 2ZSAA 4ZEWA 5KB3A 1OX4B 2ZJBA 1JIKA 4IXMA 1KVQA 3ABQB 4NZPA 4U7WA 3KELA 1CUUA 1R0KA 2KX7A 2ORYA 3FYTA 3O95A 1BWQA 5AKLA 4BASA 5JVDF 2O7VA 2RHTA 3M6AA 6REQA 4P34A 2Z1DA 1UEIA 2AJLI 2UUPA 2IS4A 4HRYA 5EZYF 4A6DA 3TAXA 3LGXA 5GOZA 5H3LA 5DBIA 3U80A 1GNVA 4XARA 2E3JA 2PV7A 3F2IA 4GMXA 2H0AA 2D13A 5DLYA 4B8YA 1TJYA 1U94A 4B3XA 4C76A 3FNEA 3KQMA 3A3KA 1SKAA 2QGFA 3OLXA 1XT6A 3UPDA 3LX4A 3GJZA 5CPBA 3QELB 1CUJA 2PYZA 3K1AA 4JJAA 4L3OA 2IVFA 4YJGA 3U4QB 1LSOA 3LX6A 2FZWA 3GQBB 3TLBA 3MM4A 1I8TA 2CF6A 3IP3A 4PS1A 3S2GA 3SHFA 1UBJS 2XUPA 1RHRA 5M29A 3WV5A 3TEMA 3GCWA 1C4KA 2OBMA 4HC4A 3ST7A 4GMDA 3QNWA 4JLKA 5C3MA 4J0HA 4QLOA 2WF7A 3EJWA 1ONPA 3FUUA 4RF2A 4G0UA 2CL7X 1DJOA 1JR3A 1CQPA 3OJEA 4UHFA 5D2CA 2GZ1A 2WMOB 1FFSA 5CT6A 4BO0A 4E3ZA 5ALEA 5CXUA 2J48A 1F8GA 2B25A 1L5FA 1SEPA 1ZD4A 3IH5A 4EHAA 4PLYA 4RCZA 2ZDGA 4GXTA 3UYLA 4FR5A 2AJCA 4M0MA 1NATA 1O4WA 2ODAA 4KFUA 1AGYA 3EXIB 1EE1A 4CVNA 5KYYA 3NYWA 2GN0A 4LOKA 2QMYA 3LXXA 3ZDAA 4DLZA 1JHOA 4CKEB 5EE1A 5FWYA 4KI7A 1MOZA 5A5DA 2VPWA 2O8DA 4B4VA 1F6DA 2I80A 4XRGA 2EZ8A 5C5DA 5CDYA 5IRCD 3ICQB 2Q2VA 1RABA 4BTEA 2DLNA 2H4ZA 1U2DA 3MTIA 3QMMA 4H7EA 2EKBA 2HCTA 5DZSA 3RAPR 3FYDA 4X6YA 5B2ZA 3EX7C 3MVEA 1WZIA 3K5IA 3PDIB 5D3MA 4N76A 2BD0A 3HVUA 4DSNA 3HEBA 1I4OA 2B4RO 1GEEA 3HU5A 2ZRCA 4Z2AA 1FSFA 1I3LA 4LSWA 4YJKA 1OV4A 5D1NA 1ZITA 3CWCA 3QG1A 4AM8A 4C0KA 5K8CA 4JQOA 4K5QA 3DCIA 4M8NE 3AR6A 4QAJA 1HETA 2PDAA 1BVYF 5LD2C 1PUJA 3IERA 3ZV3A 1P9WA 2DT8A 1DO8A 2K2WA 1E0JA 3GOQA 2PJDA 3DBHA 3TCKA 4XYBA 1FP1D 1PL0A 2CMDA 2CLDX 1TM7E 1NVBA 1ULTA 1YL7A 2BKEA 5DNWA 3VR3D 1MVNA 1ZD3A 4N03A 2LPMA 4DLSA 4QLBA 1RKVA 1XKXA 3G0DA 4JI3B 4E88A 5BVGB 2JLZA 3C45A 3A4YA 3EXHB 1H2WA 4TS1A 3NHWA 4U02A 3WB2A 5H9VA 4ANFA 2RBGA 1MF7A 3FCSB 4BV9A 4RH3A 4KPFC 3KO8A 1GR1A 1I9CA 1E2DA 1T24A 4ZCSA 4YXFA 1ZJ4A 2H5IA 1U11A 3FPLA 1GADO 4NOJA 4NZYA 3GZNB 1I7NA 3UHJA 5A06A 5HDQA 5A5FA 1HT2E 2BWJA 3ZYCA 1OXMA 3Q8KA 1TVKA 4FYMA 4YP6A 2B92A 3GLGE 1BHJA 3QTLA 3SHTA 1U2DC 2WG2A 2ZRQA 2IYWA 4RFLA 1EJ6A 2HV9A 4XIFA 1FYFA 1HPLA 3MIIA 4LYDA 3CRVA 5CK4A 3R7FA 4E5UA 1S3FA 1J5XA 2QL7A 1Y9EA 1YR2A 2ZYTX 3MT9A 1H4VB 1S89A 4U9UA 4QWMA