1KFYB

Quinol-fumarate reductase with quinol inhibitor 2-[1-(4-chloro-phenyl)-ethyl]-4,6-dinitro-phenol
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
243
structure length
243
Chain Sequence
AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FUMARATE REDUCTASE FLAVOPROTEIN
publication title Crystallographic studies of the Escherichia coli quinol-fumarate reductase with inhibitors bound to the quinol-binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 69
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2001-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1kfyB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1kfyB01
2HTME 2WU5B 2WLBA 1YQ3B 2QJLA 3B9JA 1F0ZA 3P1MA 1FFUA 2WS3B 1GT8A 3AEBB 1CZPA 2BS3B 1FRRA 1N60A 1NVID 2H89B 1R7SA 1L0VB 4ZOHC 4YTNB 2WP9B 1PUTA 5EE1A 3HVZA 5G5GA 1AYFA 3L4PA 4ITKA 2E3TA 1KF6B 3AE4B 1NEKB 1OFFA 1RWSA 1A70A 1E10A 1YJJA 2H88B 4YT0B 3AMZA 1DOYA 3P4SB 3AEFB 5AUKA 3B2GA 4HROA 1H7WA 2K22A 3B2FA 1KRHA 1J7BA 1JWBD 3SFEB 1ZOYB 1E6EB 4YXDB 3LXFA 3NVZA 2WQYB 3P4QB 3NRZA 4JWSC 1XO3A 3P4PB 1L6UA 2W54A 3AH7A 3DWMA 2K5PA 4N6EB 1SF0A 1TYGB 2M19A 5EE0A 3AE3B 4C7YA 3CF4A 3NS1A 4N58A 1N5WA 3LB8C 4P6VF 2B76B 2BS2B 1E7PB 4US8A 2G1EA 2OHFA 3AN1A 3AEDB 5EE9A 5H8YE 1N62A 1B9RA 1SB3C 1XLNA 1DGJA 1TJEA 1RM6C 1XLOA 1ZXIA 1V97A 1QOFA 1TKEA 1VDVA 2FBWB 2L52A 1YJIA 4JX1C 3W9CB 2BT6A 3FAHA 1JALA 4KX6B 1NYQA 2W3RA 5EE3A 3P4RB 1H7XA 4YTMB 2DWQA 1EWYC 1ZP0B 1FXIA 5C2TB 1QOBA 1WWTA 2N0SB 4JWUC 2JX5A 3PO0A 3AV8A 3VR9B 2MJ3A 1WYGA 3ETRA 1T3QA 3W5UB 1VLBA 2ACZB 1DOXA 1ZUD2 3AB5A 1GTHA 5H92C 1FO4A 2WU2B 1NYRA 1CJEA 1J7AA 3DWGC 1N5XA 3CIRB 1YQ4B 1FM0D 4WQMA 1QLBB 1TKYA 1E9MA 1QOAA 1XLQA 2WDQB 2AX5A 3KWLA 4YSYB 1PFDA 3AEEB 3AEGB 2L83A 1VJKA 2MH7A 4ZHOA 3AE5B 1JQ4A 3SFDB 4C80A 1NENB 3AECB 1IUEA 1OQQA 1QOGA 1L5PA 1TKGA 3NVYA 3NVVA 4FXCA 2M56B 3SR6A 3AE2B 1JW9D 2MJDA 3NVWA 4YSZB 2MJEA 1N61A 4US9A 3RPFC 2EKIA 3BIID 3FC4A 3HRDD 4IDIA 4LTUA 1DOIA 5MPOA 1I7HA 2DBYA 1RYJA 3AE9B 5C3JB 1FXAA 2JQRB 2CU3A 3W5VB 1N63A 4USAA 1JWAD 3VR8B 3AEAB 3P63A 2Y5CA 2CJOA 1WXQA 2LEKA 4C7ZA 2PVGC 1WGKA 3ABVB 2W3SA 1WRIA 1FIQA 2WDVB 5G5HA 4HRSA 3VRAB 1RFKA 1GTEA 2PIAA 4A9AA 2K9XA 2WDRB 2BS4B 4YSXB 1L6VA 1NI3A 2QIEB 1E0ZA 2PVOD 4YTPB 3AM9A 1AWDA 4ZHPA 1GPXA 2Q5WD 1GAQB 1ROEA 3ZYYX 1JROA 5GXGB 1KFYB 2CJNA 2KAJA 3AE7B 3AE1B 1UWMA 4N59A 3CWIA 4WWMA 2PKOA 5AUIA 1FRDA 1OQRA 3VRBB 3AE8B 3HUIA 2KMMA 1FFVA 1FMAD 3WCQA 1V8CA 2W55A 1QF6A 3EUB2 1J7CA 1PDXA 3AE6B 1SIJA 1JRPA 1QT9A 1XLPA
chains in the Genus database with same CATH superfamily
4M02A 5FR6A 2KDMA 2WXRA 3ZRFA 5JHAA 2WXPA 3AXCA 3T3NA 3VUWA 4CYEA 5EE1A 2GBNA 4TUUA 2E3TA 3Q3FA 4K3BA 3NJTA 4NJ7A 2JRHA 3C8YA 4EKUA 3AI5A 3UIPB 1P9DU 4FBJB 2WDTB 3T9LA 1I4HA 1G6JA 3A9KA 4NJCA 4W9EA 3TEZA 2OOBB 4UDUC 1ENFA 3R2TA 1I4PA 2L52A 2GOWA 1UD7A 3BYTB 1WX7A 1RLFA 2MCNB 1EWYC 2N0SB 2ZJDA 3HK0A 1UGMA 4FULA 2KQ7A 2JWZA 3IXSA 4TMAB 3GB1A 3DBHI 3ZQ4A 2D07B 1NYRA 1N5XA 2R2OA 1FM0D 1WE7A 5BMGA 4LJPB 2ICIA 1K53A 1WXAA 3NVYA 4EUTA 4AQ7A 4HEA1 2V9HA 1MI0A 2CHXA 1OGWA 2K6DB 2VH1A 4USAA 3SHQA 2CJOA 2RPVA 1EU4A 2PVGC 2V3SA 3VRAB 3Q2AC 4OVUA 2DYBA 1VCBA 3HIZA 3V6CB 5C1ZA 3OLMD 3QAQA 1RFAA 3DDCB 3IT4B 1JROA 1MG4A 4X57B 2GB1A 2KVZA 2L0TA 2KN5A 3DBLB 4RH6A 3U7DA 4BOZB 2AL6A 3EUB2 2MQJA 3MC9A 3URYA 4PT5A 2K8BA 1GT8A 2BS3B 4ZOHC 3CMMB 3TSSA 1V49A 4E71A 3L17A 1AYFA 4BVUC 1C1YB 1E10A 2PTLA 3EGRA 1FPYA 1GOZA 4HROA 2QMTA 2KVRA 1JWBD 4YXDB 2KQSA 2DZKA 4NNJB 3VHTC 1KLUD 2O6VD 4LNIA 3DPDA 4A3OA 3NS1A 2B76B 1H8CA 1ZGUB 3PHXB 2O2VB 2KHWB 2GBRA 3ZDTA 4B9KA 5H8YE 1XLNA 1DGJA 2JT4B 1WR1A 1L0YB 1V97A 1V6EA 2FE8A 4MJSB 2D3AA 3VDZA 3T3OA 1JALA 4LDTB 1E5WA 5BYQA 3ZJUA 4JWUC 1FXIA 3U8ZA 5DPWA 2LUMA 2MW5A 3IHPC 2WXMA 1T6BX 4GDKA 2INPE 1GTHA 1WX8A 3DWGC 1QKZA 1QLBB 3GE3C 1QOAA 2ZNVB 2ZPYA 2FIFA 2BB6A 2KX0A 2JYTA 3ZNZB 2MJDA 3VXWA 2EKIA 2KFKA 4IDIA 4FA6A 1WXMA 3RNEC 2L05A 4DDID 3PTFC 2BYVE 2RSUA 3J9CA 4C7ZA 1WGKA 2LGIA 2AL3A 4C56C 3MC0B 4KGSA 3AE7B 4CQNA 1A5RA 2C5LC 1QILA 3VRBB 1WFYA 3Q14C 3WCQA 2RPQA 4F7ZA 2QSDA 2V4IB 4FN2A 2AQ1B 2BB5A 1E7UA 3RUIB 1R7SA 4IM0A 2VH2A 4WIPA 3FKYA 2MSED 1I4XA 3SU8X 1YJJA 4IWPA 3KQ4A 4RM9A 3QC8B 3A1QA 1H7WA 1CK1A 2KANA 1J7BA 4G0NB 4AS1A 2K5PA 2IBIB 4C7YA 1GNUA 2N9XA 4P6VF 1E7PB 4W9JA 4NQLB 1TIFA 1IPGA 1L7YA 2LFIA 4GDLB 3U52E 4LNNA 2FBWB 3W9CB 3N1XC 1J8CA 2AEHA 5EE3A 4ANUA 3KH0A 1UUPA 1WYGA 1VLBA 3EHVA 5H92C 3VQIA 4WJQA 3QIJA 3GP7A 2MBHA 3PZ7A 1AW7A 3L16A 4YL8A 4W9KA 2KTRA 4M8NA 1CQVA 1D5ZC 1L0XB 1S3SG 4GN1A 4BZAA 4FJVB 1T0YA 3DHGC 3N30A 4KDLB 1BMLC 2I38A 3R8BA 1RYJA 4L1BA 4II3B 2IGGA 1N63A 4JQWC 3LDZE 5J18A 3CF6E 1JCKB 5D6JB 2FCQA 2LASA 1L6VA 2WX1A 3DHIC 4B0EA 2Q5WD 2DAJA 1KFYB 2HJ1A 4OZAA 2INDC 2MBQA 2PKOA 2D3GA 3NZUA 4ICVA 1WJ6A 2WHIA 1F0ZA 4HJKA 1FRRA 2CS4A 4BKSA 1D5MC 1R4MB 3X0WA 1JWUD 1DOYA 1WX9A 5CHFA 1OQYA 2LD9A 3NZSA 2IO0B 4N9F4 2KC1A 5D7GA 1D4BA 1I4RA 4US8A 2IJ0A 3PPAA 2PJHA 1X1MA 3KLSX 2ZVOA 3PREA 2KKCA 4W9HA 1TY0A 1VDVA 3HHMA 1V81A 3A4RA 3S2AA 5HKHA 5BMIA 1Z5SB 3RI7C 1HA5A 4JLCA 3Q8AA 4KDIC 3KW5B 1P1AA 2OJRA 3Q8CA 4ZRIA 4LNKA 5BYSA 3OG5A 4WQMA 2IYDB 2K39A 4IG7B 1PFDA 4EE2A 3SFDB 2JWUA 3BINA 4US9A 1J0GA 5HFYA 4W9FA 5C3JB 1XXGA 1F9JA 1FXAA 2V3PA 2QHOA 4OHJA 4OVZA 2Y5CA 1WXQA 5IP4D 4WJPA 3H1UA 3I5JC 1E8XA 1STEA 3JW0X 2PIAA 2WDRB 3MHZA 2K1FA 2M17A 1ROEA 5AEKB 1FD6A 1V2YA 3D32A 5AUIA 1HEZE 3ZGZA 4KGTA 3BK1A 1JRPA 1QT9A 5IO9A 4L2YA 3VTVA 1IYFA 3HM6X 3RNFC 1NVID 3VTUA 2NCNA 3M63B 3HVZA 2D5GA 1WZ3A 2KX3A 2IGHA 4FHKA 3RNBC 3SD5A 2A5UA 4ASWC 1GB1A 1NI2A 3SFEB 3AE3B 2R2QA 2CHWA 4B0MA 1JMLA 2ONQA 3DVGX 1F77A 2BTEA 3H9DA 2V0GA 1K8RB 2KOXA 2DYOA 1YX6B 3Q8EA 1IGCA 5FKAC 1XLOA 3I57A 2W9NA 3QX1A 4TQ0A 4ZYSA 1EF1A 1FCCC 2IGDA 4KX6B 2W3RA 2C9WB 3SEBA 3PO0A 2FIDA 3KWVA 2KD0A 3A4SC 4RNAA 1KJTA 4AOFA 3PHWB 2W82A 1SGHA 1XLQA 3AEEB 1C77A 4O1NA 2DZJA 2B3AA 3PLVA 5C23A 4C4VA 2IO2B 4HVBA 2WXJA 1GG3A 2DLBA 3APDA 1I7HA 4CO7A 1PGAA 4KZCA 3MC8A 1E90A 3DHHC 3BY4B 2KWDA 3MFGA 2M0XA 1GTEA 4S17A 1C3TA 2FCSA 2L76A 3A9JB 3W2DA 2JY6A 2K8HA 3HUIA 1WZ0A 2FUHB 2N1WA 2GMIC 2BWES 4G3XB 4EZKA 1V1PB 3MTNB 3PT2B 4TQ1A 2KJHB 2KLCA 3L13A 3T8MA 4LLGM 3ZTDA 1KF6B 1RWSA 4WQOB 4G11A 4XC2A 2D3BA 2GLSA 4ARCA 3ZKJC 2K22A 1L4ZB 3P4QB 2PLPA 2BPSA 4JWSC 4ANVA 4N6EB 2KLGA 5EE0A 3DVNU 1F52A 5G2NA 2C7NB 1WJNA 3VH3B 2D3CA 1XF5L 1FCLA 1N6ZA 2KZRA 2GBJA 3KYDD 5L95C 3PLUA 1SE4A 1RAXA 3A9KB 2PE9A 4ANWA 2RDHA 3QQ8B 2DZMA 2HD5B 3FAHA 1BUIC 3PV1A 4URKA 1XQQA 4HJGE 2JX5A 1E8WA 2WXLA 3DCGA 3JSVA 1JRUA 2AQ3B 1Q5WB 3JYUA 4RM8A 1YIWA 1CJEA 4EZLA 2N7JA 3RZFA 1ET9A 1TKYA 1MG8A 3KWLA 2NBVB 3KVFB 2KQ4X 2CKHB 1OQQA 4W9LA 1GC7A 1ZPSA 2AWTA 3BIID 4WWOA 2DBYA 2GRIA 1YQBA 4A6QA 1I4GA 2KFJA 2A4ZA 4GIVA 2G4SA 2LEKA 4OW0A 1V80A 2VRRB 2D11A 4LDTD 2HE7A 4FHJA 4KVGB 3RZWC 1AARA 4DXGA 5I4DA 1SEBD 3V3XA 1HE8A 1XLPA 1WE6A 5T8IA 1KLGD 3WAPA 3KYCD 2LHEA 1FFUA 1WIAA 2N9LA 5GMVA 3ML8A 4DHZE 2IY1B 2BVCA 1Y56A 4XDDA 4II2B 3EFCA 4HPLB 4WAFA 1HTQA 3RCZA 5AUKA 4KSKC 4BBNC 3ZNGC 2LGXA 3AU5A 3IVFA 3Q8FA 3P4PB 1TS5A 3TEYA 3OJ4B 1SXTA 4KIKA 5FK9C 3EC8A 2OHFA 5DPRA 1NDDA 3EECA 2C7MB 4NY0A 4EOYA 3N3KB 2LZ6A 2FNJB 2G9HD 4PYUA 1GUAB 3WIMA 1C76A 5AZHA 2WXIA 1ZXHA 3M62B 2K25A 4K3CA 3PSEB 3AB5A 3DOWA 3DBLI 2ZVNA 1L4DB 1V9JA 1Z2MA 2J7QB 1KLVA 1VJKA 1YN4A 4HXDA 3AECB 3GOEA 4GGQA 5CHVC 4GDKB 4HDQA 2M4NA 4FLHA 2LVOA 4RFBA 2JXTA 2M0AA 4IW0A 1YJ1A 2NR2A 4KKJA 1XEEA 3AEAB 3NOBA 2NPTA 1PGXA 2KFKB 5G5HA 2KWUB 1ZE3D 4ANXA 1IGDA 1Q0WB 3ZYYX 2R61A 1OEYA 1OQRA 5IA7A 2JZZA 3AE6B 2Y3AA 2M8SA 2WU5B 3P1MA 2DZIA 2N4FA 3VUYA 2DYMA 3ZJTA 5IOIA 3UIOB 1S1QB 3N1YC 4DQOC 4Q2JA 4RMAA 1UELA 2NTTA 2MEKA 4J6IA 5DPTA 4ZRQA 4KSLC 5IAAC 2M19A 3A1QB 4N58A 3RD2A 3TL5A 3TCAA 3ALBA 2JPHA 2BGFA 1YNTE 4WURA 1UH6A 2Z8LA 3BYYB 3Q3JA 2WXKA 4K7UA 1SB3C 1F1HA 3ZO5B 1YX5B 5EDSA 2KTFA 2IO1B 3MJ5A 3JVZX 2PEAA 1SE3A 4PS8A 4YTMB 3P42A 2INCC 2KMCA 3Q69A 1WMHA 2NS5A 5E6JA 2QDFA 1WGYA 1DOXA 4JPSA 1V86A 3PVLA 2KDBA 3IBEA 2KDIA 4AJWA 1U4AA 5JZEB 1E9MA 2RDBC 5BO4B 4C80A 3B08A 3VUXA 2DAFA 1HTOA 1K51A 2JZPA 4HPMB 1TS4A 4OZCA 1TS2A 2IY0B 3NVWA 2LJ5A 2NBUA 5TSSA 4MH0E 4G50A 1D6EC 2KTRB 2O6VA 4EFOA 4WJOA 3R7QA 1C9FA 4MM3A 1P3QU 2CU3A 2DHZA 2G45B 4MEMA 3P63A 4XWWA 2V1YA 2WDVB 2G3QB 3EFUA 1TS3A 3NHEB 5GXGB 1FNUA 1SBBB 4W9CA 3IT6B 2WXNA 3CWIA 2MWSB 5KHOA 1V8CA 2G4DB 3U2SC 3APCA 1YQ3B 5FR3A 2KN4A 1B1ZA 3UGBB 2ZCBA 2WP9B 4BOSC 5KHQA 2I2YA 3CSFA 5LXIB 3TEXA 2ON8A 1KH0A 4HKQA 1WF9A 3TIXA 4KGRA 2JXXA 4PS3A 2KXJA 3N9YC 1ZOYB 1E6EB 2L00B 2Y5BB 3NRZA 2MHJA 1Q1OA 2LGDA 2WXHA 4DHJB 4GB9A 3CF4A 1N5WA 2KYWA 4MSQB 3BZDB 1E7VA 2LGSA 1I42A 1TJEA 4F1SA 1RM6C 1ZXIA 2JU6X 4JX1C 4K7WA 4ZRKA 2BKFA 4RF1A 1WJUA 4S0RA 1JWMD 2HTHA 4E3CA 2UWQA 5AZGA 3MJWA 1QQRA 1T0QC 2V4LA 2D2QA 2N9PC 1TKGA 3QK0A 3TBLD 2UYZB 3VH4B 3ZXRA 2C7HA 1N61A 2VZKB 4HCPB 3FC4A 1BXTA 4R3DA 2QCZA 1R4MI 3RYTA 2BW2A 1EWCA 4LJOB 4MACA 1RFKA 2ZNVC 5JH5C 1NI3A 4YSXB 1E0ZA 1VRAB 5AZFA 4A90A 4JL9A 2N7DA 3LYYA 2KMMA 2W55A 3HVDA 4E74A 5CHWA 2XK5A 2HJ8A 2NBWB 2JYEA 2LRWA 2L0FA 3TMPB 4XE0A 5HHDG 2KWVB 2BYEA 2OJWA 1WJ4A 5D2MB 4I6LB 2N9KA 2PW9A 2YEPF 3RT3B 2DNFA 4IM3A 1LGRA 2BBCA 3ENEA 4KV2A 3V6EB 2MBBB 4BBNF 1VZ8A 1KRHA 4D2KA 2KO3A 2FUG1 2W54A 3IAM1 1WSPA 1SIFA 1T0RC 3LB8C 4H2AA 2X8XX 3L08A 2NTSA 3WALA 3IAS1 5EE9A 1J19A 1WH3A 2ZCCA 1UGJA 1QZEA 5JHBA 1YJIA 4I6PA 1FNVA 1H7XA 5IKCM 2IZVB 4FADA 1VR9A 1WM3A 1LQBA 1TTNA 1ZUD2 2YLMA 3I9V1 1MPEA 2PPHA 3ZNHB 5G55A 2WDQB 3AE5B 3ZDMC 4TKNA 4ICUA 4FXCA 3RFZB 4JE3B 3DQVA 5LXHA 1M94A 3DBRB 4IUMB 1WGGA 4FJZA 2ZZPB 1JWAD 3Q6BA 4C4VB 3C19A 4MH8A 3C0RB 4DDGD 2SEBD 2K3UA 4W9GA 4P16A 3X23A 2K9XA 3FILA 4A3PA 1GPXA 4BKGA 2MLBA 3VAWA 4DWFA 4KZ0A 1UWXA 2KC2A 4RCOA 3VFKA 3R7RA 2UU7A 3V60A 3K9OB 1KOTA 4NJ6A 1CZPA 4DK5A 3GZNB 2WX0A 3ECIA 5DCNA 3OWEB 3L4PA 2DENB 3ZUNA 1A70A 1T5XD 3H7PA 4PS7A 3Q3NC 2N7EA 3AULA 1UF0A 2KDEB 1YOVB 1ZKHA 1WXVA 1TYGB 3Q8BA 2LUEA 4HK2A 3NZ3A 2E6XA 4NPNA 3RN9C 2L1AA 4ZDVA 4K7SA 4XGAB 4B95A 1YN5A 1SSNA 2IO3B 4MSMB 3BVZA 4WJNA 5JXVA 2L7RA 4ZRPA 3AV8A 3W1SC 1ESFA 4LNOA 3UQBA 1WYWB 4HDOA 3IG3A 1D5XC 1D3ZA 1XT9B 4J3OD 3CIRB 1OEYJ 4OVVA 3O13A 2KACA 2L83A 5CX3A 3JSVB 1JQ4A 4DBGA 1NENB 5D3IB 3NVVA 2GBKA 4MELA 3RNAC 3ZLZA 4M01A 1KTKA 2L32A 3R2IA 1C4CA 2N1VA 4MGKE 3ABVB 4NAWA 2XNAC 2QIEB 3N32A 5HG2A 3VVWB 3N1ZC 2WXOA 3DBHB 1GC6A 2I1KA 2AQ2B 3UINB 1PDXA 1UBQA 2LVQA 2HTME 5E6PA 2WLBA 3PGEA 4AWJA 4YTNB 1EU3A 2N9EB 4GU2A 4K1RB 4LCDE 4HLEA 4BAXA 3ZRCA 1WM2A 3LXFA 2Y5PA 3ML9A 2MBEA 2WQYB 2V3NA 2INNE 1WXSA 2J42A 2DX5B 3B0AA 1K52A 1YMHE 1BT0A 1ZDXA 2JF5A 3U30A 4ZRJA 1N62A 1XD3B 3KUCB 3TUOA 4KIKB 2QC8A 1NYQA 3BWUD 2Z0DB 1ZP0B 1WWTA 2LRUA 4KKIA 1JWSD 2MJ3A 2XN9C 3QCAA 4MGZE 4WWNA 4WWPA 3ZNID 2WU2B 3H7SA 2J53A 1J7AA 1MHHE 3UQAA 3L0WB 4IKGA 4YSYB 1IUEA 1QOGA 3TEWA 2MBOA 2M56B 3SR6A 1JW9D 2MJEA 2LGYA 4XYCA 2X38A 1L2NA 1FXTB 3AE9B 1I4QA 5LNK1 3VR8B 1TZOA 1WGRA 4XX5A 3BVGA 1OTRB 2BS4B 2PVOD 1P0RA 2ZW1A 4K81A 4P1BC 2QEJC 2SAKA 1F2RI 2KAJA 3PS6A 3QWZB 2NPTB 3AE8B 1FFVA 2REXA 1V5OA 1J7CA 1EF5A 2M1MA 4M8MA 4CHKA 2RR9A 3RULA 5D94A 2TSSA 1N60A 2H89B 2LXCA 1L0VB 2JRIB 3B1LX 1PUTA 2J0KA 3AE4B 1ET6A 1NEKB 3WA0A 2H88B 1EUVB 4YT0B 2WXGA 4WAAA 4FJYA 3P4SB 3U4EG 1TT5B 1IBXB 4MGYE 3B2FA 3KUDB 2O2VA 2ZW0A 2BYFA 1L6UA 3DWMA 1SE2A 1VZ7A 2ASQA 2FAZA 2BS2B 4MJSA 1E8YA 4RF0A 1IBXA 3QHTA 4JGHB 4TV3A 3AEDB 1B9RA 2JSVX 1TKEA 2BKRB 3A33B 1HZ5A 5E6NA 1PQSA 2J52A 5D3DA 2KNBA 5C2TB 2RGFA 3CSTA 4PK1A 2MX2A 2WYQA 2ZPNA 1E8ZA 2CR5A 3MHSD 4IWQA 2WWZA 3L54A 4GSWA 3WAOA 1WMHB 3ONSA 2K8CA 4OZBA 4ARIA 4BKSD 4LNFA 3Q3MC 2AYOB 1NBFC 4DHJD 5MPOA 3M95A 1PGBA 1PYWD 3UF8A 1ZW7A 3PZ8A 1HXYD 2BF8B 2W3SA 1FIQA 2O6VB 3TJPA 1WR6E 4MM3B 3RNGC 1YD8U 3APFA 2CJNA 3WANA 1WGHA 2JVCA 2EMSA 1IP9A 2MA9B 4AJYB 1FMAD 1P7FA 2J0JA 4GMVA 2XEWA 4AP4C 3B9JA 3DVNV 1EM7A 4HPPA 4I6NB 5G5GA 5L83A 2NVUI 4ITKA 2FCNA 2VZKD 1OFFA 1WGDA 2KK8A 4HKZE 2WGSA 4NQKE 2EKEC 3U7ZA 4RGOS 1LM8B 3K9PB 3MP9A 3ZVVA 3NVZA 4B6WA 3H8HA 2CU1A 3V05A 1XO3A 4XWTA 3AH7A 1DYQA 4GDLA 1SF0A 2J4XA 2NMQA 4REZA 1C78A 4W9IA 1CMXB 4GLSC 1FNWA 4A20A 3E9SA 3M3JA 3W1YA 3P4RB 4ACFA 3H6NA 3W5UB 4IC7B 2ACZB 1F2RC 1MVKA 2LVPA 4DXAB 3L10B 2MH7A 4BKTA 4GOCA 1ZDVA 3NUHB 2L8JA 2Z0EB 4EEWA 3AE2B 1VD2A 1TY2A 1WI0A 2LI5A 2JZ3B 3QA8A 1UBIA 1KM7A 1C4PA 2KWCA 3W5VB 2RDGA 3OAWA 2WXFA 3QARA 3GS2A 3EA6A 1EO6A 1TBEA 3I3TB 4NAMA 1I35A 4W9DA 3ZXVA 3AE1B 4MGIE 1R4NB 4LK0M 4M0WB 2KT7A 1QF6A 1K50A 2FCMA 2QJLA 1M4VA 4RGMA 2WS3B 1WRDB 4XZ4A 2RD0A 4M0WA 3PRPB 1T0SC 4A8XC 2GI9A 4DHZB 4RGTA 2XK5B 3W1SA 5CTRC 5TR5A 1ACCA 1P7EA 4QAYA 4HWIB 2BQQA 3AEFB 2PE6B 1AN8A 2PMVA 4GXBA 3VTWA 1R4NI 3ZTCA 2D10A 3LJ3A 2G1EA 1GB4A 5J2RA 3R66C 2BWFA 5LLIA 5BMHA 4BFRA 2MRPA 1QOFA 4MT5A 3DVGY 1C4AA 4PYZA 3V62A 2LMCA 2I1JA 2KDFB 4TSSA 1QOBA 3VR9B 2ZEQA 5E6OA 3QJZA 1XCQL 3HM3A 4HCNB 1YN3A 5BYRA 1Y8RC 1TGZB 1LO5D 1V1OA 4ZHOA 3AEGB 2CHZA 1P98A 3WAMA 2K6QA 3IFWB 2EMTA 2KJRA 4YSZB 1Q10A 1RRBA 1DOIA 3RNCC 2JQRB 2BYTA 2L3ZA 1LFDA 2OEDA 1SJHD 1XCTL 1C79A 3ZJVA 3PZDA 4A9AA 1GJZA 2IDYA 2J0MA 3N20C 1MFWA 3ZIMA 4YTPB 2K0PA 1GAQB 2YEPB 4DXFA 3KUZA 2MP2B 1FRDA 2Z59B 2XBBC 3FILB 2YVCA 4IOIE 2KMAA 5J17A 2LWPA 3NY5A 3NG0A 3AEBB 1FEHA 3E56A 4IM2A 2MP2A 1UNSA 3NS8A 1V5TA 4EZJA 4M00A 3AMZA 2C60A 4WH4A 3B2GA 4JIOU 4MDKE 3RMKC 3I63C 4P1CC 3DBSA 3AU4A 3H7PB 1WY8A 3OJ3A 2QILA 2KJ6A 2RMMA 3SDLC 3DBRI 5IN7A 4ZYNA 1HZ6A 3AN1A 4C00A 2JUOA 4XDCA 1TZ1A 2BT6A 1VZ6A 5DPSA 3UI3A 1MJDA 2DWQA 1MHXA 1LXDA 1ISNA 3ETRA 1T3QA 3BK2A 4L23A 2GBMA 4A55A 3Q3OC 1FO4A 3BVMA 4NZLB 1YQ4B 2AX5A 2IPKD 3V61A 3PRZA 1L5PA 4YWGG 1SJED 2EELA 3GZNI 4F8CB 3RPFC 3HRDD 4LTUA 4AUQC 3A9JA 3P2BA 3O65B 4P7IA 1WRIA 2HDEA 4HRSA 2LXAA 2WXQA 1UZXB 1SE9A 3R3MA 3PRMB 1H4RA 3ZW3A 3AM9A 1AWDA 4IWOA 4ZHPA 1HQRD 2LJIA 1V1PA 1UWMA 3GE8C 2LHDA 4N59A 4NAWB 4WWMA 2WNMA 4RGNA 5HI1A 1SIJA
chains in the Genus database with same CATH topology
2KDMA 2WXRA 4L2YA 1YQ3B 2WXPA 5FR3A 2TSSA 2KN4A 3T3NA 1N60A 1B1ZA 1NVID 2H89B 1L0VB 2WP9B 1PUTA 5EE1A 2I2YA 3HVZA 2D5GA 2E3TA 3TEXA 2ON8A 3AE4B 1ET6A 1NEKB 2IGHA 1KH0A 2H88B 3C8YA 4HKQA 4YT0B 2WXGA 3U4EG 3P4SB 1GB1A 1IBXB 4KGRA 3B2FA 3SFEB 3N9YC 1ZOYB 1E6EB 2ZW0A 3NRZA 1L6UA 3DWMA 2WXHA 1I4HA 1SE2A 3AE3B 1VZ7A 3CF4A 1N5WA 4B0MA 1JMLA 2BS2B 2ONQA 4RF0A 4NJCA 1F77A 1IBXA 2BTEA 3AEDB 3BZDB 2V0GA 3TEZA 1B9RA 4UDUC 2DYOA 3Q8EA 1ENFA 3R2TA 1IGCA 5FKAC 1TJEA 1I4PA 1RM6C 1XLOA 1ZXIA 2JSVX 2JU6X 1TKEA 2L52A 3I57A 4JX1C 4TQ0A 4ZYSA 3BYTB 1FCCC 1HZ5A 2IGDA 4KX6B 2W3RA 2J52A 5D3DA 1EWYC 2N0SB 4RF1A 5C2TB 3SEBA 3PO0A 1JWMD 3KWVA 3IXSA 4TMAB 3GB1A 4RNAA 3ZQ4A 1NYRA 1N5XA 1FM0D 2W82A 1XLQA 5BMGA 2ICIA 1QQRA 3AEEB 1C77A 4O1NA 4OZBA 4ARIA 1TKGA 1K53A 3NVYA 2WXJA 1N61A 2VZKB 5MPOA 3FC4A 2DLBA 4AQ7A 1BXTA 4R3DA 4HEA1 1I7HA 1PGAA 1MI0A 1PGBA 4USAA 2BW2A 1EWCA 1PYWD 2CJOA 2RPVA 1EU4A 2PVGC 4MACA 3PZ8A 2KWDA 1HXYD 2W3SA 3MFGA 1FIQA 3VRAB 1RFKA 1GTEA 1NI3A 4YSXB 1E0ZA 1VRAB 4MM3B 4A90A 3W2DA 3IT4B 1JROA 2CJNA 2GB1A 3HUIA 3LYYA 2KMMA 1FMAD 1P7FA 4RH6A 2W55A 3EUB2 3HVDA 3URYA 4PT5A 2JYEA 4XE0A 1V1PB 3B9JA 5HHDG 4TQ1A 1GT8A 1EM7A 2BS3B 4ZOHC 3TSSA 5G5GA 1AYFA 2N9KA 4ITKA 2PW9A 4LLGM 2YEPF 1KF6B 2VZKD 1OFFA 1RWSA 4HKZE 1E10A 2BBCA 2PTLA 3EGRA 1VZ8A 3U7ZA 4ARCA 1GOZA 4HROA 2K22A 4RGOS 1KRHA 2QMTA 4D2KA 1JWBD 3MP9A 3NVZA 4YXDB 1L4ZB 3H8HA 3P4QB 3V05A 2PLPA 4JWSC 1KLUD 1XO3A 4XWTA 2FUG1 2W54A 3AH7A 3IAM1 1DYQA 1WSPA 4N6EB 1SF0A 5EE0A 2J4XA 3NS1A 3LB8C 4H2AA 2B76B 2NMQA 1XF5L 1FCLA 4REZA 1C78A 2NTSA 3IAS1 5EE9A 5H8YE 4GLSC 1XLNA 1DGJA 1UGJA 1FNWA 1SE4A 1L0YB 1V97A 2FE8A 1YJIA 2RDHA 3E9SA 3FAHA 1BUIC 3T3OA 1FNVA 1JALA 3P4RB 1H7XA 5BYQA 4JWUC 3ZJUA 1FXIA 4HJGE 1VR9A 2JX5A 2LUMA 2WXLA 3W5UB 2ACZB 2AQ3B 2WXMA 1T6BX 1ZUD2 1F2RC 2INPE 1GTHA 1MPEA 3I9V1 1MVKA 1CJEA 3DWGC 1QKZA 2N7JA 1QLBB 1ET9A 1TKYA 1QOAA 2WDQB 3KWLA 2BB6A 2MH7A 3AE5B 2KQ4X 1ZDVA 1OQQA 3NUHB 4FXCA 3RFZB 2JYTA 4JE3B 3AE2B 1ZPSA 2MJDA 1TY2A 2EKIA 3BIID 4IDIA 2DBYA 2GRIA 4A6QA 1I4GA 1C4PA 3W5VB 1JWAD 2RDGA 4MH8A 3J9CA 4C7ZA 2LEKA 2SEBD 1WGKA 4OW0A 2K3UA 4P16A 2WXFA 2K9XA 3FILA 3GS2A 2LGIA 3EA6A 4C56C 3MC0B 1GPXA 4KGSA 4NAMA 3AE7B 3AE1B 4CQNA 4LK0M 1UWXA 1QILA 3VRBB 4RCOA 3WCQA 1QF6A 2QSDA 4DXGA 5I4DA 1SEBD 3V3XA 2V4IB 1XLPA 5T8IA 1K50A 1KLGD 2AQ1B 2BB5A 2QJLA 1M4VA 2LHEA 1FFUA 4RGMA 2WS3B 2N9LA 1CZPA 1R7SA 3OWEB 4M0WA 4WIPA 2GI9A 3L4PA 4A8XC 1Y56A 4RGTA 1I4XA 4XDDA 3W1SA 1A70A 1ACCA 1YJJA 1T5XD 3KQ4A 4WAFA 1P7EA 3AEFB 5AUKA 1H7WA 1CK1A 1J7BA 1AN8A 2PMVA 3Q8FA 3P4PB 4AS1A 1TS5A 2K5PA 3TEYA 1TYGB 4C7YA 1SXTA 3Q8BA 4P6VF 5FK9C 1E7PB 3NZ3A 2E6XA 2G1EA 2OHFA 1GB4A 2L1AA 2LFIA 4GDLB 3U52E 5BMHA 4MT5A 1QOFA 1YN5A 1SSNA 2FBWB 1C4AA 3W9CB 2LMCA 3BVZA 2G9HD 1C76A 5EE3A 4TSSA 5JXVA 1QOBA 4ZRPA 2WXIA 3AV8A 3VR9B 1ZXHA 1ESFA 1UUPA 1WYGA 1VLBA 1XCQL 1YN3A 1D5XC 3AB5A 4J3OD 5BYRA 5H92C 3VQIA 3GP7A 3CIRB 3PZ7A 1AW7A 1LO5D 1V1OA 1L4DB 4ZHOA 3O13A 2KACA 3AEGB 2L83A 1VJKA 1YN4A 1JQ4A 1NENB 3AECB 1CQVA 5D3IB 4GDKB 1D5ZC 1L0XB 3NVVA 4YSZB 1Q10A 4RFBA 1BMLC 1DOIA 2JXTA 2I38A 2M0AA 3R8BA 1RYJA 4L1BA 1KTKA 2IGGA 2JQRB 2L32A 2BYTA 3R2IA 1N63A 4KKJA 1C4CA 1XEEA 3AEAB 2OEDA 1SJHD 1XCTL 1C79A 3ABVB 1PGXA 3ZJVA 5G5HA 4A9AA 2XNAC 1JCKB 1ZE3D 2IDYA 1L6VA 2QIEB 1IGDA 5HG2A 4YTPB 2K0PA 4B0EA 2Q5WD 1GAQB 2YEPB 3ZYYX 2R61A 1KFYB 4OZAA 4DXFA 2WXOA 2PKOA 1FRDA 1OQRA 3FILB 2AQ2B 4IOIE 1PDXA 3AE6B 2Y3AA 2HTME 2WU5B 2WLBA 1F0ZA 3P1MA 3AEBB 1FRRA 1FEHA 3E56A 4YTNB 1EU3A 2DYMA 3ZJTA 1UNSA 1D5MC 1JWUD 3AMZA 1DOYA 4DQOC 4Q2JA 4WH4A 3B2GA 2NTTA 2MEKA 3LXFA 2Y5PA 2WQYB 2V3NA 2INNE 4ZRQA 2M19A 2J42A 4N58A 5D7GA 1K52A 2QILA 1YMHE 1I4RA 2RMMA 1D4BA 4US8A 1YNTE 2IJ0A 1ZDXA 4WURA 1HZ6A 3AN1A 3KLSX 2Z8LA 3BYYB 2WXKA 1N62A 1SB3C 4XDCA 1TY0A 3TUOA 3MJ5A 1VDVA 1SE3A 2BT6A 1VZ6A 3UI3A 1NYQA 3BWUD 4YTMB 2DWQA 3P42A 3Q69A 1ZP0B 1MHXA 1WWTA 5BMIA 5E6JA 4KKIA 1JWSD 1HA5A 2MJ3A 1T3QA 2XN9C 3BK2A 3ETRA 3Q8AA 4L23A 1DOXA 3Q8CA 4JPSA 4A55A 5BYSA 1FO4A 2WU2B 3BVMA 2J53A 4NZLB 1J7AA 1MHHE 4WQMA 1YQ4B 1E9MA 2AX5A 4IKGA 4YSYB 1PFDA 4EE2A 2IPKD 3SFDB 4C80A 1IUEA 1QOGA 3TEWA 2JWUA 1L5PA 4YWGG 1SJED 1K51A 2JZPA 2EELA 1TS4A 2M56B 4OZCA 1JW9D 1TS2A 3SR6A 3NVWA 2MJEA 5TSSA 4US9A 3RPFC 3HRDD 4LTUA 5HFYA 1D6EC 2X38A 1I4QA 3AE9B 5C3JB 1C9FA 1XXGA 1FXAA 2V3PA 5LNK1 2CU3A 3VR8B 4OHJA 1TZOA 3P63A 4OVZA 2Y5CA 1WXQA 4XWWA 1WRIA 2WDVB 2HDEA 1STEA 3BVGA 4HRSA 2PIAA 2WXQA 2WDRB 2BS4B 1TS3A 3MHZA 2PVOD 2ZW1A 3AM9A 1AWDA 4ZHPA 1ROEA 2QEJC 1HQRD 1F2RI 1FNUA 1SBBB 2KAJA 2SAKA 2LJIA 1V1PA 5GXGB 1UWMA 1FD6A 3IT6B 4N59A 2LHDA 2WXNA 4NAWB 3CWIA 4WWMA 5AUIA 1HEZE 3AE8B 2WNMA 4RGNA 1FFVA 3ZGZA 5HI1A 1V8CA 4KGTA 1J7CA 3BK1A 1SIJA 1JRPA 1QT9A 3U2SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HTM E;  2WU5 B;  2WLB A;  1YQ3 B;  2QJL A;  3B9J A;  1F0Z A;  3P1M A;  1FFU A;  2WS3 B;  1GT8 A;  3AEB B;  1CZP A;  2BS3 B;  1FRR A;  1N60 A;  1NVI D;  2H89 B;  1R7S A;  1L0V B;  4ZOH C;  4YTN B;  2WP9 B;  1PUT A;  5EE1 A;  3HVZ A;  5G5G A;  1AYF A;  3L4P A;  4ITK A;  2E3T A;  1KF6 B;  3AE4 B;  1NEK B;  1OFF A;  1RWS A;  1A70 A;  1E10 A;  1YJJ A;  2H88 B;  4YT0 B;  3AMZ A;  1DOY A;  3P4S B;  3AEF B;  5AUK A;  3B2G A;  4HRO A;  1H7W A;  2K22 A;  3B2F A;  1KRH A;  1J7B A;  1JWB D;  3SFE B;  1ZOY B;  1E6E B;  4YXD B;  3LXF A;  3NVZ A;  2WQY B;  3P4Q B;  3NRZ A;  4JWS C;  1XO3 A;  3P4P B;  1L6U A;  2W54 A;  3AH7 A;  3DWM A;  2K5P A;  4N6E B;  1SF0 A;  1TYG B;  2M19 A;  5EE0 A;  3AE3 B;  4C7Y A;  3CF4 A;  3NS1 A;  4N58 A;  1N5W A;  3LB8 C;  4P6V F;  2B76 B;  2BS2 B;  1E7P B;  4US8 A;  2G1E A;  2OHF A;  3AN1 A;  3AED B;  5EE9 A;  5H8Y E;  1N62 A;  1B9R A;  1SB3 C;  1XLN A;  1DGJ A;  1TJE A;  1RM6 C;  1XLO A;  1ZXI A;  1V97 A;  1QOF A;  1TKE A;  1VDV A;  2FBW B;  2L52 A;  1YJI A;  4JX1 C;  3W9C B;  2BT6 A;  3FAH A;  1JAL A;  4KX6 B;  1NYQ A;  2W3R A;  5EE3 A;  3P4R B;  1H7X A;  4YTM B;  2DWQ A;  1EWY C;  1ZP0 B;  1FXI A;  5C2T B;  1QOB A;  1WWT A;  2N0S B;  4JWU C;  2JX5 A;  3PO0 A;  3AV8 A;  3VR9 B;  2MJ3 A;  1WYG A;  3ETR A;  1T3Q A;  3W5U B;  1VLB A;  2ACZ B;  1DOX A;  1ZUD 2;  3AB5 A;  1GTH A;  5H92 C;  1FO4 A;  2WU2 B;  1NYR A;  1CJE A;  1J7A A;  3DWG C;  1N5X A;  3CIR B;  1YQ4 B;  1FM0 D;  4WQM A;  1QLB B;  1TKY A;  1E9M A;  1QOA A;  1XLQ A;  2WDQ B;  2AX5 A;  3KWL A;  4YSY B;  1PFD A;  3AEE B;  3AEG B;  2L83 A;  1VJK A;  2MH7 A;  4ZHO A;  3AE5 B;  1JQ4 A;  3SFD B;  4C80 A;  1NEN B;  3AEC B;  1IUE A;  1OQQ A;  1QOG A;  1L5P A;  1TKG A;  3NVY A;  3NVV A;  4FXC A;  2M56 B;  3SR6 A;  3AE2 B;  1JW9 D;  2MJD A;  3NVW A;  4YSZ B;  2MJE A;  1N61 A;  4US9 A;  3RPF C;  2EKI A;  3BII D;  3FC4 A;  3HRD D;  4IDI A;  4LTU A;  1DOI A;  5MPO A;  1I7H A;  2DBY A;  1RYJ A;  3AE9 B;  5C3J B;  1FXA A;  2JQR B;  2CU3 A;  3W5V B;  1N63 A;  4USA A;  1JWA D;  3VR8 B;  3AEA B;  3P63 A;  2Y5C A;  2CJO A;  1WXQ A;  2LEK A;  4C7Z A;  2PVG C;  1WGK A;  3ABV B;  2W3S A;  1WRI A;  1FIQ A;  2WDV B;  5G5H A;  4HRS A;  3VRA B;  1RFK A;  1GTE A;  2PIA A;  4A9A A;  2K9X A;  2WDR B;  2BS4 B;  4YSX B;  1L6V A;  1NI3 A;  2QIE B;  1E0Z A;  2PVO D;  4YTP B;  3AM9 A;  1AWD A;  4ZHP A;  1GPX A;  2Q5W D;  1GAQ B;  1ROE A;  3ZYY X;  1JRO A;  5GXG B;  1KFY B;  2CJN A;  2KAJ A;  3AE7 B;  3AE1 B;  1UWM A;  4N59 A;  3CWI A;  4WWM A;  2PKO A;  5AUI A;  1FRD A;  1OQR A;  3VRB B;  3AE8 B;  3HUI A;  2KMM A;  1FFV A;  1FMA D;  3WCQ A;  1V8C A;  2W55 A;  1QF6 A;  3EUB 2;  1J7C A;  1PDX A;  3AE6 B;  1SIJ A;  1JRP A;  1QT9 A;  1XLP A; 
#chains in the Genus database with same CATH topology
 4M02 A;  5FR6 A;  2KDM A;  2WXR A;  3ZRF A;  5JHA A;  2WXP A;  3AXC A;  3T3N A;  3VUW A;  4CYE A;  5EE1 A;  2GBN A;  4TUU A;  2E3T A;  3Q3F A;  4K3B A;  3NJT A;  4NJ7 A;  2JRH A;  3C8Y A;  4EKU A;  3AI5 A;  3UIP B;  1P9D U;  4FBJ B;  2WDT B;  3T9L A;  1I4H A;  1G6J A;  3A9K A;  4NJC A;  4W9E A;  3TEZ A;  2OOB B;  4UDU C;  1ENF A;  3R2T A;  1I4P A;  2L52 A;  2GOW A;  1UD7 A;  3BYT B;  1WX7 A;  1RLF A;  2MCN B;  1EWY C;  2N0S B;  2ZJD A;  3HK0 A;  1UGM A;  4FUL A;  2KQ7 A;  2JWZ A;  3IXS A;  4TMA B;  3GB1 A;  3DBH I;  3ZQ4 A;  2D07 B;  1NYR A;  1N5X A;  2R2O A;  1FM0 D;  1WE7 A;  5BMG A;  4LJP B;  2ICI A;  1K53 A;  1WXA A;  3NVY A;  4EUT A;  4AQ7 A;  4HEA 1;  2V9H A;  1MI0 A;  2CHX A;  1OGW A;  2K6D B;  2VH1 A;  4USA A;  3SHQ A;  2CJO A;  2RPV A;  1EU4 A;  2PVG C;  2V3S A;  3VRA B;  3Q2A C;  4OVU A;  2DYB A;  1VCB A;  3HIZ A;  3V6C B;  5C1Z A;  3OLM D;  3QAQ A;  1RFA A;  3DDC B;  3IT4 B;  1JRO A;  1MG4 A;  4X57 B;  2GB1 A;  2KVZ A;  2L0T A;  2KN5 A;  3DBL B;  4RH6 A;  3U7D A;  4BOZ B;  2AL6 A;  3EUB 2;  2MQJ A;  3MC9 A;  3URY A;  4PT5 A;  2K8B A;  1GT8 A;  2BS3 B;  4ZOH C;  3CMM B;  3TSS A;  1V49 A;  4E71 A;  3L17 A;  1AYF A;  4BVU C;  1C1Y B;  1E10 A;  2PTL A;  3EGR A;  1FPY A;  1GOZ A;  4HRO A;  2QMT A;  2KVR A;  1JWB D;  4YXD B;  2KQS A;  2DZK A;  4NNJ B;  3VHT C;  1KLU D;  2O6V D;  4LNI A;  3DPD A;  4A3O A;  3NS1 A;  2B76 B;  1H8C A;  1ZGU B;  3PHX B;  2O2V B;  2KHW B;  2GBR A;  3ZDT A;  4B9K A;  5H8Y E;  1XLN A;  1DGJ A;  2JT4 B;  1WR1 A;  1L0Y B;  1V97 A;  1V6E A;  2FE8 A;  4MJS B;  2D3A A;  3VDZ A;  3T3O A;  1JAL A;  4LDT B;  1E5W A;  5BYQ A;  3ZJU A;  4JWU C;  1FXI A;  3U8Z A;  5DPW A;  2LUM A;  2MW5 A;  3IHP C;  2WXM A;  1T6B X;  4GDK A;  2INP E;  1GTH A;  1WX8 A;  3DWG C;  1QKZ A;  1QLB B;  3GE3 C;  1QOA A;  2ZNV B;  2ZPY A;  2FIF A;  2BB6 A;  2KX0 A;  2JYT A;  3ZNZ B;  2MJD A;  3VXW A;  2EKI A;  2KFK A;  4IDI A;  4FA6 A;  1WXM A;  3RNE C;  2L05 A;  4DDI D;  3PTF C;  2BYV E;  2RSU A;  3J9C A;  4C7Z A;  1WGK A;  2LGI A;  2AL3 A;  4C56 C;  3MC0 B;  4KGS A;  3AE7 B;  4CQN A;  1A5R A;  2C5L C;  1QIL A;  3VRB B;  1WFY A;  3Q14 C;  3WCQ A;  2RPQ A;  4F7Z A;  2QSD A;  2V4I B;  4FN2 A;  2AQ1 B;  2BB5 A;  1E7U A;  3RUI B;  1R7S A;  4IM0 A;  2VH2 A;  4WIP A;  3FKY A;  2MSE D;  1I4X A;  3SU8 X;  1YJJ A;  4IWP A;  3KQ4 A;  4RM9 A;  3QC8 B;  3A1Q A;  1H7W A;  1CK1 A;  2KAN A;  1J7B A;  4G0N B;  4AS1 A;  2K5P A;  2IBI B;  4C7Y A;  1GNU A;  2N9X A;  4P6V F;  1E7P B;  4W9J A;  4NQL B;  1TIF A;  1IPG A;  1L7Y A;  2LFI A;  4GDL B;  3U52 E;  4LNN A;  2FBW B;  3W9C B;  3N1X C;  1J8C A;  2AEH A;  5EE3 A;  4ANU A;  3KH0 A;  1UUP A;  1WYG A;  1VLB A;  3EHV A;  5H92 C;  3VQI A;  4WJQ A;  3QIJ A;  3GP7 A;  2MBH A;  3PZ7 A;  1AW7 A;  3L16 A;  4YL8 A;  4W9K A;  2KTR A;  4M8N A;  1CQV A;  1D5Z C;  1L0X B;  1S3S G;  4GN1 A;  4BZA A;  4FJV B;  1T0Y A;  3DHG C;  3N30 A;  4KDL B;  1BML C;  2I38 A;  3R8B A;  1RYJ A;  4L1B A;  4II3 B;  2IGG A;  1N63 A;  4JQW C;  3LDZ E;  5J18 A;  3CF6 E;  1JCK B;  5D6J B;  2FCQ A;  2LAS A;  1L6V A;  2WX1 A;  3DHI C;  4B0E A;  2Q5W D;  2DAJ A;  1KFY B;  2HJ1 A;  4OZA A;  2IND C;  2MBQ A;  2PKO A;  2D3G A;  3NZU A;  4ICV A;  1WJ6 A;  2WHI A;  1F0Z A;  4HJK A;  1FRR A;  2CS4 A;  4BKS A;  1D5M C;  1R4M B;  3X0W A;  1JWU D;  1DOY A;  1WX9 A;  5CHF A;  1OQY A;  2LD9 A;  3NZS A;  2IO0 B;  4N9F 4;  2KC1 A;  5D7G A;  1D4B A;  1I4R A;  4US8 A;  2IJ0 A;  3PPA A;  2PJH A;  1X1M A;  3KLS X;  2ZVO A;  3PRE A;  2KKC A;  4W9H A;  1TY0 A;  1VDV A;  3HHM A;  1V81 A;  3A4R A;  3S2A A;  5HKH A;  5BMI A;  1Z5S B;  3RI7 C;  1HA5 A;  4JLC A;  3Q8A A;  4KDI C;  3KW5 B;  1P1A A;  2OJR A;  3Q8C A;  4ZRI A;  4LNK A;  5BYS A;  3OG5 A;  4WQM A;  2IYD B;  2K39 A;  4IG7 B;  1PFD A;  4EE2 A;  3SFD B;  2JWU A;  3BIN A;  4US9 A;  1J0G A;  5HFY A;  4W9F A;  5C3J B;  1XXG A;  1F9J A;  1FXA A;  2V3P A;  2QHO A;  4OHJ A;  4OVZ A;  2Y5C A;  1WXQ A;  5IP4 D;  4WJP A;  3H1U A;  3I5J C;  1E8X A;  1STE A;  3JW0 X;  2PIA A;  2WDR B;  3MHZ A;  2K1F A;  2M17 A;  1ROE A;  5AEK B;  1FD6 A;  1V2Y A;  3D32 A;  5AUI A;  1HEZ E;  3ZGZ A;  4KGT A;  3BK1 A;  1JRP A;  1QT9 A;  5IO9 A;  4L2Y A;  3VTV A;  1IYF A;  3HM6 X;  3RNF C;  1NVI D;  3VTU A;  2NCN A;  3M63 B;  3HVZ A;  2D5G A;  1WZ3 A;  2KX3 A;  2IGH A;  4FHK A;  3RNB C;  3SD5 A;  2A5U A;  4ASW C;  1GB1 A;  1NI2 A;  3SFE B;  3AE3 B;  2R2Q A;  2CHW A;  4B0M A;  1JML A;  2ONQ A;  3DVG X;  1F77 A;  2BTE A;  3H9D A;  2V0G A;  1K8R B;  2KOX A;  2DYO A;  1YX6 B;  3Q8E A;  1IGC A;  5FKA C;  1XLO A;  3I57 A;  2W9N A;  3QX1 A;  4TQ0 A;  4ZYS A;  1EF1 A;  1FCC C;  2IGD A;  4KX6 B;  2W3R A;  2C9W B;  3SEB A;  3PO0 A;  2FID A;  3KWV A;  2KD0 A;  3A4S C;  4RNA A;  1KJT A;  4AOF A;  3PHW B;  2W82 A;  1SGH A;  1XLQ A;  3AEE B;  1C77 A;  4O1N A;  2DZJ A;  2B3A A;  3PLV A;  5C23 A;  4C4V A;  2IO2 B;  4HVB A;  2WXJ A;  1GG3 A;  2DLB A;  3APD A;  1I7H A;  4CO7 A;  1PGA A;  4KZC A;  3MC8 A;  1E90 A;  3DHH C;  3BY4 B;  2KWD A;  3MFG A;  2M0X A;  1GTE A;  4S17 A;  1C3T A;  2FCS A;  2L76 A;  3A9J B;  3W2D A;  2JY6 A;  2K8H A;  3HUI A;  1WZ0 A;  2FUH B;  2N1W A;  2GMI C;  2BWE S;  4G3X B;  4EZK A;  1V1P B;  3MTN B;  3PT2 B;  4TQ1 A;  2KJH B;  2KLC A;  3L13 A;  3T8M A;  4LLG M;  3ZTD A;  1KF6 B;  1RWS A;  4WQO B;  4G11 A;  4XC2 A;  2D3B A;  2GLS A;  4ARC A;  3ZKJ C;  2K22 A;  1L4Z B;  3P4Q B;  2PLP A;  2BPS A;  4JWS C;  4ANV A;  4N6E B;  2KLG A;  5EE0 A;  3DVN U;  1F52 A;  5G2N A;  2C7N B;  1WJN A;  3VH3 B;  2D3C A;  1XF5 L;  1FCL A;  1N6Z A;  2KZR A;  2GBJ A;  3KYD D;  5L95 C;  3PLU A;  1SE4 A;  1RAX A;  3A9K B;  2PE9 A;  4ANW A;  2RDH A;  3QQ8 B;  2DZM A;  2HD5 B;  3FAH A;  1BUI C;  3PV1 A;  4URK A;  1XQQ A;  4HJG E;  2JX5 A;  1E8W A;  2WXL A;  3DCG A;  3JSV A;  1JRU A;  2AQ3 B;  1Q5W B;  3JYU A;  4RM8 A;  1YIW A;  1CJE A;  4EZL A;  2N7J A;  3RZF A;  1ET9 A;  1TKY A;  1MG8 A;  3KWL A;  2NBV B;  3KVF B;  2KQ4 X;  2CKH B;  1OQQ A;  4W9L A;  1GC7 A;  1ZPS A;  2AWT A;  3BII D;  4WWO A;  2DBY A;  2GRI A;  1YQB A;  4A6Q A;  1I4G A;  2KFJ A;  2A4Z A;  4GIV A;  2G4S A;  2LEK A;  4OW0 A;  1V80 A;  2VRR B;  2D11 A;  4LDT D;  2HE7 A;  4FHJ A;  4KVG B;  3RZW C;  1AAR A;  4DXG A;  5I4D A;  1SEB D;  3V3X A;  1HE8 A;  1XLP A;  1WE6 A;  5T8I A;  1KLG D;  3WAP A;  3KYC D;  2LHE A;  1FFU A;  1WIA A;  2N9L A;  5GMV A;  3ML8 A;  4DHZ E;  2IY1 B;  2BVC A;  1Y56 A;  4XDD A;  4II2 B;  3EFC A;  4HPL B;  4WAF A;  1HTQ A;  3RCZ A;  5AUK A;  4KSK C;  4BBN C;  3ZNG C;  2LGX A;  3AU5 A;  3IVF A;  3Q8F A;  3P4P B;  1TS5 A;  3TEY A;  3OJ4 B;  1SXT A;  4KIK A;  5FK9 C;  3EC8 A;  2OHF A;  5DPR A;  1NDD A;  3EEC A;  2C7M B;  4NY0 A;  4EOY A;  3N3K B;  2LZ6 A;  2FNJ B;  2G9H D;  4PYU A;  1GUA B;  3WIM A;  1C76 A;  5AZH A;  2WXI A;  1ZXH A;  3M62 B;  2K25 A;  4K3C A;  3PSE B;  3AB5 A;  3DOW A;  3DBL I;  2ZVN A;  1L4D B;  1V9J A;  1Z2M A;  2J7Q B;  1KLV A;  1VJK A;  1YN4 A;  4HXD A;  3AEC B;  3GOE A;  4GGQ A;  5CHV C;  4GDK B;  4HDQ A;  2M4N A;  4FLH A;  2LVO A;  4RFB A;  2JXT A;  2M0A A;  4IW0 A;  1YJ1 A;  2NR2 A;  4KKJ A;  1XEE A;  3AEA B;  3NOB A;  2NPT A;  1PGX A;  2KFK B;  5G5H A;  2KWU B;  1ZE3 D;  4ANX A;  1IGD A;  1Q0W B;  3ZYY X;  2R61 A;  1OEY A;  1OQR A;  5IA7 A;  2JZZ A;  3AE6 B;  2Y3A A;  2M8S A;  2WU5 B;  3P1M A;  2DZI A;  2N4F A;  3VUY A;  2DYM A;  3ZJT A;  5IOI A;  3UIO B;  1S1Q B;  3N1Y C;  4DQO C;  4Q2J A;  4RMA A;  1UEL A;  2NTT A;  2MEK A;  4J6I A;  5DPT A;  4ZRQ A;  4KSL C;  5IAA C;  2M19 A;  3A1Q B;  4N58 A;  3RD2 A;  3TL5 A;  3TCA A;  3ALB A;  2JPH A;  2BGF A;  1YNT E;  4WUR A;  1UH6 A;  2Z8L A;  3BYY B;  3Q3J A;  2WXK A;  4K7U A;  1SB3 C;  1F1H A;  3ZO5 B;  1YX5 B;  5EDS A;  2KTF A;  2IO1 B;  3MJ5 A;  3JVZ X;  2PEA A;  1SE3 A;  4PS8 A;  4YTM B;  3P42 A;  2INC C;  2KMC A;  3Q69 A;  1WMH A;  2NS5 A;  5E6J A;  2QDF A;  1WGY A;  1DOX A;  4JPS A;  1V86 A;  3PVL A;  2KDB A;  3IBE A;  2KDI A;  4AJW A;  1U4A A;  5JZE B;  1E9M A;  2RDB C;  5BO4 B;  4C80 A;  3B08 A;  3VUX A;  2DAF A;  1HTO A;  1K51 A;  2JZP A;  4HPM B;  1TS4 A;  4OZC A;  1TS2 A;  2IY0 B;  3NVW A;  2LJ5 A;  2NBU A;  5TSS A;  4MH0 E;  4G50 A;  1D6E C;  2KTR B;  2O6V A;  4EFO A;  4WJO A;  3R7Q A;  1C9F A;  4MM3 A;  1P3Q U;  2CU3 A;  2DHZ A;  2G45 B;  4MEM A;  3P63 A;  4XWW A;  2V1Y A;  2WDV B;  2G3Q B;  3EFU A;  1TS3 A;  3NHE B;  5GXG B;  1FNU A;  1SBB B;  4W9C A;  3IT6 B;  2WXN A;  3CWI A;  2MWS B;  5KHO A;  1V8C A;  2G4D B;  3U2S C;  3APC A;  1YQ3 B;  5FR3 A;  2KN4 A;  1B1Z A;  3UGB B;  2ZCB A;  2WP9 B;  4BOS C;  5KHQ A;  2I2Y A;  3CSF A;  5LXI B;  3TEX A;  2ON8 A;  1KH0 A;  4HKQ A;  1WF9 A;  3TIX A;  4KGR A;  2JXX A;  4PS3 A;  2KXJ A;  3N9Y C;  1ZOY B;  1E6E B;  2L00 B;  2Y5B B;  3NRZ A;  2MHJ A;  1Q1O A;  2LGD A;  2WXH A;  4DHJ B;  4GB9 A;  3CF4 A;  1N5W A;  2KYW A;  4MSQ B;  3BZD B;  1E7V A;  2LGS A;  1I42 A;  1TJE A;  4F1S A;  1RM6 C;  1ZXI A;  2JU6 X;  4JX1 C;  4K7W A;  4ZRK A;  2BKF A;  4RF1 A;  1WJU A;  4S0R A;  1JWM D;  2HTH A;  4E3C A;  2UWQ A;  5AZG A;  3MJW A;  1QQR A;  1T0Q C;  2V4L A;  2D2Q A;  2N9P C;  1TKG A;  3QK0 A;  3TBL D;  2UYZ B;  3VH4 B;  3ZXR A;  2C7H A;  1N61 A;  2VZK B;  4HCP B;  3FC4 A;  1BXT A;  4R3D A;  2QCZ A;  1R4M I;  3RYT A;  2BW2 A;  1EWC A;  4LJO B;  4MAC A;  1RFK A;  2ZNV C;  5JH5 C;  1NI3 A;  4YSX B;  1E0Z A;  1VRA B;  5AZF A;  4A90 A;  4JL9 A;  2N7D A;  3LYY A;  2KMM A;  2W55 A;  3HVD A;  4E74 A;  5CHW A;  2XK5 A;  2HJ8 A;  2NBW B;  2JYE A;  2LRW A;  2L0F A;  3TMP B;  4XE0 A;  5HHD G;  2KWV B;  2BYE A;  2OJW A;  1WJ4 A;  5D2M B;  4I6L B;  2N9K A;  2PW9 A;  2YEP F;  3RT3 B;  2DNF A;  4IM3 A;  1LGR A;  2BBC A;  3ENE A;  4KV2 A;  3V6E B;  2MBB B;  4BBN F;  1VZ8 A;  1KRH A;  4D2K A;  2KO3 A;  2FUG 1;  2W54 A;  3IAM 1;  1WSP A;  1SIF A;  1T0R C;  3LB8 C;  4H2A A;  2X8X X;  3L08 A;  2NTS A;  3WAL A;  3IAS 1;  5EE9 A;  1J19 A;  1WH3 A;  2ZCC A;  1UGJ A;  1QZE A;  5JHB A;  1YJI A;  4I6P A;  1FNV A;  1H7X A;  5IKC M;  2IZV B;  4FAD A;  1VR9 A;  1WM3 A;  1LQB A;  1TTN A;  1ZUD 2;  2YLM A;  3I9V 1;  1MPE A;  2PPH A;  3ZNH B;  5G55 A;  2WDQ B;  3AE5 B;  3ZDM C;  4TKN A;  4ICU A;  4FXC A;  3RFZ B;  4JE3 B;  3DQV A;  5LXH A;  1M94 A;  3DBR B;  4IUM B;  1WGG A;  4FJZ A;  2ZZP B;  1JWA D;  3Q6B A;  4C4V B;  3C19 A;  4MH8 A;  3C0R B;  4DDG D;  2SEB D;  2K3U A;  4W9G A;  4P16 A;  3X23 A;  2K9X A;  3FIL A;  4A3P A;  1GPX A;  4BKG A;  2MLB A;  3VAW A;  4DWF A;  4KZ0 A;  1UWX A;  2KC2 A;  4RCO A;  3VFK A;  3R7R A;  2UU7 A;  3V60 A;  3K9O B;  1KOT A;  4NJ6 A;  1CZP A;  4DK5 A;  3GZN B;  2WX0 A;  3ECI A;  5DCN A;  3OWE B;  3L4P A;  2DEN B;  3ZUN A;  1A70 A;  1T5X D;  3H7P A;  4PS7 A;  3Q3N C;  2N7E A;  3AUL A;  1UF0 A;  2KDE B;  1YOV B;  1ZKH A;  1WXV A;  1TYG B;  3Q8B A;  2LUE A;  4HK2 A;  3NZ3 A;  2E6X A;  4NPN A;  3RN9 C;  2L1A A;  4ZDV A;  4K7S A;  4XGA B;  4B95 A;  1YN5 A;  1SSN A;  2IO3 B;  4MSM B;  3BVZ A;  4WJN A;  5JXV A;  2L7R A;  4ZRP A;  3AV8 A;  3W1S C;  1ESF A;  4LNO A;  3UQB A;  1WYW B;  4HDO A;  3IG3 A;  1D5X C;  1D3Z A;  1XT9 B;  4J3O D;  3CIR B;  1OEY J;  4OVV A;  3O13 A;  2KAC A;  2L83 A;  5CX3 A;  3JSV B;  1JQ4 A;  4DBG A;  1NEN B;  5D3I B;  3NVV A;  2GBK A;  4MEL A;  3RNA C;  3ZLZ A;  4M01 A;  1KTK A;  2L32 A;  3R2I A;  1C4C A;  2N1V A;  4MGK E;  3ABV B;  4NAW A;  2XNA C;  2QIE B;  3N32 A;  5HG2 A;  3VVW B;  3N1Z C;  2WXO A;  3DBH B;  1GC6 A;  2I1K A;  2AQ2 B;  3UIN B;  1PDX A;  1UBQ A;  2LVQ A;  2HTM E;  5E6P A;  2WLB A;  3PGE A;  4AWJ A;  4YTN B;  1EU3 A;  2N9E B;  4GU2 A;  4K1R B;  4LCD E;  4HLE A;  4BAX A;  3ZRC A;  1WM2 A;  3LXF A;  2Y5P A;  3ML9 A;  2MBE A;  2WQY B;  2V3N A;  2INN E;  1WXS A;  2J42 A;  2DX5 B;  3B0A A;  1K52 A;  1YMH E;  1BT0 A;  1ZDX A;  2JF5 A;  3U30 A;  4ZRJ A;  1N62 A;  1XD3 B;  3KUC B;  3TUO A;  4KIK B;  2QC8 A;  1NYQ A;  3BWU D;  2Z0D B;  1ZP0 B;  1WWT A;  2LRU A;  4KKI A;  1JWS D;  2MJ3 A;  2XN9 C;  3QCA A;  4MGZ E;  4WWN A;  4WWP A;  3ZNI D;  2WU2 B;  3H7S A;  2J53 A;  1J7A A;  1MHH E;  3UQA A;  3L0W B;  4IKG A;  4YSY B;  1IUE A;  1QOG A;  3TEW A;  2MBO A;  2M56 B;  3SR6 A;  1JW9 D;  2MJE A;  2LGY A;  4XYC A;  2X38 A;  1L2N A;  1FXT B;  3AE9 B;  1I4Q A;  5LNK 1;  3VR8 B;  1TZO A;  1WGR A;  4XX5 A;  3BVG A;  1OTR B;  2BS4 B;  2PVO D;  1P0R A;  2ZW1 A;  4K81 A;  4P1B C;  2QEJ C;  2SAK A;  1F2R I;  2KAJ A;  3PS6 A;  3QWZ B;  2NPT B;  3AE8 B;  1FFV A;  2REX A;  1V5O A;  1J7C A;  1EF5 A;  2M1M A;  4M8M A;  4CHK A;  2RR9 A;  3RUL A;  5D94 A;  2TSS A;  1N60 A;  2H89 B;  2LXC A;  1L0V B;  2JRI B;  3B1L X;  1PUT A;  2J0K A;  3AE4 B;  1ET6 A;  1NEK B;  3WA0 A;  2H88 B;  1EUV B;  4YT0 B;  2WXG A;  4WAA A;  4FJY A;  3P4S B;  3U4E G;  1TT5 B;  1IBX B;  4MGY E;  3B2F A;  3KUD B;  2O2V A;  2ZW0 A;  2BYF A;  1L6U A;  3DWM A;  1SE2 A;  1VZ7 A;  2ASQ A;  2FAZ A;  2BS2 B;  4MJS A;  1E8Y A;  4RF0 A;  1IBX A;  3QHT A;  4JGH B;  4TV3 A;  3AED B;  1B9R A;  2JSV X;  1TKE A;  2BKR B;  3A33 B;  1HZ5 A;  5E6N A;  1PQS A;  2J52 A;  5D3D A;  2KNB A;  5C2T B;  2RGF A;  3CST A;  4PK1 A;  2MX2 A;  2WYQ A;  2ZPN A;  1E8Z A;  2CR5 A;  3MHS D;  4IWQ A;  2WWZ A;  3L54 A;  4GSW A;  3WAO A;  1WMH B;  3ONS A;  2K8C A;  4OZB A;  4ARI A;  4BKS D;  4LNF A;  3Q3M C;  2AYO B;  1NBF C;  4DHJ D;  5MPO A;  3M95 A;  1PGB A;  1PYW D;  3UF8 A;  1ZW7 A;  3PZ8 A;  1HXY D;  2BF8 B;  2W3S A;  1FIQ A;  2O6V B;  3TJP A;  1WR6 E;  4MM3 B;  3RNG C;  1YD8 U;  3APF A;  2CJN A;  3WAN A;  1WGH A;  2JVC A;  2EMS A;  1IP9 A;  2MA9 B;  4AJY B;  1FMA D;  1P7F A;  2J0J A;  4GMV A;  2XEW A;  4AP4 C;  3B9J A;  3DVN V;  1EM7 A;  4HPP A;  4I6N B;  5G5G A;  5L83 A;  2NVU I;  4ITK A;  2FCN A;  2VZK D;  1OFF A;  1WGD A;  2KK8 A;  4HKZ E;  2WGS A;  4NQK E;  2EKE C;  3U7Z A;  4RGO S;  1LM8 B;  3K9P B;  3MP9 A;  3ZVV A;  3NVZ A;  4B6W A;  3H8H A;  2CU1 A;  3V05 A;  1XO3 A;  4XWT A;  3AH7 A;  1DYQ A;  4GDL A;  1SF0 A;  2J4X A;  2NMQ A;  4REZ A;  1C78 A;  4W9I A;  1CMX B;  4GLS C;  1FNW A;  4A20 A;  3E9S A;  3M3J A;  3W1Y A;  3P4R B;  4ACF A;  3H6N A;  3W5U B;  4IC7 B;  2ACZ B;  1F2R C;  1MVK A;  2LVP A;  4DXA B;  3L10 B;  2MH7 A;  4BKT A;  4GOC A;  1ZDV A;  3NUH B;  2L8J A;  2Z0E B;  4EEW A;  3AE2 B;  1VD2 A;  1TY2 A;  1WI0 A;  2LI5 A;  2JZ3 B;  3QA8 A;  1UBI A;  1KM7 A;  1C4P A;  2KWC A;  3W5V B;  2RDG A;  3OAW A;  2WXF A;  3QAR A;  3GS2 A;  3EA6 A;  1EO6 A;  1TBE A;  3I3T B;  4NAM A;  1I35 A;  4W9D A;  3ZXV A;  3AE1 B;  4MGI E;  1R4N B;  4LK0 M;  4M0W B;  2KT7 A;  1QF6 A;  1K50 A;  2FCM A;  2QJL A;  1M4V A;  4RGM A;  2WS3 B;  1WRD B;  4XZ4 A;  2RD0 A;  4M0W A;  3PRP B;  1T0S C;  4A8X C;  2GI9 A;  4DHZ B;  4RGT A;  2XK5 B;  3W1S A;  5CTR C;  5TR5 A;  1ACC A;  1P7E A;  4QAY A;  4HWI B;  2BQQ A;  3AEF B;  2PE6 B;  1AN8 A;  2PMV A;  4GXB A;  3VTW A;  1R4N I;  3ZTC A;  2D10 A;  3LJ3 A;  2G1E A;  1GB4 A;  5J2R A;  3R66 C;  2BWF A;  5LLI A;  5BMH A;  4BFR A;  2MRP A;  1QOF A;  4MT5 A;  3DVG Y;  1C4A A;  4PYZ A;  3V62 A;  2LMC A;  2I1J A;  2KDF B;  4TSS A;  1QOB A;  3VR9 B;  2ZEQ A;  5E6O A;  3QJZ A;  1XCQ L;  3HM3 A;  4HCN B;  1YN3 A;  5BYR A;  1Y8R C;  1TGZ B;  1LO5 D;  1V1O A;  4ZHO A;  3AEG B;  2CHZ A;  1P98 A;  3WAM A;  2K6Q A;  3IFW B;  2EMT A;  2KJR A;  4YSZ B;  1Q10 A;  1RRB A;  1DOI A;  3RNC C;  2JQR B;  2BYT A;  2L3Z A;  1LFD A;  2OED A;  1SJH D;  1XCT L;  1C79 A;  3ZJV A;  3PZD A;  4A9A A;  1GJZ A;  2IDY A;  2J0M A;  3N20 C;  1MFW A;  3ZIM A;  4YTP B;  2K0P A;  1GAQ B;  2YEP B;  4DXF A;  3KUZ A;  2MP2 B;  1FRD A;  2Z59 B;  2XBB C;  3FIL B;  2YVC A;  4IOI E;  2KMA A;  5J17 A;  2LWP A;  3NY5 A;  3NG0 A;  3AEB B;  1FEH A;  3E56 A;  4IM2 A;  2MP2 A;  1UNS A;  3NS8 A;  1V5T A;  4EZJ A;  4M00 A;  3AMZ A;  2C60 A;  4WH4 A;  3B2G A;  4JIO U;  4MDK E;  3RMK C;  3I63 C;  4P1C C;  3DBS A;  3AU4 A;  3H7P B;  1WY8 A;  3OJ3 A;  2QIL A;  2KJ6 A;  2RMM A;  3SDL C;  3DBR I;  5IN7 A;  4ZYN A;  1HZ6 A;  3AN1 A;  4C00 A;  2JUO A;  4XDC A;  1TZ1 A;  2BT6 A;  1VZ6 A;  5DPS A;  3UI3 A;  1MJD A;  2DWQ A;  1MHX A;  1LXD A;  1ISN A;  3ETR A;  1T3Q A;  3BK2 A;  4L23 A;  2GBM A;  4A55 A;  3Q3O C;  1FO4 A;  3BVM A;  4NZL B;  1YQ4 B;  2AX5 A;  2IPK D;  3V61 A;  3PRZ A;  1L5P A;  4YWG G;  1SJE D;  2EEL A;  3GZN I;  4F8C B;  3RPF C;  3HRD D;  4LTU A;  4AUQ C;  3A9J A;  3P2B A;  3O65 B;  4P7I A;  1WRI A;  2HDE A;  4HRS A;  2LXA A;  2WXQ A;  1UZX B;  1SE9 A;  3R3M A;  3PRM B;  1H4R A;  3ZW3 A;  3AM9 A;  1AWD A;  4IWO A;  4ZHP A;  1HQR D;  2LJI A;  1V1P A;  1UWM A;  3GE8 C;  2LHD A;  4N59 A;  4NAW B;  4WWM A;  2WNM A;  4RGN A;  5HI1 A;  1SIJ A; 
#chains in the Genus database with same CATH homology
 2KDM A;  2WXR A;  4L2Y A;  1YQ3 B;  2WXP A;  5FR3 A;  2TSS A;  2KN4 A;  3T3N A;  1N60 A;  1B1Z A;  1NVI D;  2H89 B;  1L0V B;  2WP9 B;  1PUT A;  5EE1 A;  2I2Y A;  3HVZ A;  2D5G A;  2E3T A;  3TEX A;  2ON8 A;  3AE4 B;  1ET6 A;  1NEK B;  2IGH A;  1KH0 A;  2H88 B;  3C8Y A;  4HKQ A;  4YT0 B;  2WXG A;  3U4E G;  3P4S B;  1GB1 A;  1IBX B;  4KGR A;  3B2F A;  3SFE B;  3N9Y C;  1ZOY B;  1E6E B;  2ZW0 A;  3NRZ A;  1L6U A;  3DWM A;  2WXH A;  1I4H A;  1SE2 A;  3AE3 B;  1VZ7 A;  3CF4 A;  1N5W A;  4B0M A;  1JML A;  2BS2 B;  2ONQ A;  4RF0 A;  4NJC A;  1F77 A;  1IBX A;  2BTE A;  3AED B;  3BZD B;  2V0G A;  3TEZ A;  1B9R A;  4UDU C;  2DYO A;  3Q8E A;  1ENF A;  3R2T A;  1IGC A;  5FKA C;  1TJE A;  1I4P A;  1RM6 C;  1XLO A;  1ZXI A;  2JSV X;  2JU6 X;  1TKE A;  2L52 A;  3I57 A;  4JX1 C;  4TQ0 A;  4ZYS A;  3BYT B;  1FCC C;  1HZ5 A;  2IGD A;  4KX6 B;  2W3R A;  2J52 A;  5D3D A;  1EWY C;  2N0S B;  4RF1 A;  5C2T B;  3SEB A;  3PO0 A;  1JWM D;  3KWV A;  3IXS A;  4TMA B;  3GB1 A;  4RNA A;  3ZQ4 A;  1NYR A;  1N5X A;  1FM0 D;  2W82 A;  1XLQ A;  5BMG A;  2ICI A;  1QQR A;  3AEE B;  1C77 A;  4O1N A;  4OZB A;  4ARI A;  1TKG A;  1K53 A;  3NVY A;  2WXJ A;  1N61 A;  2VZK B;  5MPO A;  3FC4 A;  2DLB A;  4AQ7 A;  1BXT A;  4R3D A;  4HEA 1;  1I7H A;  1PGA A;  1MI0 A;  1PGB A;  4USA A;  2BW2 A;  1EWC A;  1PYW D;  2CJO A;  2RPV A;  1EU4 A;  2PVG C;  4MAC A;  3PZ8 A;  2KWD A;  1HXY D;  2W3S A;  3MFG A;  1FIQ A;  3VRA B;  1RFK A;  1GTE A;  1NI3 A;  4YSX B;  1E0Z A;  1VRA B;  4MM3 B;  4A90 A;  3W2D A;  3IT4 B;  1JRO A;  2CJN A;  2GB1 A;  3HUI A;  3LYY A;  2KMM A;  1FMA D;  1P7F A;  4RH6 A;  2W55 A;  3EUB 2;  3HVD A;  3URY A;  4PT5 A;  2JYE A;  4XE0 A;  1V1P B;  3B9J A;  5HHD G;  4TQ1 A;  1GT8 A;  1EM7 A;  2BS3 B;  4ZOH C;  3TSS A;  5G5G A;  1AYF A;  2N9K A;  4ITK A;  2PW9 A;  4LLG M;  2YEP F;  1KF6 B;  2VZK D;  1OFF A;  1RWS A;  4HKZ E;  1E10 A;  2BBC A;  2PTL A;  3EGR A;  1VZ8 A;  3U7Z A;  4ARC A;  1GOZ A;  4HRO A;  2K22 A;  4RGO S;  1KRH A;  2QMT A;  4D2K A;  1JWB D;  3MP9 A;  3NVZ A;  4YXD B;  1L4Z B;  3H8H A;  3P4Q B;  3V05 A;  2PLP A;  4JWS C;  1KLU D;  1XO3 A;  4XWT A;  2FUG 1;  2W54 A;  3AH7 A;  3IAM 1;  1DYQ A;  1WSP A;  4N6E B;  1SF0 A;  5EE0 A;  2J4X A;  3NS1 A;  3LB8 C;  4H2A A;  2B76 B;  2NMQ A;  1XF5 L;  1FCL A;  4REZ A;  1C78 A;  2NTS A;  3IAS 1;  5EE9 A;  5H8Y E;  4GLS C;  1XLN A;  1DGJ A;  1UGJ A;  1FNW A;  1SE4 A;  1L0Y B;  1V97 A;  2FE8 A;  1YJI A;  2RDH A;  3E9S A;  3FAH A;  1BUI C;  3T3O A;  1FNV A;  1JAL A;  3P4R B;  1H7X A;  5BYQ A;  4JWU C;  3ZJU A;  1FXI A;  4HJG E;  1VR9 A;  2JX5 A;  2LUM A;  2WXL A;  3W5U B;  2ACZ B;  2AQ3 B;  2WXM A;  1T6B X;  1ZUD 2;  1F2R C;  2INP E;  1GTH A;  1MPE A;  3I9V 1;  1MVK A;  1CJE A;  3DWG C;  1QKZ A;  2N7J A;  1QLB B;  1ET9 A;  1TKY A;  1QOA A;  2WDQ B;  3KWL A;  2BB6 A;  2MH7 A;  3AE5 B;  2KQ4 X;  1ZDV A;  1OQQ A;  3NUH B;  4FXC A;  3RFZ B;  2JYT A;  4JE3 B;  3AE2 B;  1ZPS A;  2MJD A;  1TY2 A;  2EKI A;  3BII D;  4IDI A;  2DBY A;  2GRI A;  4A6Q A;  1I4G A;  1C4P A;  3W5V B;  1JWA D;  2RDG A;  4MH8 A;  3J9C A;  4C7Z A;  2LEK A;  2SEB D;  1WGK A;  4OW0 A;  2K3U A;  4P16 A;  2WXF A;  2K9X A;  3FIL A;  3GS2 A;  2LGI A;  3EA6 A;  4C56 C;  3MC0 B;  1GPX A;  4KGS A;  4NAM A;  3AE7 B;  3AE1 B;  4CQN A;  4LK0 M;  1UWX A;  1QIL A;  3VRB B;  4RCO A;  3WCQ A;  1QF6 A;  2QSD A;  4DXG A;  5I4D A;  1SEB D;  3V3X A;  2V4I B;  1XLP A;  5T8I A;  1K50 A;  1KLG D;  2AQ1 B;  2BB5 A;  2QJL A;  1M4V A;  2LHE A;  1FFU A;  4RGM A;  2WS3 B;  2N9L A;  1CZP A;  1R7S A;  3OWE B;  4M0W A;  4WIP A;  2GI9 A;  3L4P A;  4A8X C;  1Y56 A;  4RGT A;  1I4X A;  4XDD A;  3W1S A;  1A70 A;  1ACC A;  1YJJ A;  1T5X D;  3KQ4 A;  4WAF A;  1P7E A;  3AEF B;  5AUK A;  1H7W A;  1CK1 A;  1J7B A;  1AN8 A;  2PMV A;  3Q8F A;  3P4P B;  4AS1 A;  1TS5 A;  2K5P A;  3TEY A;  1TYG B;  4C7Y A;  1SXT A;  3Q8B A;  4P6V F;  5FK9 C;  1E7P B;  3NZ3 A;  2E6X A;  2G1E A;  2OHF A;  1GB4 A;  2L1A A;  2LFI A;  4GDL B;  3U52 E;  5BMH A;  4MT5 A;  1QOF A;  1YN5 A;  1SSN A;  2FBW B;  1C4A A;  3W9C B;  2LMC A;  3BVZ A;  2G9H D;  1C76 A;  5EE3 A;  4TSS A;  5JXV A;  1QOB A;  4ZRP A;  2WXI A;  3AV8 A;  3VR9 B;  1ZXH A;  1ESF A;  1UUP A;  1WYG A;  1VLB A;  1XCQ L;  1YN3 A;  1D5X C;  3AB5 A;  4J3O D;  5BYR A;  5H92 C;  3VQI A;  3GP7 A;  3CIR B;  3PZ7 A;  1AW7 A;  1LO5 D;  1V1O A;  1L4D B;  4ZHO A;  3O13 A;  2KAC A;  3AEG B;  2L83 A;  1VJK A;  1YN4 A;  1JQ4 A;  1NEN B;  3AEC B;  1CQV A;  5D3I B;  4GDK B;  1D5Z C;  1L0X B;  3NVV A;  4YSZ B;  1Q10 A;  4RFB A;  1BML C;  1DOI A;  2JXT A;  2I38 A;  2M0A A;  3R8B A;  1RYJ A;  4L1B A;  1KTK A;  2IGG A;  2JQR B;  2L32 A;  2BYT A;  3R2I A;  1N63 A;  4KKJ A;  1C4C A;  1XEE A;  3AEA B;  2OED A;  1SJH D;  1XCT L;  1C79 A;  3ABV B;  1PGX A;  3ZJV A;  5G5H A;  4A9A A;  2XNA C;  1JCK B;  1ZE3 D;  2IDY A;  1L6V A;  2QIE B;  1IGD A;  5HG2 A;  4YTP B;  2K0P A;  4B0E A;  2Q5W D;  1GAQ B;  2YEP B;  3ZYY X;  2R61 A;  1KFY B;  4OZA A;  4DXF A;  2WXO A;  2PKO A;  1FRD A;  1OQR A;  3FIL B;  2AQ2 B;  4IOI E;  1PDX A;  3AE6 B;  2Y3A A;  2HTM E;  2WU5 B;  2WLB A;  1F0Z A;  3P1M A;  3AEB B;  1FRR A;  1FEH A;  3E56 A;  4YTN B;  1EU3 A;  2DYM A;  3ZJT A;  1UNS A;  1D5M C;  1JWU D;  3AMZ A;  1DOY A;  4DQO C;  4Q2J A;  4WH4 A;  3B2G A;  2NTT A;  2MEK A;  3LXF A;  2Y5P A;  2WQY B;  2V3N A;  2INN E;  4ZRQ A;  2M19 A;  2J42 A;  4N58 A;  5D7G A;  1K52 A;  2QIL A;  1YMH E;  1I4R A;  2RMM A;  1D4B A;  4US8 A;  1YNT E;  2IJ0 A;  1ZDX A;  4WUR A;  1HZ6 A;  3AN1 A;  3KLS X;  2Z8L A;  3BYY B;  2WXK A;  1N62 A;  1SB3 C;  4XDC A;  1TY0 A;  3TUO A;  3MJ5 A;  1VDV A;  1SE3 A;  2BT6 A;  1VZ6 A;  3UI3 A;  1NYQ A;  3BWU D;  4YTM B;  2DWQ A;  3P42 A;  3Q69 A;  1ZP0 B;  1MHX A;  1WWT A;  5BMI A;  5E6J A;  4KKI A;  1JWS D;  1HA5 A;  2MJ3 A;  1T3Q A;  2XN9 C;  3BK2 A;  3ETR A;  3Q8A A;  4L23 A;  1DOX A;  3Q8C A;  4JPS A;  4A55 A;  5BYS A;  1FO4 A;  2WU2 B;  3BVM A;  2J53 A;  4NZL B;  1J7A A;  1MHH E;  4WQM A;  1YQ4 B;  1E9M A;  2AX5 A;  4IKG A;  4YSY B;  1PFD A;  4EE2 A;  2IPK D;  3SFD B;  4C80 A;  1IUE A;  1QOG A;  3TEW A;  2JWU A;  1L5P A;  4YWG G;  1SJE D;  1K51 A;  2JZP A;  2EEL A;  1TS4 A;  2M56 B;  4OZC A;  1JW9 D;  1TS2 A;  3SR6 A;  3NVW A;  2MJE A;  5TSS A;  4US9 A;  3RPF C;  3HRD D;  4LTU A;  5HFY A;  1D6E C;  2X38 A;  1I4Q A;  3AE9 B;  5C3J B;  1C9F A;  1XXG A;  1FXA A;  2V3P A;  5LNK 1;  2CU3 A;  3VR8 B;  4OHJ A;  1TZO A;  3P63 A;  4OVZ A;  2Y5C A;  1WXQ A;  4XWW A;  1WRI A;  2WDV B;  2HDE A;  1STE A;  3BVG A;  4HRS A;  2PIA A;  2WXQ A;  2WDR B;  2BS4 B;  1TS3 A;  3MHZ A;  2PVO D;  2ZW1 A;  3AM9 A;  1AWD A;  4ZHP A;  1ROE A;  2QEJ C;  1HQR D;  1F2R I;  1FNU A;  1SBB B;  2KAJ A;  2SAK A;  2LJI A;  1V1P A;  5GXG B;  1UWM A;  1FD6 A;  3IT6 B;  4N59 A;  2LHD A;  2WXN A;  4NAW B;  3CWI A;  4WWM A;  5AUI A;  1HEZ E;  3AE8 B;  2WNM A;  4RGN A;  1FFV A;  3ZGZ A;  5HI1 A;  1V8C A;  4KGT A;  1J7C A;  3BK1 A;  1SIJ A;  1JRP A;  1QT9 A;  3U2S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...