1KFYB

Quinol-fumarate reductase with quinol inhibitor 2-[1-(4-chloro-phenyl)-ethyl]-4,6-dinitro-phenol
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
243
structure length
243
Chain Sequence
b'AEMKNLKIEVVRYNPEVDTAPHSAFYEVPYDATTSLLDALGYIKDNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTDGMKVEALANFPIERDLVVDMTHFIESLEAIKPYIIGNSRTADQGTNIQTPAQMAKYHQFSGCINCGLCYAACPQFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMAQLNSQNGVWSCTFVGYCSEVCPKHVDPAAAIQQGKVESSKDFLIATLKPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of the Escherichia coli quinol-fumarate reductase with inhibitors bound to the quinol-binding site.
pubmed doi rcsb
molecule keywords FUMARATE REDUCTASE FLAVOPROTEIN
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 69
structure length 243
sequence length 243
chains with identical sequence N
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2001-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13183 Fer4_8 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 1kfyB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1kfyB01
5H92C 1B9RA 5MPOA 2QIEB 1WRIA 4N6EB 1WWTA 1KRHA 1NVID 3AEGB 4YTPB 1T3QA 3AM9A 4YXDB 4ZOHC 3LXFA 1AWDA 4N58A 1KFYB 2KMMA 1E6EB 3NVYA 3AE1B 3AE5B 1R7SA 1QOFA 3W5VB 2E3TA 1WXQA 2WS3B 4YSXB 2WU2B 1J7AA 3VRBB 2JQRB 3HVZA 2CJOA 2JX5A 2KAJA 2K5PA 1WYGA 1FRRA 1N5XA 2W54A 3AE9B 2W55A 3HRDD 4HROA 4ZHPA 3P1MA 1FO4A 4YTMB 1IUEA 2CJNA 2WDQB 3DWGC 1L5PA 1RM6C 1CZPA 1TKGA 2G1EA 5G5GA 1QT9A 1XLQA 1VLBA 1DOYA 1F0ZA 1ROEA 2L83A 3DWMA 5EE3A 3P4PB 2M56B 2H89B 2EKIA 1JALA 3CWIA 2WQYB 1E0ZA 2K9XA 1QF6A 1V8CA 2MJDA 3AE6B 1N61A 1RWSA 1TKYA 5G5HA 1L6UA 1J7BA 1E7PB 1NEKB 1J7CA 1RFKA 4WWMA 1N63A 4YT0B 1L6VA 2WDRB 2OHFA 4YTNB 4C7ZA 3AV8A 2H88B 1JROA 1E9MA 3PO0A 1L0VB 1JWBD 3KWLA 4N59A 3VRAB 1NYRA 5H8YE 1JWAD 3P63A 1XLOA 2WLBA 1OQQA 2Y5CA 3AN1A 4FXCA 4JWSC 4US9A 4HRSA 3HUIA 1KF6B 3AH7A 3VR9B 1FIQA 5EE1A 1H7XA 1I7HA 4YSZB 2ACZB 1PUTA 1XLNA 3RPFC 3AEAB 1QLBB 5EE0A 3AEBB 2PVGC 1GTEA 1JRPA 4ITKA 1SF0A 2AX5A 1TJEA 3LB8C 3SFEB 1WGKA 1EWYC 3CIRB 1FRDA 1VDVA 3AEFB 3AE8B 1DOIA 1UWMA 1XO3A 2HTME 1ZXIA 2WU5B 1OQRA 3L4PA 4ZHOA 1TKEA 3FAHA 1E10A 3VR8B 1CJEA 1YQ4B 3AEDB 3AECB 1FXIA 1QOGA 4C7YA 4IDIA 2PKOA 2M19A 1GAQB 3NVWA 2CU3A 2W3SA 3NS1A 3NVVA 4JX1C 2WDVB 3AE3B 1PDXA 3W9CB 1DGJA 3SR6A 1DOXA 2PIAA 3P4RB 1SIJA 2PVOD 5EE9A 4WQMA 3BIID 3ZYYX 1FXAA 1AYFA 5AUIA 1XLPA 1YQ3B 2BS2B 5C3JB 1QOBA 2BS3B 3SFDB 1GTHA 1ZP0B 2BS4B 1FFUA 1QOAA 1SB3C 1VJKA 4YSYB 2BT6A 2MJ3A 2N0SB 2W3RA 4P6VF 3WCQA 2WP9B 4LTUA 1RYJA 3NVZA 1NYQA 3CF4A 1V97A 1NENB 1ZUD2 4A9AA 1GPXA 2LEKA 2FBWB 2B76B 4KX6B 1GT8A 1OFFA 2L52A 3NRZA 1JW9D 2DBYA 4USAA 1FMAD 1N60A 1JQ4A 1N5WA 3P4SB 3P4QB 2K22A 3ABVB 3B2GA 3ETRA 5AUKA 1ZOYB 1FFVA 1TYGB 1PFDA 2QJLA 4US8A 1YJIA 4C80A 1H7WA 2MJEA 3B2FA 1N62A 3AE2B 2DWQA 1FM0D 5C2TB 3B9JA 3AMZA 3AEEB 3AE7B 1YJJA 2MH7A 1A70A 2Q5WD 3EUB2 3FC4A 3AE4B 3AB5A 4JWUC 3W5UB 1NI3A 5GXGB
chains in the Genus database with same CATH superfamily
3WANA 3BWUD 4ZOHC 2YVCA 4B0EA 3AE1B 1KLVA 2W9NA 5HG2A 1WIAA 2E3TA 1T0RC 1YMHE 2N9PC 1K52A 3Q8EA 1VZ8A 2CJNA 3PHWB 4XYCA 5C23A 5D7GA 1ROEA 3JVZX 4G11A 1BT0A 4XDCA 1BUIC 5JH5C 2MLBA 1PQSA 3LJ3A 3ZJVA 4AOFA 2M0AA 2JVCA 4PK1A 4YT0B 3M62B 1C76A 4KZCA 3W1SC 4HRSA 4KGRA 3TUOA 1LFDA 1I7HA 2FE8A 2LXCA 1PGAA 3CIRB 1F2RC 4TUUA 2WU5B 2KWUB 4BKGA 4MEMA 4MT5A 1GAQB 3QCAA 1L0YB 1D5MC 1PDXA 4TMAB 5DPTA 5D94A 1RLFA 1KOTA 3TSSA 4B0MA 1FNWA 1V5TA 1QILA 2ZCCA 3WAMA 3SDLC 1NBFC 1V1PA 1M4VA 1OGWA 2JSVX 3ABVB 2N9XA 2L7RA 1PFDA 1MG8A 2KDFB 2OJRA 3AMZA 1ZE3D 3AE7B 2Q5WD 4RGMA 5J18A 2G9HD 2LGXA 1I4HA 2LJIA 1G6JA 3Q8BA 5J17A 3WAPA 4MGKE 2BKRB 2E6XA 4EZLA 4IWOA 1WYGA 4HROA 4RGOS 1K50A 2JWUA 3IFWB 4W9FA 1QT9A 3DWMA 1E8ZA 3URYA 4JE3B 2HJ8A 1R4MI 2GI9A 5DPRA 3IXSA 2A5UA 2LUMA 3D32A 1VZ6A 1MI0A 1WZ3A 2BYEA 2BQQA 4BOSC 4IM3A 3VRAB 3J9CA 1TZOA 2MP2A 3KYCD 4MH0E 1IBXB 2FUG1 4UDUC 2WXMA 2LGYA 2ZJDA 2YLMA 5GMVA 2IDYA 4MSMB 2V0GA 1KH0A 4HKQA 2CR5A 2WDVB 3T3OA 1HE8A 1F9JA 4NZLB 3VUWA 4MDKE 2ZPYA 4IOIE 4KIKB 2CHZA 3VH3B 5CHFA 3GS2A 4M00A 1C9FA 1LGRA 2KC2A 1UBIA 1P7FA 3WCQA 2KACA 4WWPA 3TEWA 2N4FA 1YN4A 2RD0A 1F77A 4FJYA 3DCGA 1OFFA 3EFCA 2JYEA 3Q14C 1WGHA 1JQ4A 1V6EA 2NPTB 3P4SB 2GRIA 2K22A 1AARA 2DYBA 1I4QA 2BBCA 3L08A 1EUVB 1VR9A 1YJIA 3I63C 5LXIB 5CHVC 3R3MA 1R4MB 2I2YA 1V49A 1NVID 2ZCBA 4N58A 1AN8A 2IY1B 2MBQA 1R7SA 1Q0WB 1RRBA 3W5VB 3QARA 3C8YA 3WIMA 2C7NB 3L13A 2L00B 2LRWA 2LGIA 2UYZB 3HRDD 2TSSA 4DDID 3RN9C 1JMLA 4MSQB 4HWIB 2NMQA 4FULA 3PV1A 4GN1A 1ACCA 1HEZE 2FCNA 1WZ0A 1TS3A 4C7ZA 4RMAA 2MCNB 3A9JA 3N9YC 2XBBC 4ZRJA 1XQQA 2JRIB 2O6VA 3VVWB 2AL6A 1U4AA 3PHXB 3Q8AA 2KD0A 2KVZA 5EDSA 3NZSA 3NUHB 4ITKA 4ACFA 2ZVNA 2WHIA 3MTNB 1OQRA 1SXTA 3BVGA 2DX5B 4HDOA 4DHZB 2CU1A 4QAYA 2QCZA 1DYQA 1SE9A 2BS2B 3NZ3A 1R4NI 4MJSA 4ARCA 2W3RA 2L8JA 1WR1A 4RF1A 2I38A 3PZ7A 3CF4A 3U7DA 3TJPA 2ON8A 2J7QB 2L52A 1CQVA 4EZJA 3BINA 4I6PA 2BKFA 2JWZA 4IWQA 2PEAA 1TYGB 2CKHB 3KUDB 1IGDA 1IGCA 1A70A 3RNCC 3AB5A 1LQBA 4WJOA 1GC6A 4YTPB 3LXFA 1B1ZA 1ISNA 2KMMA 4KKIA 4OHJA 2KJ6A 2YEPB 2PE6B 1WXQA 5DCNA 1WXSA 1I42A 4HVBA 2HE7A 4BFRA 1NI2A 3V3XA 3AE9B 3RMKC 1FO4A 2G3QB 2IO2B 3KWVA 1WGYA 2G1EA 3U4EG 3ZDTA 3P4PB 1T0YA 4LNFA 2LGDA 4MELA 1OEYJ 1UUPA 2LHEA 2LD9A 1I35A 1TKYA 3H7PA 2NBVB 3U30A 2AYOB 2INNE 2C60A 4LCDE 3I5JC 2BW2A 2I1KA 2ZNVC 1IP9A 4ICVA 3C19A 5G2NA 3RULA 2WLBA 3HUIA 3ZRCA 3UQAA 1C77A 2ACZB 3MJ5A 3AEBB 1YX6B 3RNEC 4DWFA 4AS1A 2RDBC 2ZNVB 3PRMB 2RDHA 4C7YA 3MC8A 2KFJA 4GIVA 2W3SA 1HTQA 4GXBA 2PIAA 2WXFA 1SIJA 4E74A 4HEA1 2M1MA 1PGXA 2CHXA 1TIFA 1SB3C 4ZDVA 2W82A 2GBMA 3QQ8B 1BMLC 2BYVE 1UD7A 1V97A 5FKAC 2LVPA 2ZVOA 1GT8A 2D3AA 4WWNA 4FBJB 3ZVVA 2INCC 3BYTB 3IVFA 4M0WB 1J0GA 3RZFA 2GOWA 1WF9A 3V6CB 4JL9A 1WRIA 1WWTA 3HK0A 2WXNA 5D3IB 2ASQA 2EMSA 4K1RB 2OEDA 5G55A 4M8NA 3HVZA 1FRRA 2ONQA 2R61A 2XK5B 4EFOA 3X23A 2SAKA 1DOYA 2LVQA 4NPNA 3CWIA 1E0ZA 1QF6A 4R3DA 1WSPA 3TEZA 5BO4B 1I4GA 2RR9A 1I4PA 4ZRQA 2WDRB 1MG4A 3SD5A 3DBHI 1JROA 3APCA 3ZRFA 1C4AA 3A9KA 2WYQA 4K81A 1E5WA 4MM3B 2BYTA 2M0XA 3MHZA 3AH7A 1PUTA 2Y5PA 1JRPA 3IBEA 1FD6A 3LB8C 1WGKA 1EWYC 2MHJA 3EHVA 5JZEB 1L7YA 3DBRB 4CQNA 2K8BA 3AECB 4W9EA 5AEKB 1HZ6A 1S3SG 1ET6A 1EU4A 3P4RB 4WQMA 2KOXA 3BIID 5AUIA 1YQ3B 3A1QA 2BS3B 4PYUA 1GTHA 3RFZB 1VJKA 1ZDVA 1FNUA 3UF8A 1SJHD 5D2MB 1ENFA 4MACA 3NRZA 4NQKE 4GDKB 2REXA 2HDEA 4LDTD 4DBGA 1D6EC 3B2GA 5E6JA 2L1AA 4C80A 1XF5L 2L05A 2DWQA 1J19A 3BVMA 1SBBB 2R2QA 2VH1A 3AM9A 2FAZA 4MGZE 2NBWB 4OW0A 2KAJA 2NTSA 1A5RA 1N5XA 2W55A 2KFKA 1KJTA 3ZNGC 2WDQB 5G5GA 3VTUA 4IW0A 3BVZA 1MFWA 1F2RI 2MJDA 2ICIA 4XE0A 1J7BA 1NEKB 3RCZA 1NDDA 1L6VA 4PS8A 2DZKA 1KLGD 4HCNB 2MBOA 1JWBD 1WJNA 1NYRA 5H8YE 1STEA 3ZGZA 4FXCA 3IHPC 3PLUA 3Q3OC 2MEKA 2DHZA 2RMMA 2Z0DB 3UI3A 1WRDB 2J0MA 3L4PA 1SEBD 2K25A 1WFYA 2PJHA 2KDIA 4FHKA 3NVVA 3NS1A 2AWTA 3FILA 3SR6A 3ZYYX 2KTRB 1QOAA 2QEJC 3PVLA 1S1QB 3GB1A 1WMHA 4GDLB 2B76B 2FNJB 2J42A 1UH6A 3BY4B 4E71A 1GUAB 2I1JA 4A3PA 2JY6A 2GLSA 1L4ZB 3ZTDA 3TBLD 5C2TB 3TL5A 2WXRA 1WGGA 1JWMD 5H92C 4X57B 4A3OA 3H8HA 3IG3A 2KWDA 2M8SA 3I3TB 4ANWA 1E6EB 5IA7A 3RYTA 2V9HA 5LXHA 3AI5A 3DHIC 3ZTCA 4L2YA 3PS6A 3VUYA 4L23A 1I4RA 2PPHA 2W54A 3E56A 4OZCA 3P1MA 4AUQC 2DENB 4IWPA 3M95A 4RM9A 2L83A 2D10A 2M56B 3QJZA 2EKIA 1SGHA 3HIZA 2WXLA 4BKTA 2L0FA 3JSVB 2KTFA 3C0RB 3KW5B 2MBHA 4IM2A 3AV8A 2H88B 5BMGA 1E9MA 2KXJA 4FJZA 1WGRA 4ARIA 1SE3A 3A33B 4M8MA 2AQ3B 4P7IA 2LWPA 4OVUA 5HI1A 1Z2MA 2OOBB 3PTFC 4WJQA 1GTEA 3Q6BA 2AX5A 2KKCA 4OVVA 3MFGA 3AE8B 1XO3A 2KHWB 1ZXIA 3U52E 1QOGA 4IDIA 5KHQA 4HXDA 4LNIA 1V5OA 2NVUI 4BBNF 4EOYA 4GLSC 3ZKJC 1FFUA 4P6VF 4AQ7A 2MBBB 1TGZB 3BYYB 2BB6A 1HTOA 4KDLB 1ZUD2 3EA6A 1P1AA 1GNUA 1N60A 1YNTE 2D07B 4KSLC 5AUKA 4P1BC 1WM2A 1TY0A 3R66C 3ONSA 1FM0D 3B9JA 2L3ZA 3K9PB 3FC4A 4AJWA 1WXAA 3DDCB 3ZDMC 1ZW7A 1B9RA 2QIEB 1K8RB 4PT5A 1KRHA 1KTKA 5AZHA 3CMMB 3RNGC 5I4DA 3ML9A 4GMVA 2KDEB 3SU8X 1QOFA 1KM7A 1E8XA 1GOZA 4W9JA 2LXAA 2INPE 4F7ZA 2LJ5A 1F0ZA 1E7UA 1XLQA 2NS5A 3CF6E 1QKZA 2H89B 1YD8U 2K8CA 3PREA 1EO6A 3RNBC 2KN4A 3V05A 2BVCA 2C7HA 2N7DA 1WX7A 2EKEC 1L0VB 4N59A 3Q3FA 3P63A 2V4LA 3VR9B 3V6EB 1CK1A 2PVGC 2KT7A 5BYRA 4NAWA 1FRDA 4MGYE 4TQ1A 3MP9A 3R7RA 2VZKB 4ZHOA 1TKEA 4P16A 2CU3A 1FXTB 4ICUA 4LNOA 4N9F4 4XGAB 4B9KA 4PS3A 3JYUA 4P1CC 4KV2A 2RPQA 3NOBA 4ASWC 2BS4B 3UIPB 3RNAC 3VQIA 4XWTA 3AU4A 3PPAA 3FKYA 1V1PB 3L16A 3L54A 4RCOA 1XCTL 3R8BA 2L76A 2N1VA 4EZKA 4EE2A 4GSWA 4KVGB 3ETRA 4G50A 2D5GA 3BZDB 2BGFA 4BKSD 5E6PA 1AWDA 3MC9A 5KHOA 1F52A 2JQRB 2FCQA 5BMIA 4KKJA 2JX5A 2BPSA 2MWSB 3I9V1 3R2IA 3DQVA 4FADA 2L0TA 1L5PA 2WXOA 3Q69A 3VH4B 3OAWA 4K7SA 2DAFA 3GP7A 2LGSA 5AZFA 4MGIE 3MHSD 2KZRA 5G5HA 2GBRA 3NY5A 1J7CA 4WWMA 2K6QA 3GOEA 2XNAC 2QDFA 1OQYA 3OJ4B 2G45B 2PE9A 3PRZA 1WJUA 2FCMA 3KWLA 3DBSA 2KMCA 1YJ1A 3GZNI 2MP2B 2Y5CA 4US9A 1JWSD 2X8XX 2UU7A 2NBUA 1F1HA 4F1SA 3B1LX 4WJPA 5J2RA 1C3TA 2IGGA 4B6WA 4DXGA 3S2AA 2O2VA 4FA6A 1JRUA 4FN2A 2B3AA 2PKOA 3NHEB 3R2TA 3NJTA 4K3BA 2DAJA 3VUXA 1DOXA 4HPPA 1T0QC 2AQ1B 1FXAA 2NCNA 2LRUA 4LNNA 2DNFA 2KX0A 4W9GA 1TTNA 2KK8A 2LI5A 2AEHA 1UGJA 2C9WB 3JW0X 1N6ZA 3P4QB 3ZO5B 3DOWA 4OZAA 2KQ4X 2MJEA 1UWXA 2J4XA 2WXPA 1OTRB 2MA9B 3N32A 4C4VA 1WXVA 3PSEB 4ZRIA 4DXAB 3SEBA 2UWQA 1HZ5A 2K6DB 1WR6E 3NVYA 4PS7A 2PW9A 1IYFA 4A55A 5E6OA 3DBRI 3V62A 3GZNB 2N7JA 3NZUA 1FCCC 1WI0A 3H1UA 1IUEA 2JF5A 1SE2A 1VLBA 2WXIA 2K9XA 1V8CA 3VDZA 3UINB 1GJZA 4NNJB 1PGBA 3IAM1 1E7PB 4CHKA 2OHFA 2KQ7A 4C56C 3A9JB 4EUTA 1J8CA 4EEWA 2LZ6A 2O6VB 1OQQA 2NTTA 1C4PA 1XXGA 1FCLA 4WAAA 5EE1A 4TV3A 3NG0A 3APFA 4CO7A 3SFEB 3P2BA 3OLMD 1UWMA 1UF0A 1H4RA 3ML8A 5LNK1 4URKA 2WDTB 3W1SA 3DVNV 1I4XA 1C4CA 2JRHA 1K51A 3W9CB 4W9IA 4YL8A 1WE7A 1M94A 1ZGUB 4GGQA 2KWCA 4NAMA 2M17A 4ANVA 4MJSB 1ZP0B 2JUOA 2BT6A 4BBNC 4J6IA 4ZRPA 2LASA 3DBLB 1UGMA 4TSSA 2WXKA 3DVNU 4K7UA 2CS4A 3UQBA 2KO3A 4AP4C 3QK0A 4ANUA 2NR2A 4FHJA 4LK0M 4K7WA 4CYEA 2KMAA 3AEEB 1YJJA 2MH7A 4REZA 2WXGA 4NJ7A 4G3XB 4A6QA 4WQOB 2AQ2B 1HA5A 2Y3AA 3QAQA 1T3QA 1E7VA 2KJRA 2HJ1A 4KDIC 4RGTA 4EKUA 1TS5A 2BF8B 2JZPA 2N1WA 1J7AA 1WE6A 4GB9A 4WJNA 1EF1A 4ZHPA 1EWCA 4JLCA 3DWGC 4LJOB 1MVKA 3GE8C 2BB5A 3Q3JA 1RAXA 4Q2JA 1JCKB 2VH2A 2WQYB 3H7SA 2JXTA 3H7PB 4NJ6A 2Z0EB 4YTNB 2LUEA 3A4RA 4KZ0A 3LYYA 1LXDA 1V86A 1JWAD 2WNMA 5IO9A 1YIWA 2IO1B 4G0NB 4JWSC 2VRRB 1IBXA 1WXMA 2ZW0A 3EFUA 1KLUD 3PGEA 1TT5B 3CSFA 5EE0A 1QLBB 2D3CA 5D3DA 1SF0A 4AWJA 1E90A 1ET9A 4S0RA 3FAHA 3U2SC 3AEDB 1EM7A 2V3NA 2YEPF 3HM3A 5E6NA 1WX9A 2K39A 4JX1C 1GC7A 2JU6X 3PZ8A 3T9LA 2KVRA 3EC8A 2KANA 3ECIA 5EE9A 5JHAA 3U8ZA 2KQSA 4KIKA 2GBKA 1ZKHA 3AN1A 3QWZB 3OG5A 4AJYB 2KYWA 3RT3B 1ESFA 4KGTA 1VRAB 3TMPB 1GPXA 1V80A 3SHQA 1FMAD 1N5WA 2NPTA 1P3QU 2HTHA 2RPVA 4US8A 1Q10A 3LDZE 2IZVB 4S17A 4WWOA 3TEYA 2DZIA 3EUB2 4JWUC 3W5UB 2IGDA 4OVZA 1NI3A 1D4BA 3HM6X 3VTVA 3AEGB 4HPMB 3HHMA 1Y56A 3CSTA 3AE5B 3QX1A 2CJOA 4GU2A 3O65B 4IKGA 1CZPA 3R7QA 1YQBA 4I6LB 5EE3A 3ZNZB 1L2NA 3ZXVA 1MJDA 1HXYD 1T6BX 4YWGG 2GBNA 3L0WB 2HD5B 4XZ4A 2BWFA 4JPSA 1UELA 1Q5WB 3AXCA 5T8IA 3AULA 2D3GA 3A9KB 2JZ3B 3Q3MC 3N1YC 1GG3A 2MRPA 1KF6B 4RGNA 3X0WA 1E8WA 2SEBD 3AEFB 2EELA 5BYQA 5AZGA 3WALA 4BKSA 5IOIA 1V1OA 2DZMA 3VR8B 2C7MB 4HKZE 1FXIA 2X38A 3N1ZC 1XEEA 2Y5BB 1Q1OA 4WAFA 3HVDA 3RZWC 1DGJA 1Y8RC 4XDDA 3RD2A 3A1QB 5C3JB 5IAAC 4YSYB 2MJ3A 1MHHE 4NY0A 4LTUA 3PLVA 4LLGM 1EF5A 1TY2A 2LEKA 2JZZA 4D2KA 2C5LC 2JXXA 3ZNID 2JYTA 2M4NA 2G4SA 3KQ4A 2D11A 2FUHB 3BK1A 1WX8A 2Z8LA 4N6EB 2JPHA 1WJ6A 5IP4D 3N3KB 1KFYB 3DHGC 3ZJUA 1SJED 1WJ4A 3ALBA 3ZQ4A 2WU2B 2J53A 3VRBB 3OJ3A 2KFKB 1T0SC 3P42A 3KH0A 2LMCA 4B95A 2L32A 2KC1A 4BZAA 2ZZPB 5HFYA 1PYWD 1RWSA 3UGBB 5FR6A 4DQOC 1N63A 2DLBA 2KDMA 4W9LA 4WIPA 2V3PA 3ZNHB 4XX5A 1WM3A 3ZXRA 3MJWA 1CMXB 4HCPB 1GB4A 1FIQA 2K3UA 4YSZB 2V3SA 3AEAB 2MBEA 1XCQL 1TJEA 2XEWA 3K9OB 3V60A 1Z5SB 1QZEA 1ZPSA 4C00A 1CJEA 1YQ4B 1YOVB 4RNAA 2D2QA 3DHHC 3FILB 4W9HA 4A8XC 1UZXB 4L1BA 2PVOD 4PYZA 2QSDA 3TIXA 2WXJA 4IC7B 3ENEA 1RYJA 1NYQA 4GOCA 3ZJTA 1WMHB 4A9AA 2BTEA 4KX6B 2GB1A 2BWES 5CTRC 4KSKC 1FFVA 2QJLA 4RH6A 2GMIC 2KLCA 3Q2AC 4M0WA 2J0KA 3VHTC 1H8CA 4DK5A 5GXGB 1WY8A 4E3CA 2IO0B 5MPOA 2VZKD 2PTLA 2WX0A 5CX3A 3UIOB 3PT2B 5BMHA 4YSXB 5TSSA 2RSUA 2ZW1A 5FR3A 2IBIB 3ZIMA 4RFBA 3PZDA 2FCSA 3N20C 2XK5A 1YN5A 3O13A 4IG7B 1TKGA 1VCBA 4J3OD 3AU5A 1D3ZA 2QILA 4ZRKA 3KUCB 1QQRA 2ZEQA 4II3B 1L4DB 4DHZE 3WAOA 2R2OA 2ZPNA 4A90A 1XD3B 2XN9C 3ZUNA 3B08A 4BVUC 3DVGY 3VAWA 1TS4A 3APDA 3T3NA 1VD2A 1WH3A 4FJVB 4MM3A 1P7EA 2CHWA 1UBQA 2RDGA 1XLNA 1RFAA 3N1XC 4HPLB 2KLGA 2K1FA 2HTME 1TS2A 1IPGA 3AE3B 3PRPB 3GE3C 4XWWA 4IUMB 1XLPA 3KYDD 1QOBA 2OJWA 3SFDB 2D3BA 2DYMA 1V2YA 2WP9B 3TEXA 1HQRD 5JHBA 3T8MA 5C1ZA 1C1YB 4GDKA 3B0AA 2LVOA 1H7WA 1SE4A 2WXHA 3B2FA 1N62A 3AE2B 2RGFA 5BYSA 1K53A 3WA0A 3AE4B 4ZYSA 2MX2A 2N9LA 3H9DA 1YX5B 2KJHB 1XT9B 3QIJA 2IJ0A 4FLHA 2INDC 4LJPB 2K5PA 4JIOU 2V4IB 1R4NB 5IKCM 4YTMB 3E9SA 5TR5A 1P9DU 1T5XD 2FIDA 1JALA 2KDBA 5LLIA 1MHXA 3W2DA 2A4ZA 1ZXHA 3U7ZA 4OZBA 1L6UA 3KVFB 1RFKA 2IPKD 4RF0A 3DBLI 4O1NA 1JWUD 1WGDA 2PLPA 2DZJA 2AL3A 3M3JA 4K3CA 1FNVA 1TBEA 4W9CA 4NJCA 2IO3B 4I6NB 1LM8B 2K0PA 2KN5A 4H2AA 4NAWB 3Q8CA 1FEHA 2KWVB 1E10A 3QHTA 2BYFA 3RNFC 2WX1A 4DXFA 2QHOA 4II2B 3NVWA 3RUIB 1TZ1A 4LNKA 4F8CB 3Q3NC 2KTRA 2MSED 1SSNA 2Z59B 4NQLB 1X1MA 3NVZA 2MQJA 2LFIA 5L95C 1C78A 4GDLA 3IT6B 2QC8A 1V81A 2PMVA 4M02A 1JW9D 2DBYA 3VFKA 4USAA 5HHDG 1GB1A 3IAS1 1YN3A 2WWZA 4ZYNA 2O6VD 5IN7A 3A4SC 4HJKA 4HDQA 1EU3A 4ANXA 5DPSA 1UNSA 1MPEA 1BXTA 5D6JB 3ZLZA 2J52A 4YXDB 4W9KA 3W1YA 3QA8A 4KGSA 4IM0A 2N9KA 2K8HA 3V61A 5DPWA 3Q8FA 2WS3B 2N7EA 3DVGX 5L83A 3NS8A 4HK2A 2IGHA 3I57A 4HLEA 2GBJA 2WGSA 1FPYA 1RM6C 4WH4A 3OWEB 1D5XC 2LHDA 3M63B 2J0JA 3EECA 3AE6B 1N61A 1AW7A 2DYOA 3JSVA 4A20A 5CHWA 4JGHB 2QMTA 1L0XB 4RM8A 4JQWC 3PO0A 4LDTB 4HJGE 1XLOA 1C79A 4XC2A 2KNBA 4DHJB 1ZDXA 2FIFA 4W9DA 1E8YA 1LO5D 2JT4B 1H7XA 2EMTA 3BK2A 3RPFC 3QC8B 3N30A 1WYWB 1V9JA 1VDVA 3DPDA 3IT4B 1DOIA 4TQ0A 2O2VB 3TCAA 2WXQA 4TKNA 2M19A 5HKHA 4WURA 1VZ7A 4DHJD 5JXVA 3KUZA 4MH8A 1AYFA 1OEYA 3L10B 3KLSX 2KX3A 2N0SB 2IY0B 1SIFA 2IYDB 4DDGD 3L17A 2N9EB 3VTWA 1NENB 3DBHB 2FBWB 4BOZB 3RI7C 4M01A 3VXWA 1P98A 4BAXA 2V1YA 3EGRA 2MW5A 3H6NA 1ZOYB 5FK9C 2G4DB 3ZW3A 1D5ZC 1P0RA 4C4VB 3MC0B
chains in the Genus database with same CATH topology
3BK1A 1WRIA 2Z8LA 4N6EB 1WWTA 3BWUD 2WXNA 4ZOHC 5D3IB 4B0EA 1AWDA 1KFYB 3AE1B 3ZJUA 1SJED 2OEDA 5HG2A 2E3TA 3ZQ4A 2WU2B 2J53A 3VRBB 2JQRB 3HVZA 1YMHE 4KKJA 2JX5A 5BMIA 1FRRA 2ONQA 2R61A 3I9V1 3R2IA 1K52A 3Q8EA 1VZ8A 2CJNA 3P42A 1L5PA 2SAKA 5D7GA 2LMCA 1DOYA 2L32A 2WXOA 3Q69A 1ROEA 4XDCA 1BUIC 3CWIA 3GP7A 5HFYA 1E0ZA 1QF6A 4R3DA 1WSPA 3ZJVA 1PYWD 1RWSA 3TEZA 2M0AA 5G5HA 1I4GA 1J7CA 1I4PA 4WWMA 4DQOC 1N63A 4YT0B 2DLBA 4ZRQA 2XNAC 2WDRB 1C76A 2KDMA 1JROA 4WIPA 1C4AA 2V3PA 3KWLA 4MM3B 2BYTA 2Y5CA 4US9A 4HRSA 4KGRA 1JWSD 3MHZA 3AH7A 3TUOA 1FIQA 1GB4A 2K3UA 1I7HA 4YSZB 1PUTA 2FE8A 2Y5PA 3AEAB 1JRPA 1FD6A 1PGAA 1XCQL 1TJEA 2IGGA 3LB8C 1WGKA 1EWYC 3CIRB 1F2RC 4DXGA 2WU5B 1ZPSA 4CQNA 1CJEA 1YQ4B 3AECB 2PKOA 3R2TA 4MT5A 1GAQB 1L0YB 1D5MC 4RNAA 1HZ6A 1PDXA 4TMAB 3FILB 1DOXA 3TSSA 1ET6A 1EU4A 3P4RB 2PVOD 4L1BA 4A8XC 4WQMA 4B0MA 3BIID 2AQ1B 1FXAA 5AUIA 1YQ3B 2QSDA 2BS3B 1FNWA 1GTHA 3RFZB 1VJKA 1QILA 1ZDVA 1FNUA 2WXJA 1SJHD 1UGJA 1RYJA 1V1PA 1NYQA 1ENFA 3ZJTA 4A9AA 4MACA 3NRZA 2BTEA 4KX6B 1M4VA 4GDKB 2HDEA 2GB1A 2JSVX 3P4QB 1D6EC 3B2GA 3ABVB 5E6JA 1FFVA 2QJLA 4OZAA 1PFDA 4RH6A 2KQ4X 2L1AA 4C80A 1XF5L 2MJEA 1UWXA 2DWQA 2J4XA 4M0WA 2WXPA 3AMZA 1ZE3D 3AE7B 3BVMA 2Q5WD 1SBBB 4RGMA 2G9HD 1I4HA 5GXGB 2LJIA 3Q8BA 5MPOA 3SEBA 2VZKD 1HZ5A 2PTLA 3AM9A 3NVYA 2PW9A 4A55A 5BMHA 4YSXB 5TSSA 4OW0A 2E6XA 2KAJA 2N7JA 2NTSA 1WYGA 2ZW1A 5FR3A 1N5XA 4RFBA 4HROA 1FCCC 2W55A 4RGOS 1YN5A 1IUEA 1K50A 2JWUA 2WDQB 3O13A 5G5GA 1TKGA 1QT9A 1SE2A 1VLBA 4J3OD 3DWMA 3URYA 2WXIA 4JE3B 2QILA 3BVZA 1F2RI 2K9XA 1V8CA 2MJDA 2GI9A 1QQRA 2ICIA 1L4DB 4XE0A 3IXSA 1J7BA 1PGBA 3IAM1 1E7PB 1NEKB 2LUMA 1L6VA 1VZ6A 2OHFA 4A90A 1MI0A 2XN9C 1TS4A 1KLGD 4C56C 1JWBD 3VRAB 1NYRA 5H8YE 3T3NA 3J9CA 1TZOA 1STEA 3ZGZA 1OQQA 4FXCA 2NTTA 1P7EA 1IBXB 1C4PA 1XXGA 1FCLA 2FUG1 5EE1A 4UDUC 2RDGA 2MEKA 1XLNA 2RMMA 2WXMA 3UI3A 3SFEB 3L4PA 1UWMA 1SEBD 2HTME 1TS2A 2IDYA 5LNK1 2V0GA 3W1SA 1KH0A 1I4XA 3NS1A 1C4CA 3NVVA 4HKQA 1K51A 2WDVB 3AE3B 3W9CB 3T3OA 4NZLB 3FILA 3SR6A 4NAMA 3ZYYX 4IOIE 4XWWA 1XLPA 1QOBA 3SFDB 3GS2A 1C9FA 1ZP0B 1QOAA 2BT6A 2QEJC 2DYMA 1P7FA 3WCQA 2KACA 4ZRPA 2WP9B 3TEWA 3TEXA 1HQRD 3GB1A 1YN4A 1F77A 4GDLB 2B76B 1OFFA 2WXKA 2J42A 4TSSA 2JYEA 1JQ4A 3P4SB 2GRIA 2K22A 2BBCA 1I4QA 1L4ZB 1YJIA 1VR9A 1H7WA 1SE4A 2WXHA 3B2FA 1N62A 3AE2B 4LK0M 5C2TB 3AEEB 5BYSA 1YJJA 2MH7A 1K53A 3AE4B 4REZA 2WXGA 2WXRA 4ZYSA 1JWMD 5H92C 2N9LA 2I2YA 4A6QA 1NVID 2AQ2B 1HA5A 2Y3AA 3H8HA 1T3QA 2KWDA 4N58A 1AN8A 1E6EB 4RGTA 1R7SA 1TS5A 3W5VB 2JZPA 3C8YA 2IJ0A 1J7AA 4L2YA 2K5PA 2LGIA 4L23A 1I4RA 2W54A 2V4IB 2TSSA 3E56A 3HRDD 4OZCA 1EWCA 3P1MA 4ZHPA 4YTMB 3E9SA 3DWGC 1MVKA 1T5XD 2BB5A 2L83A 1JMLA 2M56B 2NMQA 4Q2JA 1JCKB 2EKIA 1JALA 2WQYB 3W2DA 1MHXA 2WXLA 1ZXHA 1ACCA 3U7ZA 2JXTA 1L6UA 4OZBA 1HEZE 1RFKA 2IPKD 4RF0A 1TS3A 4O1NA 4YTNB 4C7ZA 3AV8A 1JWUD 2H88B 3LYYA 5BMGA 1E9MA 2PLPA 3N9YC 1JWAD 2WNMA 4ARIA 1SE3A 3Q8AA 4JWSC 2AQ3B 1IBXA 1FNVA 2ZW0A 5HI1A 4NJCA 1KLUD 5EE0A 1QLBB 1GTEA 2K0PA 3NUHB 1SF0A 4H2AA 4ITKA 2AX5A 5D3DA 4NAWB 3Q8CA 3MFGA 3AE8B 1FEHA 1XO3A 1E10A 1ZXIA 1OQRA 1ET9A 1SXTA 3BVGA 3FAHA 3U52E 3U2SC 3AEDB 1QOGA 4DXFA 1EM7A 2V3NA 4IDIA 2YEPF 3NVWA 4JX1C 2JU6X 3PZ8A 1DYQA 5EE9A 1SSNA 2BS2B 4GLSC 3NZ3A 3AN1A 1FFUA 4ARCA 2W3RA 4P6VF 4AQ7A 4RF1A 2I38A 3BYYB 3PZ7A 2BB6A 3NVZA 3CF4A 2LFIA 1ESFA 1ZUD2 1VRAB 2ON8A 3EA6A 4KGTA 1GPXA 1C78A 2L52A 1CQVA 3IT6B 2PMVA 1JW9D 2DBYA 4USAA 1FMAD 1N60A 1YNTE 1N5WA 5HHDG 1GB1A 3IAS1 1YN3A 5AUKA 1TYGB 2RPVA 4US8A 1TY0A 1Q10A 1IGDA 1FM0D 1EU3A 1IGCA 3B9JA 3TEYA 1A70A 3EUB2 3FC4A 4JWUC 3AB5A 1UNSA 2IGDA 1NI3A 4OVZA 3W5UB 1MPEA 1BXTA 1B9RA 2QIEB 4PT5A 1D4BA 1KRHA 1KTKA 3AEGB 4YTPB 2J52A 4YXDB 3LXFA 1B1ZA 5I4DA 4KGSA 2KMMA 1Y56A 4KKIA 4OHJA 2N9KA 3AE5B 2YEPB 1QOFA 3Q8FA 1WXQA 2WS3B 1GOZA 2CJOA 2IGHA 2INPE 3V3XA 3I57A 3AE9B 4IKGA 1FO4A 3KWVA 1RM6C 1CZPA 2G1EA 1F0ZA 1XLQA 4WH4A 3U4EG 5EE3A 3P4PB 3OWEB 1D5XC 1QKZA 2LHDA 1HXYD 2H89B 1T6BX 1UUPA 4YWGG 2LHEA 3AE6B 1N61A 1TKYA 1AW7A 2DYOA 2KN4A 3V05A 2INNE 4JPSA 2QMTA 5T8IA 1L0XB 2BW2A 3PO0A 1L0VB 4N59A 4HJGE 3P63A 1XLOA 1C79A 2WLBA 1ZDXA 3HUIA 1KF6B 3VR9B 1LO5D 1H7XA 3BK2A 3RPFC 1C77A 2ACZB 3MJ5A 4RGNA 3AEBB 1CK1A 2PVGC 4AS1A 5BYRA 2SEBD 1VDVA 1FRDA 3IT4B 3AEFB 2EELA 3MP9A 1DOIA 4TQ1A 5BYQA 2VZKB 2RDHA 4TQ0A 4ZHOA 1TKEA 4P16A 1V1OA 4HKZE 3VR8B 2WXQA 4C7YA 1FXIA 2X38A 2M19A 1XEEA 2CU3A 2W3SA 4WURA 4WAFA 3HVDA 1VZ7A 1DGJA 4XDDA 2PIAA 2WXFA 1SIJA 5JXVA 4HEA1 4MH8A 1AYFA 5C3JB 1PGXA 3KLSX 2BS4B 1SB3C 3VQIA 4YSYB 2MJ3A 4XWTA 2N0SB 1MHHE 2W82A 4LTUA 1BMLC 1V1PB 4LLGM 1V97A 5FKAC 1NENB 1TY2A 4RCOA 1XCTL 3R8BA 2LEKA 2FBWB 1GT8A 4EE2A 4D2KA 3EGRA 2JYTA 3ETRA 1ZOYB 3BYTB 5FK9C 3KQ4A 1D5ZC 2D5GA 3BZDB 3MC0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H92 C;  1B9R A;  5MPO A;  2QIE B;  1WRI A;  4N6E B;  1WWT A;  1KRH A;  1NVI D;  3AEG B;  4YTP B;  1T3Q A;  3AM9 A;  4YXD B;  4ZOH C;  3LXF A;  1AWD A;  4N58 A;  1KFY B;  2KMM A;  1E6E B;  3NVY A;  3AE1 B;  3AE5 B;  1R7S A;  1QOF A;  3W5V B;  2E3T A;  1WXQ A;  2WS3 B;  4YSX B;  2WU2 B;  1J7A A;  3VRB B;  2JQR B;  3HVZ A;  2CJO A;  2JX5 A;  2KAJ A;  2K5P A;  1WYG A;  1FRR A;  1N5X A;  2W54 A;  3AE9 B;  2W55 A;  3HRD D;  4HRO A;  4ZHP A;  3P1M A;  1FO4 A;  4YTM B;  1IUE A;  2CJN A;  2WDQ B;  3DWG C;  1L5P A;  1RM6 C;  1CZP A;  1TKG A;  2G1E A;  5G5G A;  1QT9 A;  1XLQ A;  1VLB A;  1DOY A;  1F0Z A;  1ROE A;  2L83 A;  3DWM A;  5EE3 A;  3P4P B;  2M56 B;  2H89 B;  2EKI A;  1JAL A;  3CWI A;  2WQY B;  1E0Z A;  2K9X A;  1QF6 A;  1V8C A;  2MJD A;  3AE6 B;  1N61 A;  1RWS A;  1TKY A;  5G5H A;  1L6U A;  1J7B A;  1E7P B;  1NEK B;  1J7C A;  1RFK A;  4WWM A;  1N63 A;  4YT0 B;  1L6V A;  2WDR B;  2OHF A;  4YTN B;  4C7Z A;  3AV8 A;  2H88 B;  1JRO A;  1E9M A;  3PO0 A;  1L0V B;  1JWB D;  3KWL A;  4N59 A;  3VRA B;  1NYR A;  5H8Y E;  1JWA D;  3P63 A;  1XLO A;  2WLB A;  1OQQ A;  2Y5C A;  3AN1 A;  4FXC A;  4JWS C;  4US9 A;  4HRS A;  3HUI A;  1KF6 B;  3AH7 A;  3VR9 B;  1FIQ A;  5EE1 A;  1H7X A;  1I7H A;  4YSZ B;  2ACZ B;  1PUT A;  1XLN A;  3RPF C;  3AEA B;  1QLB B;  5EE0 A;  3AEB B;  2PVG C;  1GTE A;  1JRP A;  4ITK A;  1SF0 A;  2AX5 A;  1TJE A;  3LB8 C;  3SFE B;  1WGK A;  1EWY C;  3CIR B;  1FRD A;  1VDV A;  3AEF B;  3AE8 B;  1DOI A;  1UWM A;  1XO3 A;  2HTM E;  1ZXI A;  2WU5 B;  1OQR A;  3L4P A;  4ZHO A;  1TKE A;  3FAH A;  1E10 A;  3VR8 B;  1CJE A;  1YQ4 B;  3AED B;  3AEC B;  1FXI A;  1QOG A;  4C7Y A;  4IDI A;  2PKO A;  2M19 A;  1GAQ B;  3NVW A;  2CU3 A;  2W3S A;  3NS1 A;  3NVV A;  4JX1 C;  2WDV B;  3AE3 B;  1PDX A;  3W9C B;  1DGJ A;  3SR6 A;  1DOX A;  2PIA A;  3P4R B;  1SIJ A;  2PVO D;  5EE9 A;  4WQM A;  3BII D;  3ZYY X;  1FXA A;  1AYF A;  5AUI A;  1XLP A;  1YQ3 B;  2BS2 B;  5C3J B;  1QOB A;  2BS3 B;  3SFD B;  1GTH A;  1ZP0 B;  2BS4 B;  1FFU A;  1QOA A;  1SB3 C;  1VJK A;  4YSY B;  2BT6 A;  2MJ3 A;  2N0S B;  2W3R A;  4P6V F;  3WCQ A;  2WP9 B;  4LTU A;  1RYJ A;  3NVZ A;  1NYQ A;  3CF4 A;  1V97 A;  1NEN B;  1ZUD 2;  4A9A A;  1GPX A;  2LEK A;  2FBW B;  2B76 B;  4KX6 B;  1GT8 A;  1OFF A;  2L52 A;  3NRZ A;  1JW9 D;  2DBY A;  4USA A;  1FMA D;  1N60 A;  1JQ4 A;  1N5W A;  3P4S B;  3P4Q B;  2K22 A;  3ABV B;  3B2G A;  3ETR A;  5AUK A;  1ZOY B;  1FFV A;  1TYG B;  1PFD A;  2QJL A;  4US8 A;  1YJI A;  4C80 A;  1H7W A;  2MJE A;  3B2F A;  1N62 A;  3AE2 B;  2DWQ A;  1FM0 D;  5C2T B;  3B9J A;  3AMZ A;  3AEE B;  3AE7 B;  1YJJ A;  2MH7 A;  1A70 A;  2Q5W D;  3EUB 2;  3FC4 A;  3AE4 B;  3AB5 A;  4JWU C;  3W5U B;  1NI3 A;  5GXG B; 
#chains in the Genus database with same CATH topology
 3WAN A;  3BWU D;  4ZOH C;  2YVC A;  4B0E A;  3AE1 B;  1KLV A;  2W9N A;  5HG2 A;  1WIA A;  2E3T A;  1T0R C;  1YMH E;  2N9P C;  1K52 A;  3Q8E A;  1VZ8 A;  2CJN A;  3PHW B;  4XYC A;  5C23 A;  5D7G A;  1ROE A;  3JVZ X;  4G11 A;  1BT0 A;  4XDC A;  1BUI C;  5JH5 C;  2MLB A;  1PQS A;  3LJ3 A;  3ZJV A;  4AOF A;  2M0A A;  2JVC A;  4PK1 A;  4YT0 B;  3M62 B;  1C76 A;  4KZC A;  3W1S C;  4HRS A;  4KGR A;  3TUO A;  1LFD A;  1I7H A;  2FE8 A;  2LXC A;  1PGA A;  3CIR B;  1F2R C;  4TUU A;  2WU5 B;  2KWU B;  4BKG A;  4MEM A;  4MT5 A;  1GAQ B;  3QCA A;  1L0Y B;  1D5M C;  1PDX A;  4TMA B;  5DPT A;  5D94 A;  1RLF A;  1KOT A;  3TSS A;  4B0M A;  1FNW A;  1V5T A;  1QIL A;  2ZCC A;  3WAM A;  3SDL C;  1NBF C;  1V1P A;  1M4V A;  1OGW A;  2JSV X;  3ABV B;  2N9X A;  2L7R A;  1PFD A;  1MG8 A;  2KDF B;  2OJR A;  3AMZ A;  1ZE3 D;  3AE7 B;  2Q5W D;  4RGM A;  5J18 A;  2G9H D;  2LGX A;  1I4H A;  2LJI A;  1G6J A;  3Q8B A;  5J17 A;  3WAP A;  4MGK E;  2BKR B;  2E6X A;  4EZL A;  4IWO A;  1WYG A;  4HRO A;  4RGO S;  1K50 A;  2JWU A;  3IFW B;  4W9F A;  1QT9 A;  3DWM A;  1E8Z A;  3URY A;  4JE3 B;  2HJ8 A;  1R4M I;  2GI9 A;  5DPR A;  3IXS A;  2A5U A;  2LUM A;  3D32 A;  1VZ6 A;  1MI0 A;  1WZ3 A;  2BYE A;  2BQQ A;  4BOS C;  4IM3 A;  3VRA B;  3J9C A;  1TZO A;  2MP2 A;  3KYC D;  4MH0 E;  1IBX B;  2FUG 1;  4UDU C;  2WXM A;  2LGY A;  2ZJD A;  2YLM A;  5GMV A;  2IDY A;  4MSM B;  2V0G A;  1KH0 A;  4HKQ A;  2CR5 A;  2WDV B;  3T3O A;  1HE8 A;  1F9J A;  4NZL B;  3VUW A;  4MDK E;  2ZPY A;  4IOI E;  4KIK B;  2CHZ A;  3VH3 B;  5CHF A;  3GS2 A;  4M00 A;  1C9F A;  1LGR A;  2KC2 A;  1UBI A;  1P7F A;  3WCQ A;  2KAC A;  4WWP A;  3TEW A;  2N4F A;  1YN4 A;  2RD0 A;  1F77 A;  4FJY A;  3DCG A;  1OFF A;  3EFC A;  2JYE A;  3Q14 C;  1WGH A;  1JQ4 A;  1V6E A;  2NPT B;  3P4S B;  2GRI A;  2K22 A;  1AAR A;  2DYB A;  1I4Q A;  2BBC A;  3L08 A;  1EUV B;  1VR9 A;  1YJI A;  3I63 C;  5LXI B;  5CHV C;  3R3M A;  1R4M B;  2I2Y A;  1V49 A;  1NVI D;  2ZCB A;  4N58 A;  1AN8 A;  2IY1 B;  2MBQ A;  1R7S A;  1Q0W B;  1RRB A;  3W5V B;  3QAR A;  3C8Y A;  3WIM A;  2C7N B;  3L13 A;  2L00 B;  2LRW A;  2LGI A;  2UYZ B;  3HRD D;  2TSS A;  4DDI D;  3RN9 C;  1JML A;  4MSQ B;  4HWI B;  2NMQ A;  4FUL A;  3PV1 A;  4GN1 A;  1ACC A;  1HEZ E;  2FCN A;  1WZ0 A;  1TS3 A;  4C7Z A;  4RMA A;  2MCN B;  3A9J A;  3N9Y C;  2XBB C;  4ZRJ A;  1XQQ A;  2JRI B;  2O6V A;  3VVW B;  2AL6 A;  1U4A A;  3PHX B;  3Q8A A;  2KD0 A;  2KVZ A;  5EDS A;  3NZS A;  3NUH B;  4ITK A;  4ACF A;  2ZVN A;  2WHI A;  3MTN B;  1OQR A;  1SXT A;  3BVG A;  2DX5 B;  4HDO A;  4DHZ B;  2CU1 A;  4QAY A;  2QCZ A;  1DYQ A;  1SE9 A;  2BS2 B;  3NZ3 A;  1R4N I;  4MJS A;  4ARC A;  2W3R A;  2L8J A;  1WR1 A;  4RF1 A;  2I38 A;  3PZ7 A;  3CF4 A;  3U7D A;  3TJP A;  2ON8 A;  2J7Q B;  2L52 A;  1CQV A;  4EZJ A;  3BIN A;  4I6P A;  2BKF A;  2JWZ A;  4IWQ A;  2PEA A;  1TYG B;  2CKH B;  3KUD B;  1IGD A;  1IGC A;  1A70 A;  3RNC C;  3AB5 A;  1LQB A;  4WJO A;  1GC6 A;  4YTP B;  3LXF A;  1B1Z A;  1ISN A;  2KMM A;  4KKI A;  4OHJ A;  2KJ6 A;  2YEP B;  2PE6 B;  1WXQ A;  5DCN A;  1WXS A;  1I42 A;  4HVB A;  2HE7 A;  4BFR A;  1NI2 A;  3V3X A;  3AE9 B;  3RMK C;  1FO4 A;  2G3Q B;  2IO2 B;  3KWV A;  1WGY A;  2G1E A;  3U4E G;  3ZDT A;  3P4P B;  1T0Y A;  4LNF A;  2LGD A;  4MEL A;  1OEY J;  1UUP A;  2LHE A;  2LD9 A;  1I35 A;  1TKY A;  3H7P A;  2NBV B;  3U30 A;  2AYO B;  2INN E;  2C60 A;  4LCD E;  3I5J C;  2BW2 A;  2I1K A;  2ZNV C;  1IP9 A;  4ICV A;  3C19 A;  5G2N A;  3RUL A;  2WLB A;  3HUI A;  3ZRC A;  3UQA A;  1C77 A;  2ACZ B;  3MJ5 A;  3AEB B;  1YX6 B;  3RNE C;  4DWF A;  4AS1 A;  2RDB C;  2ZNV B;  3PRM B;  2RDH A;  4C7Y A;  3MC8 A;  2KFJ A;  4GIV A;  2W3S A;  1HTQ A;  4GXB A;  2PIA A;  2WXF A;  1SIJ A;  4E74 A;  4HEA 1;  2M1M A;  1PGX A;  2CHX A;  1TIF A;  1SB3 C;  4ZDV A;  2W82 A;  2GBM A;  3QQ8 B;  1BML C;  2BYV E;  1UD7 A;  1V97 A;  5FKA C;  2LVP A;  2ZVO A;  1GT8 A;  2D3A A;  4WWN A;  4FBJ B;  3ZVV A;  2INC C;  3BYT B;  3IVF A;  4M0W B;  1J0G A;  3RZF A;  2GOW A;  1WF9 A;  3V6C B;  4JL9 A;  1WRI A;  1WWT A;  3HK0 A;  2WXN A;  5D3I B;  2ASQ A;  2EMS A;  4K1R B;  2OED A;  5G55 A;  4M8N A;  3HVZ A;  1FRR A;  2ONQ A;  2R61 A;  2XK5 B;  4EFO A;  3X23 A;  2SAK A;  1DOY A;  2LVQ A;  4NPN A;  3CWI A;  1E0Z A;  1QF6 A;  4R3D A;  1WSP A;  3TEZ A;  5BO4 B;  1I4G A;  2RR9 A;  1I4P A;  4ZRQ A;  2WDR B;  1MG4 A;  3SD5 A;  3DBH I;  1JRO A;  3APC A;  3ZRF A;  1C4A A;  3A9K A;  2WYQ A;  4K81 A;  1E5W A;  4MM3 B;  2BYT A;  2M0X A;  3MHZ A;  3AH7 A;  1PUT A;  2Y5P A;  1JRP A;  3IBE A;  1FD6 A;  3LB8 C;  1WGK A;  1EWY C;  2MHJ A;  3EHV A;  5JZE B;  1L7Y A;  3DBR B;  4CQN A;  2K8B A;  3AEC B;  4W9E A;  5AEK B;  1HZ6 A;  1S3S G;  1ET6 A;  1EU4 A;  3P4R B;  4WQM A;  2KOX A;  3BII D;  5AUI A;  1YQ3 B;  3A1Q A;  2BS3 B;  4PYU A;  1GTH A;  3RFZ B;  1VJK A;  1ZDV A;  1FNU A;  3UF8 A;  1SJH D;  5D2M B;  1ENF A;  4MAC A;  3NRZ A;  4NQK E;  4GDK B;  2REX A;  2HDE A;  4LDT D;  4DBG A;  1D6E C;  3B2G A;  5E6J A;  2L1A A;  4C80 A;  1XF5 L;  2L05 A;  2DWQ A;  1J19 A;  3BVM A;  1SBB B;  2R2Q A;  2VH1 A;  3AM9 A;  2FAZ A;  4MGZ E;  2NBW B;  4OW0 A;  2KAJ A;  2NTS A;  1A5R A;  1N5X A;  2W55 A;  2KFK A;  1KJT A;  3ZNG C;  2WDQ B;  5G5G A;  3VTU A;  4IW0 A;  3BVZ A;  1MFW A;  1F2R I;  2MJD A;  2ICI A;  4XE0 A;  1J7B A;  1NEK B;  3RCZ A;  1NDD A;  1L6V A;  4PS8 A;  2DZK A;  1KLG D;  4HCN B;  2MBO A;  1JWB D;  1WJN A;  1NYR A;  5H8Y E;  1STE A;  3ZGZ A;  4FXC A;  3IHP C;  3PLU A;  3Q3O C;  2MEK A;  2DHZ A;  2RMM A;  2Z0D B;  3UI3 A;  1WRD B;  2J0M A;  3L4P A;  1SEB D;  2K25 A;  1WFY A;  2PJH A;  2KDI A;  4FHK A;  3NVV A;  3NS1 A;  2AWT A;  3FIL A;  3SR6 A;  3ZYY X;  2KTR B;  1QOA A;  2QEJ C;  3PVL A;  1S1Q B;  3GB1 A;  1WMH A;  4GDL B;  2B76 B;  2FNJ B;  2J42 A;  1UH6 A;  3BY4 B;  4E71 A;  1GUA B;  2I1J A;  4A3P A;  2JY6 A;  2GLS A;  1L4Z B;  3ZTD A;  3TBL D;  5C2T B;  3TL5 A;  2WXR A;  1WGG A;  1JWM D;  5H92 C;  4X57 B;  4A3O A;  3H8H A;  3IG3 A;  2KWD A;  2M8S A;  3I3T B;  4ANW A;  1E6E B;  5IA7 A;  3RYT A;  2V9H A;  5LXH A;  3AI5 A;  3DHI C;  3ZTC A;  4L2Y A;  3PS6 A;  3VUY A;  4L23 A;  1I4R A;  2PPH A;  2W54 A;  3E56 A;  4OZC A;  3P1M A;  4AUQ C;  2DEN B;  4IWP A;  3M95 A;  4RM9 A;  2L83 A;  2D10 A;  2M56 B;  3QJZ A;  2EKI A;  1SGH A;  3HIZ A;  2WXL A;  4BKT A;  2L0F A;  3JSV B;  2KTF A;  3C0R B;  3KW5 B;  2MBH A;  4IM2 A;  3AV8 A;  2H88 B;  5BMG A;  1E9M A;  2KXJ A;  4FJZ A;  1WGR A;  4ARI A;  1SE3 A;  3A33 B;  4M8M A;  2AQ3 B;  4P7I A;  2LWP A;  4OVU A;  5HI1 A;  1Z2M A;  2OOB B;  3PTF C;  4WJQ A;  1GTE A;  3Q6B A;  2AX5 A;  2KKC A;  4OVV A;  3MFG A;  3AE8 B;  1XO3 A;  2KHW B;  1ZXI A;  3U52 E;  1QOG A;  4IDI A;  5KHQ A;  4HXD A;  4LNI A;  1V5O A;  2NVU I;  4BBN F;  4EOY A;  4GLS C;  3ZKJ C;  1FFU A;  4P6V F;  4AQ7 A;  2MBB B;  1TGZ B;  3BYY B;  2BB6 A;  1HTO A;  4KDL B;  1ZUD 2;  3EA6 A;  1P1A A;  1GNU A;  1N60 A;  1YNT E;  2D07 B;  4KSL C;  5AUK A;  4P1B C;  1WM2 A;  1TY0 A;  3R66 C;  3ONS A;  1FM0 D;  3B9J A;  2L3Z A;  3K9P B;  3FC4 A;  4AJW A;  1WXA A;  3DDC B;  3ZDM C;  1ZW7 A;  1B9R A;  2QIE B;  1K8R B;  4PT5 A;  1KRH A;  1KTK A;  5AZH A;  3CMM B;  3RNG C;  5I4D A;  3ML9 A;  4GMV A;  2KDE B;  3SU8 X;  1QOF A;  1KM7 A;  1E8X A;  1GOZ A;  4W9J A;  2LXA A;  2INP E;  4F7Z A;  2LJ5 A;  1F0Z A;  1E7U A;  1XLQ A;  2NS5 A;  3CF6 E;  1QKZ A;  2H89 B;  1YD8 U;  2K8C A;  3PRE A;  1EO6 A;  3RNB C;  2KN4 A;  3V05 A;  2BVC A;  2C7H A;  2N7D A;  1WX7 A;  2EKE C;  1L0V B;  4N59 A;  3Q3F A;  3P63 A;  2V4L A;  3VR9 B;  3V6E B;  1CK1 A;  2PVG C;  2KT7 A;  5BYR A;  4NAW A;  1FRD A;  4MGY E;  4TQ1 A;  3MP9 A;  3R7R A;  2VZK B;  4ZHO A;  1TKE A;  4P16 A;  2CU3 A;  1FXT B;  4ICU A;  4LNO A;  4N9F 4;  4XGA B;  4B9K A;  4PS3 A;  3JYU A;  4P1C C;  4KV2 A;  2RPQ A;  3NOB A;  4ASW C;  2BS4 B;  3UIP B;  3RNA C;  3VQI A;  4XWT A;  3AU4 A;  3PPA A;  3FKY A;  1V1P B;  3L16 A;  3L54 A;  4RCO A;  1XCT L;  3R8B A;  2L76 A;  2N1V A;  4EZK A;  4EE2 A;  4GSW A;  4KVG B;  3ETR A;  4G50 A;  2D5G A;  3BZD B;  2BGF A;  4BKS D;  5E6P A;  1AWD A;  3MC9 A;  5KHO A;  1F52 A;  2JQR B;  2FCQ A;  5BMI A;  4KKJ A;  2JX5 A;  2BPS A;  2MWS B;  3I9V 1;  3R2I A;  3DQV A;  4FAD A;  2L0T A;  1L5P A;  2WXO A;  3Q69 A;  3VH4 B;  3OAW A;  4K7S A;  2DAF A;  3GP7 A;  2LGS A;  5AZF A;  4MGI E;  3MHS D;  2KZR A;  5G5H A;  2GBR A;  3NY5 A;  1J7C A;  4WWM A;  2K6Q A;  3GOE A;  2XNA C;  2QDF A;  1OQY A;  3OJ4 B;  2G45 B;  2PE9 A;  3PRZ A;  1WJU A;  2FCM A;  3KWL A;  3DBS A;  2KMC A;  1YJ1 A;  3GZN I;  2MP2 B;  2Y5C A;  4US9 A;  1JWS D;  2X8X X;  2UU7 A;  2NBU A;  1F1H A;  4F1S A;  3B1L X;  4WJP A;  5J2R A;  1C3T A;  2IGG A;  4B6W A;  4DXG A;  3S2A A;  2O2V A;  4FA6 A;  1JRU A;  4FN2 A;  2B3A A;  2PKO A;  3NHE B;  3R2T A;  3NJT A;  4K3B A;  2DAJ A;  3VUX A;  1DOX A;  4HPP A;  1T0Q C;  2AQ1 B;  1FXA A;  2NCN A;  2LRU A;  4LNN A;  2DNF A;  2KX0 A;  4W9G A;  1TTN A;  2KK8 A;  2LI5 A;  2AEH A;  1UGJ A;  2C9W B;  3JW0 X;  1N6Z A;  3P4Q B;  3ZO5 B;  3DOW A;  4OZA A;  2KQ4 X;  2MJE A;  1UWX A;  2J4X A;  2WXP A;  1OTR B;  2MA9 B;  3N32 A;  4C4V A;  1WXV A;  3PSE B;  4ZRI A;  4DXA B;  3SEB A;  2UWQ A;  1HZ5 A;  2K6D B;  1WR6 E;  3NVY A;  4PS7 A;  2PW9 A;  1IYF A;  4A55 A;  5E6O A;  3DBR I;  3V62 A;  3GZN B;  2N7J A;  3NZU A;  1FCC C;  1WI0 A;  3H1U A;  1IUE A;  2JF5 A;  1SE2 A;  1VLB A;  2WXI A;  2K9X A;  1V8C A;  3VDZ A;  3UIN B;  1GJZ A;  4NNJ B;  1PGB A;  3IAM 1;  1E7P B;  4CHK A;  2OHF A;  2KQ7 A;  4C56 C;  3A9J B;  4EUT A;  1J8C A;  4EEW A;  2LZ6 A;  2O6V B;  1OQQ A;  2NTT A;  1C4P A;  1XXG A;  1FCL A;  4WAA A;  5EE1 A;  4TV3 A;  3NG0 A;  3APF A;  4CO7 A;  3SFE B;  3P2B A;  3OLM D;  1UWM A;  1UF0 A;  1H4R A;  3ML8 A;  5LNK 1;  4URK A;  2WDT B;  3W1S A;  3DVN V;  1I4X A;  1C4C A;  2JRH A;  1K51 A;  3W9C B;  4W9I A;  4YL8 A;  1WE7 A;  1M94 A;  1ZGU B;  4GGQ A;  2KWC A;  4NAM A;  2M17 A;  4ANV A;  4MJS B;  1ZP0 B;  2JUO A;  2BT6 A;  4BBN C;  4J6I A;  4ZRP A;  2LAS A;  3DBL B;  1UGM A;  4TSS A;  2WXK A;  3DVN U;  4K7U A;  2CS4 A;  3UQB A;  2KO3 A;  4AP4 C;  3QK0 A;  4ANU A;  2NR2 A;  4FHJ A;  4LK0 M;  4K7W A;  4CYE A;  2KMA A;  3AEE B;  1YJJ A;  2MH7 A;  4REZ A;  2WXG A;  4NJ7 A;  4G3X B;  4A6Q A;  4WQO B;  2AQ2 B;  1HA5 A;  2Y3A A;  3QAQ A;  1T3Q A;  1E7V A;  2KJR A;  2HJ1 A;  4KDI C;  4RGT A;  4EKU A;  1TS5 A;  2BF8 B;  2JZP A;  2N1W A;  1J7A A;  1WE6 A;  4GB9 A;  4WJN A;  1EF1 A;  4ZHP A;  1EWC A;  4JLC A;  3DWG C;  4LJO B;  1MVK A;  3GE8 C;  2BB5 A;  3Q3J A;  1RAX A;  4Q2J A;  1JCK B;  2VH2 A;  2WQY B;  3H7S A;  2JXT A;  3H7P B;  4NJ6 A;  2Z0E B;  4YTN B;  2LUE A;  3A4R A;  4KZ0 A;  3LYY A;  1LXD A;  1V86 A;  1JWA D;  2WNM A;  5IO9 A;  1YIW A;  2IO1 B;  4G0N B;  4JWS C;  2VRR B;  1IBX A;  1WXM A;  2ZW0 A;  3EFU A;  1KLU D;  3PGE A;  1TT5 B;  3CSF A;  5EE0 A;  1QLB B;  2D3C A;  5D3D A;  1SF0 A;  4AWJ A;  1E90 A;  1ET9 A;  4S0R A;  3FAH A;  3U2S C;  3AED B;  1EM7 A;  2V3N A;  2YEP F;  3HM3 A;  5E6N A;  1WX9 A;  2K39 A;  4JX1 C;  1GC7 A;  2JU6 X;  3PZ8 A;  3T9L A;  2KVR A;  3EC8 A;  2KAN A;  3ECI A;  5EE9 A;  5JHA A;  3U8Z A;  2KQS A;  4KIK A;  2GBK A;  1ZKH A;  3AN1 A;  3QWZ B;  3OG5 A;  4AJY B;  2KYW A;  3RT3 B;  1ESF A;  4KGT A;  1VRA B;  3TMP B;  1GPX A;  1V80 A;  3SHQ A;  1FMA D;  1N5W A;  2NPT A;  1P3Q U;  2HTH A;  2RPV A;  4US8 A;  1Q10 A;  3LDZ E;  2IZV B;  4S17 A;  4WWO A;  3TEY A;  2DZI A;  3EUB 2;  4JWU C;  3W5U B;  2IGD A;  4OVZ A;  1NI3 A;  1D4B A;  3HM6 X;  3VTV A;  3AEG B;  4HPM B;  3HHM A;  1Y56 A;  3CST A;  3AE5 B;  3QX1 A;  2CJO A;  4GU2 A;  3O65 B;  4IKG A;  1CZP A;  3R7Q A;  1YQB A;  4I6L B;  5EE3 A;  3ZNZ B;  1L2N A;  3ZXV A;  1MJD A;  1HXY D;  1T6B X;  4YWG G;  2GBN A;  3L0W B;  2HD5 B;  4XZ4 A;  2BWF A;  4JPS A;  1UEL A;  1Q5W B;  3AXC A;  5T8I A;  3AUL A;  2D3G A;  3A9K B;  2JZ3 B;  3Q3M C;  3N1Y C;  1GG3 A;  2MRP A;  1KF6 B;  4RGN A;  3X0W A;  1E8W A;  2SEB D;  3AEF B;  2EEL A;  5BYQ A;  5AZG A;  3WAL A;  4BKS A;  5IOI A;  1V1O A;  2DZM A;  3VR8 B;  2C7M B;  4HKZ E;  1FXI A;  2X38 A;  3N1Z C;  1XEE A;  2Y5B B;  1Q1O A;  4WAF A;  3HVD A;  3RZW C;  1DGJ A;  1Y8R C;  4XDD A;  3RD2 A;  3A1Q B;  5C3J B;  5IAA C;  4YSY B;  2MJ3 A;  1MHH E;  4NY0 A;  4LTU A;  3PLV A;  4LLG M;  1EF5 A;  1TY2 A;  2LEK A;  2JZZ A;  4D2K A;  2C5L C;  2JXX A;  3ZNI D;  2JYT A;  2M4N A;  2G4S A;  3KQ4 A;  2D11 A;  2FUH B;  3BK1 A;  1WX8 A;  2Z8L A;  4N6E B;  2JPH A;  1WJ6 A;  5IP4 D;  3N3K B;  1KFY B;  3DHG C;  3ZJU A;  1SJE D;  1WJ4 A;  3ALB A;  3ZQ4 A;  2WU2 B;  2J53 A;  3VRB B;  3OJ3 A;  2KFK B;  1T0S C;  3P42 A;  3KH0 A;  2LMC A;  4B95 A;  2L32 A;  2KC1 A;  4BZA A;  2ZZP B;  5HFY A;  1PYW D;  1RWS A;  3UGB B;  5FR6 A;  4DQO C;  1N63 A;  2DLB A;  2KDM A;  4W9L A;  4WIP A;  2V3P A;  3ZNH B;  4XX5 A;  1WM3 A;  3ZXR A;  3MJW A;  1CMX B;  4HCP B;  1GB4 A;  1FIQ A;  2K3U A;  4YSZ B;  2V3S A;  3AEA B;  2MBE A;  1XCQ L;  1TJE A;  2XEW A;  3K9O B;  3V60 A;  1Z5S B;  1QZE A;  1ZPS A;  4C00 A;  1CJE A;  1YQ4 B;  1YOV B;  4RNA A;  2D2Q A;  3DHH C;  3FIL B;  4W9H A;  4A8X C;  1UZX B;  4L1B A;  2PVO D;  4PYZ A;  2QSD A;  3TIX A;  2WXJ A;  4IC7 B;  3ENE A;  1RYJ A;  1NYQ A;  4GOC A;  3ZJT A;  1WMH B;  4A9A A;  2BTE A;  4KX6 B;  2GB1 A;  2BWE S;  5CTR C;  4KSK C;  1FFV A;  2QJL A;  4RH6 A;  2GMI C;  2KLC A;  3Q2A C;  4M0W A;  2J0K A;  3VHT C;  1H8C A;  4DK5 A;  5GXG B;  1WY8 A;  4E3C A;  2IO0 B;  5MPO A;  2VZK D;  2PTL A;  2WX0 A;  5CX3 A;  3UIO B;  3PT2 B;  5BMH A;  4YSX B;  5TSS A;  2RSU A;  2ZW1 A;  5FR3 A;  2IBI B;  3ZIM A;  4RFB A;  3PZD A;  2FCS A;  3N20 C;  2XK5 A;  1YN5 A;  3O13 A;  4IG7 B;  1TKG A;  1VCB A;  4J3O D;  3AU5 A;  1D3Z A;  2QIL A;  4ZRK A;  3KUC B;  1QQR A;  2ZEQ A;  4II3 B;  1L4D B;  4DHZ E;  3WAO A;  2R2O A;  2ZPN A;  4A90 A;  1XD3 B;  2XN9 C;  3ZUN A;  3B08 A;  4BVU C;  3DVG Y;  3VAW A;  1TS4 A;  3APD A;  3T3N A;  1VD2 A;  1WH3 A;  4FJV B;  4MM3 A;  1P7E A;  2CHW A;  1UBQ A;  2RDG A;  1XLN A;  1RFA A;  3N1X C;  4HPL B;  2KLG A;  2K1F A;  2HTM E;  1TS2 A;  1IPG A;  3AE3 B;  3PRP B;  3GE3 C;  4XWW A;  4IUM B;  1XLP A;  3KYD D;  1QOB A;  2OJW A;  3SFD B;  2D3B A;  2DYM A;  1V2Y A;  2WP9 B;  3TEX A;  1HQR D;  5JHB A;  3T8M A;  5C1Z A;  1C1Y B;  4GDK A;  3B0A A;  2LVO A;  1H7W A;  1SE4 A;  2WXH A;  3B2F A;  1N62 A;  3AE2 B;  2RGF A;  5BYS A;  1K53 A;  3WA0 A;  3AE4 B;  4ZYS A;  2MX2 A;  2N9L A;  3H9D A;  1YX5 B;  2KJH B;  1XT9 B;  3QIJ A;  2IJ0 A;  4FLH A;  2IND C;  4LJP B;  2K5P A;  4JIO U;  2V4I B;  1R4N B;  5IKC M;  4YTM B;  3E9S A;  5TR5 A;  1P9D U;  1T5X D;  2FID A;  1JAL A;  2KDB A;  5LLI A;  1MHX A;  3W2D A;  2A4Z A;  1ZXH A;  3U7Z A;  4OZB A;  1L6U A;  3KVF B;  1RFK A;  2IPK D;  4RF0 A;  3DBL I;  4O1N A;  1JWU D;  1WGD A;  2PLP A;  2DZJ A;  2AL3 A;  3M3J A;  4K3C A;  1FNV A;  1TBE A;  4W9C A;  4NJC A;  2IO3 B;  4I6N B;  1LM8 B;  2K0P A;  2KN5 A;  4H2A A;  4NAW B;  3Q8C A;  1FEH A;  2KWV B;  1E10 A;  3QHT A;  2BYF A;  3RNF C;  2WX1 A;  4DXF A;  2QHO A;  4II2 B;  3NVW A;  3RUI B;  1TZ1 A;  4LNK A;  4F8C B;  3Q3N C;  2KTR A;  2MSE D;  1SSN A;  2Z59 B;  4NQL B;  1X1M A;  3NVZ A;  2MQJ A;  2LFI A;  5L95 C;  1C78 A;  4GDL A;  3IT6 B;  2QC8 A;  1V81 A;  2PMV A;  4M02 A;  1JW9 D;  2DBY A;  3VFK A;  4USA A;  5HHD G;  1GB1 A;  3IAS 1;  1YN3 A;  2WWZ A;  4ZYN A;  2O6V D;  5IN7 A;  3A4S C;  4HJK A;  4HDQ A;  1EU3 A;  4ANX A;  5DPS A;  1UNS A;  1MPE A;  1BXT A;  5D6J B;  3ZLZ A;  2J52 A;  4YXD B;  4W9K A;  3W1Y A;  3QA8 A;  4KGS A;  4IM0 A;  2N9K A;  2K8H A;  3V61 A;  5DPW A;  3Q8F A;  2WS3 B;  2N7E A;  3DVG X;  5L83 A;  3NS8 A;  4HK2 A;  2IGH A;  3I57 A;  4HLE A;  2GBJ A;  2WGS A;  1FPY A;  1RM6 C;  4WH4 A;  3OWE B;  1D5X C;  2LHD A;  3M63 B;  2J0J A;  3EEC A;  3AE6 B;  1N61 A;  1AW7 A;  2DYO A;  3JSV A;  4A20 A;  5CHW A;  4JGH B;  2QMT A;  1L0X B;  4RM8 A;  4JQW C;  3PO0 A;  4LDT B;  4HJG E;  1XLO A;  1C79 A;  4XC2 A;  2KNB A;  4DHJ B;  1ZDX A;  2FIF A;  4W9D A;  1E8Y A;  1LO5 D;  2JT4 B;  1H7X A;  2EMT A;  3BK2 A;  3RPF C;  3QC8 B;  3N30 A;  1WYW B;  1V9J A;  1VDV A;  3DPD A;  3IT4 B;  1DOI A;  4TQ0 A;  2O2V B;  3TCA A;  2WXQ A;  4TKN A;  2M19 A;  5HKH A;  4WUR A;  1VZ7 A;  4DHJ D;  5JXV A;  3KUZ A;  4MH8 A;  1AYF A;  1OEY A;  3L10 B;  3KLS X;  2KX3 A;  2N0S B;  2IY0 B;  1SIF A;  2IYD B;  4DDG D;  3L17 A;  2N9E B;  3VTW A;  1NEN B;  3DBH B;  2FBW B;  4BOZ B;  3RI7 C;  4M01 A;  3VXW A;  1P98 A;  4BAX A;  2V1Y A;  3EGR A;  2MW5 A;  3H6N A;  1ZOY B;  5FK9 C;  2G4D B;  3ZW3 A;  1D5Z C;  1P0R A;  4C4V B;  3MC0 B; 
#chains in the Genus database with same CATH homology
 3BK1 A;  1WRI A;  2Z8L A;  4N6E B;  1WWT A;  3BWU D;  2WXN A;  4ZOH C;  5D3I B;  4B0E A;  1AWD A;  1KFY B;  3AE1 B;  3ZJU A;  1SJE D;  2OED A;  5HG2 A;  2E3T A;  3ZQ4 A;  2WU2 B;  2J53 A;  3VRB B;  2JQR B;  3HVZ A;  1YMH E;  4KKJ A;  2JX5 A;  5BMI A;  1FRR A;  2ONQ A;  2R61 A;  3I9V 1;  3R2I A;  1K52 A;  3Q8E A;  1VZ8 A;  2CJN A;  3P42 A;  1L5P A;  2SAK A;  5D7G A;  2LMC A;  1DOY A;  2L32 A;  2WXO A;  3Q69 A;  1ROE A;  4XDC A;  1BUI C;  3CWI A;  3GP7 A;  5HFY A;  1E0Z A;  1QF6 A;  4R3D A;  1WSP A;  3ZJV A;  1PYW D;  1RWS A;  3TEZ A;  2M0A A;  5G5H A;  1I4G A;  1J7C A;  1I4P A;  4WWM A;  4DQO C;  1N63 A;  4YT0 B;  2DLB A;  4ZRQ A;  2XNA C;  2WDR B;  1C76 A;  2KDM A;  1JRO A;  4WIP A;  1C4A A;  2V3P A;  3KWL A;  4MM3 B;  2BYT A;  2Y5C A;  4US9 A;  4HRS A;  4KGR A;  1JWS D;  3MHZ A;  3AH7 A;  3TUO A;  1FIQ A;  1GB4 A;  2K3U A;  1I7H A;  4YSZ B;  1PUT A;  2FE8 A;  2Y5P A;  3AEA B;  1JRP A;  1FD6 A;  1PGA A;  1XCQ L;  1TJE A;  2IGG A;  3LB8 C;  1WGK A;  1EWY C;  3CIR B;  1F2R C;  4DXG A;  2WU5 B;  1ZPS A;  4CQN A;  1CJE A;  1YQ4 B;  3AEC B;  2PKO A;  3R2T A;  4MT5 A;  1GAQ B;  1L0Y B;  1D5M C;  4RNA A;  1HZ6 A;  1PDX A;  4TMA B;  3FIL B;  1DOX A;  3TSS A;  1ET6 A;  1EU4 A;  3P4R B;  2PVO D;  4L1B A;  4A8X C;  4WQM A;  4B0M A;  3BII D;  2AQ1 B;  1FXA A;  5AUI A;  1YQ3 B;  2QSD A;  2BS3 B;  1FNW A;  1GTH A;  3RFZ B;  1VJK A;  1QIL A;  1ZDV A;  1FNU A;  2WXJ A;  1SJH D;  1UGJ A;  1RYJ A;  1V1P A;  1NYQ A;  1ENF A;  3ZJT A;  4A9A A;  4MAC A;  3NRZ A;  2BTE A;  4KX6 B;  1M4V A;  4GDK B;  2HDE A;  2GB1 A;  2JSV X;  3P4Q B;  1D6E C;  3B2G A;  3ABV B;  5E6J A;  1FFV A;  2QJL A;  4OZA A;  1PFD A;  4RH6 A;  2KQ4 X;  2L1A A;  4C80 A;  1XF5 L;  2MJE A;  1UWX A;  2DWQ A;  2J4X A;  4M0W A;  2WXP A;  3AMZ A;  1ZE3 D;  3AE7 B;  3BVM A;  2Q5W D;  1SBB B;  4RGM A;  2G9H D;  1I4H A;  5GXG B;  2LJI A;  3Q8B A;  5MPO A;  3SEB A;  2VZK D;  1HZ5 A;  2PTL A;  3AM9 A;  3NVY A;  2PW9 A;  4A55 A;  5BMH A;  4YSX B;  5TSS A;  4OW0 A;  2E6X A;  2KAJ A;  2N7J A;  2NTS A;  1WYG A;  2ZW1 A;  5FR3 A;  1N5X A;  4RFB A;  4HRO A;  1FCC C;  2W55 A;  4RGO S;  1YN5 A;  1IUE A;  1K50 A;  2JWU A;  2WDQ B;  3O13 A;  5G5G A;  1TKG A;  1QT9 A;  1SE2 A;  1VLB A;  4J3O D;  3DWM A;  3URY A;  2WXI A;  4JE3 B;  2QIL A;  3BVZ A;  1F2R I;  2K9X A;  1V8C A;  2MJD A;  2GI9 A;  1QQR A;  2ICI A;  1L4D B;  4XE0 A;  3IXS A;  1J7B A;  1PGB A;  3IAM 1;  1E7P B;  1NEK B;  2LUM A;  1L6V A;  1VZ6 A;  2OHF A;  4A90 A;  1MI0 A;  2XN9 C;  1TS4 A;  1KLG D;  4C56 C;  1JWB D;  3VRA B;  1NYR A;  5H8Y E;  3T3N A;  3J9C A;  1TZO A;  1STE A;  3ZGZ A;  1OQQ A;  4FXC A;  2NTT A;  1P7E A;  1IBX B;  1C4P A;  1XXG A;  1FCL A;  2FUG 1;  5EE1 A;  4UDU C;  2RDG A;  2MEK A;  1XLN A;  2RMM A;  2WXM A;  3UI3 A;  3SFE B;  3L4P A;  1UWM A;  1SEB D;  2HTM E;  1TS2 A;  2IDY A;  5LNK 1;  2V0G A;  3W1S A;  1KH0 A;  1I4X A;  3NS1 A;  1C4C A;  3NVV A;  4HKQ A;  1K51 A;  2WDV B;  3AE3 B;  3W9C B;  3T3O A;  4NZL B;  3FIL A;  3SR6 A;  4NAM A;  3ZYY X;  4IOI E;  4XWW A;  1XLP A;  1QOB A;  3SFD B;  3GS2 A;  1C9F A;  1ZP0 B;  1QOA A;  2BT6 A;  2QEJ C;  2DYM A;  1P7F A;  3WCQ A;  2KAC A;  4ZRP A;  2WP9 B;  3TEW A;  3TEX A;  1HQR D;  3GB1 A;  1YN4 A;  1F77 A;  4GDL B;  2B76 B;  1OFF A;  2WXK A;  2J42 A;  4TSS A;  2JYE A;  1JQ4 A;  3P4S B;  2GRI A;  2K22 A;  2BBC A;  1I4Q A;  1L4Z B;  1YJI A;  1VR9 A;  1H7W A;  1SE4 A;  2WXH A;  3B2F A;  1N62 A;  3AE2 B;  4LK0 M;  5C2T B;  3AEE B;  5BYS A;  1YJJ A;  2MH7 A;  1K53 A;  3AE4 B;  4REZ A;  2WXG A;  2WXR A;  4ZYS A;  1JWM D;  5H92 C;  2N9L A;  2I2Y A;  4A6Q A;  1NVI D;  2AQ2 B;  1HA5 A;  2Y3A A;  3H8H A;  1T3Q A;  2KWD A;  4N58 A;  1AN8 A;  1E6E B;  4RGT A;  1R7S A;  1TS5 A;  3W5V B;  2JZP A;  3C8Y A;  2IJ0 A;  1J7A A;  4L2Y A;  2K5P A;  2LGI A;  4L23 A;  1I4R A;  2W54 A;  2V4I B;  2TSS A;  3E56 A;  3HRD D;  4OZC A;  1EWC A;  3P1M A;  4ZHP A;  4YTM B;  3E9S A;  3DWG C;  1MVK A;  1T5X D;  2BB5 A;  2L83 A;  1JML A;  2M56 B;  2NMQ A;  4Q2J A;  1JCK B;  2EKI A;  1JAL A;  2WQY B;  3W2D A;  1MHX A;  2WXL A;  1ZXH A;  1ACC A;  3U7Z A;  2JXT A;  1L6U A;  4OZB A;  1HEZ E;  1RFK A;  2IPK D;  4RF0 A;  1TS3 A;  4O1N A;  4YTN B;  4C7Z A;  3AV8 A;  1JWU D;  2H88 B;  3LYY A;  5BMG A;  1E9M A;  2PLP A;  3N9Y C;  1JWA D;  2WNM A;  4ARI A;  1SE3 A;  3Q8A A;  4JWS C;  2AQ3 B;  1IBX A;  1FNV A;  2ZW0 A;  5HI1 A;  4NJC A;  1KLU D;  5EE0 A;  1QLB B;  1GTE A;  2K0P A;  3NUH B;  1SF0 A;  4H2A A;  4ITK A;  2AX5 A;  5D3D A;  4NAW B;  3Q8C A;  3MFG A;  3AE8 B;  1FEH A;  1XO3 A;  1E10 A;  1ZXI A;  1OQR A;  1ET9 A;  1SXT A;  3BVG A;  3FAH A;  3U52 E;  3U2S C;  3AED B;  1QOG A;  4DXF A;  1EM7 A;  2V3N A;  4IDI A;  2YEP F;  3NVW A;  4JX1 C;  2JU6 X;  3PZ8 A;  1DYQ A;  5EE9 A;  1SSN A;  2BS2 B;  4GLS C;  3NZ3 A;  3AN1 A;  1FFU A;  4ARC A;  2W3R A;  4P6V F;  4AQ7 A;  4RF1 A;  2I38 A;  3BYY B;  3PZ7 A;  2BB6 A;  3NVZ A;  3CF4 A;  2LFI A;  1ESF A;  1ZUD 2;  1VRA B;  2ON8 A;  3EA6 A;  4KGT A;  1GPX A;  1C78 A;  2L52 A;  1CQV A;  3IT6 B;  2PMV A;  1JW9 D;  2DBY A;  4USA A;  1FMA D;  1N60 A;  1YNT E;  1N5W A;  5HHD G;  1GB1 A;  3IAS 1;  1YN3 A;  5AUK A;  1TYG B;  2RPV A;  4US8 A;  1TY0 A;  1Q10 A;  1IGD A;  1FM0 D;  1EU3 A;  1IGC A;  3B9J A;  3TEY A;  1A70 A;  3EUB 2;  3FC4 A;  4JWU C;  3AB5 A;  1UNS A;  2IGD A;  1NI3 A;  4OVZ A;  3W5U B;  1MPE A;  1BXT A;  1B9R A;  2QIE B;  4PT5 A;  1D4B A;  1KRH A;  1KTK A;  3AEG B;  4YTP B;  2J52 A;  4YXD B;  3LXF A;  1B1Z A;  5I4D A;  4KGS A;  2KMM A;  1Y56 A;  4KKI A;  4OHJ A;  2N9K A;  3AE5 B;  2YEP B;  1QOF A;  3Q8F A;  1WXQ A;  2WS3 B;  1GOZ A;  2CJO A;  2IGH A;  2INP E;  3V3X A;  3I57 A;  3AE9 B;  4IKG A;  1FO4 A;  3KWV A;  1RM6 C;  1CZP A;  2G1E A;  1F0Z A;  1XLQ A;  4WH4 A;  3U4E G;  5EE3 A;  3P4P B;  3OWE B;  1D5X C;  1QKZ A;  2LHD A;  1HXY D;  2H89 B;  1T6B X;  1UUP A;  4YWG G;  2LHE A;  3AE6 B;  1N61 A;  1TKY A;  1AW7 A;  2DYO A;  2KN4 A;  3V05 A;  2INN E;  4JPS A;  2QMT A;  5T8I A;  1L0X B;  2BW2 A;  3PO0 A;  1L0V B;  4N59 A;  4HJG E;  3P63 A;  1XLO A;  1C79 A;  2WLB A;  1ZDX A;  3HUI A;  1KF6 B;  3VR9 B;  1LO5 D;  1H7X A;  3BK2 A;  3RPF C;  1C77 A;  2ACZ B;  3MJ5 A;  4RGN A;  3AEB B;  1CK1 A;  2PVG C;  4AS1 A;  5BYR A;  2SEB D;  1VDV A;  1FRD A;  3IT4 B;  3AEF B;  2EEL A;  3MP9 A;  1DOI A;  4TQ1 A;  5BYQ A;  2VZK B;  2RDH A;  4TQ0 A;  4ZHO A;  1TKE A;  4P16 A;  1V1O A;  4HKZ E;  3VR8 B;  2WXQ A;  4C7Y A;  1FXI A;  2X38 A;  2M19 A;  1XEE A;  2CU3 A;  2W3S A;  4WUR A;  4WAF A;  3HVD A;  1VZ7 A;  1DGJ A;  4XDD A;  2PIA A;  2WXF A;  1SIJ A;  5JXV A;  4HEA 1;  4MH8 A;  1AYF A;  5C3J B;  1PGX A;  3KLS X;  2BS4 B;  1SB3 C;  3VQI A;  4YSY B;  2MJ3 A;  4XWT A;  2N0S B;  1MHH E;  2W82 A;  4LTU A;  1BML C;  1V1P B;  4LLG M;  1V97 A;  5FKA C;  1NEN B;  1TY2 A;  4RCO A;  1XCT L;  3R8B A;  2LEK A;  2FBW B;  1GT8 A;  4EE2 A;  4D2K A;  3EGR A;  2JYT A;  3ETR A;  1ZOY B;  3BYT B;  5FK9 C;  3KQ4 A;  1D5Z C;  2D5G A;  3BZD B;  3MC0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...