1KG1A

Nmr structure of the nip1 elicitor protein from rhynchosporium secalis
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
60
structure length
60
Chain Sequence
b'DRCRYTLCCDGALKAVSACLHESESCLVPGDCCRGKSRLTLCSYGEGGNGFQCPTGYRQC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Necrosis Inducing Protein 1
publication title Solution Structure of the Plant Disease Resistance-triggering Protein NIP1 from the Fungus Rhynchosporium secalis Shows a Novel beta-Sheet Fold.
pubmed doi rcsb
source organism Rhynchosporium secalis
molecule tags Toxin
total genus 4
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2001-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.460 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1kg1A02
1KG1A
chains in the Genus database with same CATH superfamily
1OV3A 3X26B 4ESRA 1KC8U 3NTHA 2E6ZA 3CCSQ 4C0DC 1W1FA 2JUFA 4RG8A 3CCLT 1PD1A 2WSCE 3CCRT 5I2MA 2YT6A 1K8AR 1QCNA 2L5QA 4DBHA 4Y92A 1W2BA 3MP1A 4C0FA 1Y96B 2K6DA 4JJNK 3H0IA 3QPHA 3GLXA 3EGDA 2KXDA 4N4IA 3M58A 1SPKA 4PJOA 5KYUA 3NHNA 5GANj 1D3BA 2JTMA 3UT1A 1BIBA 4IIMA 3V7CA 3TSWA 4RTTA 4CI0C 2OI3A 1M1KC 1YCSB 1KQ2A 3OYYA 7AT1B 3N5BB 4P5NA 2EYZA 4PK4A 3UPUA 1OI1A 1Y57A 1WXTA 3A5ZB 2IVWA 2EW3A 4HT9A 3C94A 2ABLA 5GJVB 4C5HA 5HK0A 2CZ7B 2EGCA 2WACA 5GMKe 4M77E 2O4XA 1AWXA 5KYNA 1YJNT 4KRTA 1PG5B 4Q5WA 5HCKA 3CD6A 2GGRA 3C4SA 3QXEB 5LJ3d 1KQ1A 1KQSA 1WNLA 1OEBA 1UGPB 2XG8D 4J83A 1VIFA 2YUOA 5CKFA 1DJ7B 3QO3A 4MDXA 1S72A 2RHXA 4IKFA 2OTJQ 1RLPC 2HQEA 3JCMV 1YN8A 2X3WD 4CRIA 3C12A 2QEXT 3ME9A 4M7DB 4MZPA 3REBB 2E70A 4C92G 3I35A 6AT1B 3NFCA 1G2BA 4M7AG 2K3BA 1O75A 4JZ3A 4C92F 2FVUA 3C0CA 3VS7A 5KYWB 4J9EA 4J5YA 1WXUA 2BUDA 5LJ3g 4OB3B 2AHJB 2J6KA 3S3MA 1K73R 1KD1R 3RBBB 4C5GA 2QA4T 3I55Q 1VQNT 4PJOD 4FW1A 1JRIA 3EHQA 2YUNA 2FPFA 1VQ6A 3QKJA 2JJ9A 4BI4A 2W0ZA 3CCET 1X6BA 2I0NA 1BCMA 2MPXC 2QXFA 2QQ9A 5CIUA 1JBMA 2EJGA 1VQLQ 2R57A 1N8RC 5FU6B 5GAN6 2KXCA 3CC4Q 4X1VA 1OQKA 1PSFA 1AWOA 4F7UB 3CMAQ 1IB8A 1QCOA 3JCMb 3MP8A 3NGPA 4FYWB 2VWFA 5I2SA 3ER0A 4WF2A 4M7AE 3TEEA 3GIBA 5KYYB 1E6HA 4L59A 3G6EQ 4C8QA 4DEYA 2QK0A 3M53A 3QBYA 3MHXA 4R56A 1G83A 1HJDA 3MP6A 2W10A 2GCXA 5GANh 3VV0A 4QKUA 1B7TA 2JW4A 2CUDA 2EPDA 2X4JA 5CCAA 1RAEB 1VQ8T 2FPEA 4ATOA 3D7SB 2DYIA 4FCYA 2ECZA 1D0YA 2DRKA 1O9SA 2O31A 3HKSA 3EHRA 2F1LA 3BDUA 1UJYA 3BFMA 3GP8A 3LGLA 4OMMA 2K79A 2QG9B 2M02A 2NUPB 2Y4XA 2E3IA 4F17A 1YI2Q 4M78B 1M1KR 3I9QA 1ZA2B 2KEAA 2EGEA 2EAYA 3PIOA 2OAWA 2CKKA 3E9GA 1QCFA 5KCOA 5IT9E 1I8FA 3HL8A 1I5LA 2O9SA 4V2SA 2JM8A 1OOTA 2RHZA 4KUIA 3REAB 1UGSB 1MUZA 2X51A 4AG1C 2DNUA 1U1TA 2ZCFB 3FC3A 4PJOC 1RI9A 4XQ3A 3HRTA 2BZ8A 2NUZA 2VV5A 3P8BB 1V29B 1JQQA 2M1HA 3DB4A 1U3OA 2KMTA 5CQXA 4OGCA 3EGXB 1VUBA 1WJSA 4M75B 1ZQ1A 2B8AA 1ZUKA 4C8QD 2HDAA 2QTVA 4M7DE 3CEYA 2MCNA 1SHFA 3V8LA 3CMEA 3G71Q 1Q86C 1IHWA 2ROLA 2FL7A 3VKIA 4KULA 3MEWA 4OVAA 1WZOA 1PRMC 3CCVA 5A2QE 1WI7A 2KRSA 2YXYA 1KHIA 1GCQA 5IXBA 4ANJA 5A0LA 4WTOB 2QEXQ 2PZ1A 3JSCA 5GMKl 5CKDA 2V1RA 4PLIA 2GF7A 1NPPA 3O8VA 3SEMA 3HSBA 4BD3A 4KUDK 2K2MA 3RMQA 1FWZA 5FRNA 4OGEA 1BYMA 4E7JA 2QA4Q 3VYHB 1VQNQ 4E7KA 2D0QB 4ELZC 4FYXB 2HNIA 2LMJA 2ATCB 3QJ6A 2PVGB 3CPWS 4ZNXA 4FT2A 2LQNA 3WXMB 4DOWA 3KXTA 2QTXA 1N8RR 4F7UE 5GMKi 4M78G 4PKCC 2KYBA 4C5EA 3OA6A 1K9MU 3CCMA 3QDFA 3CCJT 2HQXA 4LXCA 1VQPT 4L5GA 2CP3A 5GAOq 1UB4A 4BUGA 3LH0A 1VA7A 2JMAA 2MOXA 5FU7C 3PT9A 2P0KA 2Z0WA 3GOXA 2COYA 2ZGWA 3P8DA 2RA2A 3VS5A 1T0HA 1JU5C 2DM1A 4LDUA 1YIJT 2BE7D 2C06A 1AOJA 2DJQA 4JJDA 1BKBA 5C0MA 1NEBA 4N0AC 5CKBA 8AT1B 5KYXA 2LNHB 1RADB 2DL7A 4M75G 3CPWA 1QVGP 3RERA 3G1JA 2YSQA 3E1SA 3CBMA 3CQTA 3G4SQ 2OTLQ 2ROTA 1T3SA 1OX9A 1B3QA 2PU9B 2KVQG 2VB6A 2A3LA 4CC2A 4C8QC 4CC3A 4QQ6A 2A08A 3JCMJ 4M78E 4II1A 1WHMA 2KR3A 4UC4A 2RJFA 3CC2Q 2HBWA 5GANf 2ESWA 2CREA 3F70A 2VGMA 3OYEA 4JRKA 2JMCA 3HHTB 1VQ5A 2HQHA 2ZPIB 2CP2A 1G3SA 1UG1A 5GAMg 2RI2A 3H6ZA 4DBRA 3V7RA 4EMKA 5J3BA 2EKOA 2C0TA 3M0TA 4PFOA 3JCMP 3JB9F 3V7SA 3L2UA 3DLLA 4IIOA 2E64A 3V8KA 4M75E 3HPWA 3KBGA 1OU8A 3CCQA 2J05A 2A28A 2LT4A 2OTJT 1M9SA 1YWPA 3H41A 2EVRA 4DA4A 3QZ5B 4J7IA 4M4ZA 1Q86R 2FEIA 2RB6A 1RUWA 2KRMA 4LDYA 4JUVA 1N6AA 2CGHA 3OYKA 3RR6A 1ZUYA 1XTDA 4LD6A 4JLGA 2NLUA 1NLOC 1QVGS 4C0ZA 1QWEA 2RPNA 2LCCA 2D0NA 1GRIA 1I5OB 3CD6Q 2O01E 4EMHA 1VQ7A 2LC4A 1VQOT 1ZA1B 3A98A 4L6V5 2MMPA 1KSWA 1BIAA 1K73U 3HRSA 2GTOA 1KD1U 1WHKA 2B86A 3OB9A 2D6FA 2FRYA 4M7DC 2DA9A 3EG3A 1YNZA 3A8OB 2DMOA 4KGZB 3SWNA 2EQKA 4XU1A 5I11A 1GCQC 2HL5C 1SRMA 3VU3C 2GFAA 2YLBA 3ASKA 4BY6C 4AMCA 2MYSA 2KT8A 3CC4T 1PCXA 3DKMA 3OBYA 2ENMA 3CMAT 2RHUA 1RAAB 1YHQA 1EX4A 1ACMB 3CCUA 1K9MR 2EBPA 4RG2A 4BE2A 1M2VA 4ZTJA 2J6OA 2KDSA 4IUQA 3G6ET 2RQUA 2G6FX 1K1ZA 3L2VA 4PJOG 1KK7A 2DEUA 2HCKA 5FU6C 3QYGB 4HCBA 4BACA 2D8HA 4HA8A 4C92B 4JRPA 4KH1B 4PFPA 4PJOF 3C95A 2VC8A 5GAOr 1M4ZA 2LQWA 1WDXA 3E2UA 3FJPA 1TH7A 1M90C 3PIPA 1YIJQ 2VGNA 3JB9D 3EFRA 1M8VA 2QDYB 2HAXA 5KCHA 4ORZA 1F1BB 1VQKA 2E10A 3LH5A 4PL6A 1KC8C 2M16A 1YI2T 2AIRB 5IHIA 4OMPA 2LQKA 2E12A 1B34B 3J7AF 2X35A 4EMGA 5GAN3 1R0CB 3EG9A 3G7ZA 1M1KU 3X28B 2RI3A 1YFNA 2RF0A 4JS5A 4A4FA 2X9HA 4KGVB 2K3YA 2JM9A 5A0GA 3UDCA 2E1HA 1YCYA 1Q82R 1M5Q1 1OZ3A 4E7SA 1UUEA 3EG1A 2DYBA 2CZ0B 2A0FB 1Q81C 2VUBA 4MMKA 1YITA 4M77A 4PJJA 2EFIA 1U8RA 1I07A 2FHDA 2JTFA 1HXDA 2NWMA 4D8DA 2EIFA 4A4GA 4BDYA 4X9CA 5D7UA 2CUBA 4FT4A 3G71T 1QVFS 1TUDA 2FZCB 4XU3A 1NBEB 1ZSZB 2HSEB 1D0ZA 3PE0A 4F04B 4EMKC 4F16A 4OB1B 1BK2A 3OMCA 1YJ9A 4J9GA 1H3HA 2ED0A 4QT7A 3RKYA 1Y07A 2ZPBB 3UF4A 5FWCA 2JZ2A 1GBRA 3VS3A 1D09B 1I1JA 2DXUA 1TU0B 2DE0X 1UE9A 4Y28E 2DTIA 2J06A 3RKWA 2EKHA 2DVEA 1VQOQ 1W6XA 3I56T 4QQGA 1ZBJA 1QVFA 1WIEA 3CMEQ 1XQHA 5I22A 3JCMh 4C8QG 1QMCA 1S1NA 5J26A 1EFNA 2XD0A 2L3PA 4FSSA 4RTUA 2FZGB 4RTZA 4PJMA 3DLMA 4LNPA 4RTWA 3RNJA 1GBQA 3LLRA 5CKEA 4E6RA 1J3TA 1JXMA 1WHGA 4C8QF 2YLCA 4XTYA 1VYVA 2MWOA 3GBQA 2JTEA 1Q95G 3PTAA 2M51A 3EFOB 1R0BG 1N8RU 4JLIA 1D1CA 5IXFA 1V76A 4N0AA 1WLPB 3A8HB 3H9NA 1C6VX 1BB9A 4M77D 4LUEA 1PC0A 2P0PA 3SD4A 5GAN4 3A8MB 3TQ7P 1YJWT 4C92E 3SWNC 1LJOA 2KY9A 2LNVA 4BE1A 2AKLA 3TREA 2X3XD 2DIGA 1LCKA 1IHVA 1UJ0A 3CCSA 4ZGEB 2GNCA 3EAEA 4M7AA 1UHCA 2A7YA 1AWJA 1VYTA 1GXIE 3OS1A 1N9RA 5GANd 1WQ7A 1RAGB 4C0DB 3G4ST 3CC7A 4GLMA 2OTLT 5LJ5f 2BIVA 1M30A 2JNGA 3H0HA 1NJIC 2FB7A 1PRLC 3CCMQ 2E3HA 1IRXA 1Y96A 2KNBB 2LCSA 4JRIA 2GQIA 3CC2T 5EG2A 4AFUC 2JN0A 4J9IA 2GFUA 2GTJA 1MMNA 3UA6A 5CR2A 4E47A 5LL6S 4BB7A 3CXCP 4RCBA 2RJDA 2YHTA 3X25B 2OX7A 2H3JA 3VUZA 5GANg 1MV3A 3JB9I 1XNIA 5EC7A 1WYXA 1K9AA 2AKKA 3V8JA 2DD5A 2H8HA 4JZ4A 2RQRA 3M0RA 4ZTFA 1LNXA 4M7DF 4KBMB 3AT1B 3ZBDA 2L3QA 2XDPA 2DXTA 2F69A 3MPUB 1UEBA 1WXBA 1X43A 1PM3A 4NL2A 4OMQA 3BE3A 3PVLA 4XU2A 3UWNA 3M0UA 2HD0A 2QGGA 1KFZA 1M3CA 2QGFB 1WJRA 4A53A 2PVOB 1VIEA 4LD9K 5FWBA 4MMLA 2A37A 3DB3A 2BTTA 1M27C 2XDDA 2L3RA 3E19A 1RL2A 3SB2A 5D6YA 5GAN8 1Q86U 1SF9A 2L2PA 4M7DA 2OAUA 3M56A 2X4XA 2P84A 2A36A 4QVZA 3CD6T 1SKUB 4M77C 4EIKA 1GL5A 2AZSA 2FYKA 3RESA 5KYWA 3I55A 3BY7A 2DFUA 3EH1A 2KAFA 4QW2A 4GY5A 2NUTB 2EGAA 3LWHA 2WSFE 3M5AA 1S72T 3SFMA 1Y0MA 3JCMW 2VXFA 4F7UF 5A0DA 4QQDA 2LRQA 3GF5A 3MEUA 4CC7A 2P4TA 4RTVA 3OYBA 2RQVA 4J9FA 4J9CA 3M4GA 3CXCS 3UA7A 4XTVA 4A4HA 3OQ5A 1VQLA 1AD5A 2RHYA 3I56Q 4FU6A 2V26A 4A4EA 3OW2P 5DM7R 1OU9A 1VQMA 1YWOA 3LX7A 5GANe 4EPCA 4FL6A 2EYQA 1H8KA 2EQUA 4F7UA 3QYHB 1VQ9A 1AT1B 2K5FA 1PSEA 2EYXA 3JCMf 5GMKj 2DETA 1NYGA 4ZGJB 2LJ1A 3S3NA 2HMAA 1VQ4A 1VQ6T 2X4WA 2O9VA 4HT8A 1QKXA 1CSKA 1TWBA 5KYYA 2IIMA 1U06A 2KT1A 3WVDB 1YJWQ 3MCAB 2RN8A 2ZAEA 1WJQA 5FW9A 5IN1A 4FIBA 1AEYA 1MMDA 4M7DD 2CSQA 3CCLA 4C0GA 3FEOA 2KQWA 5LJ5j 1NJIR 5GMKm 4HVWA 3CCRA 3CBOA 4NOYA 1AZGB 2E5QA 4X34A 5HK3A 1CKBA 4M7AC 1I0CA 3PNWC 1MGQA 2PNIA 3JAME 3EG2A 4O5VA 5GAN7 2NUPA 4O6JA 3VRZA 3OMGA 3VUBA 4NL3A 1WA7A 4M78A 3KFVA 3ZL7C 1ZHIA 2CZ1B 3TVTA 1NZ9A 1K8AC 5IAYA 2V8JA 1JB0E 1JO8A 3FDRA 1W4SA 2RO0A 2VKNA 1NLPC 8ATCB 3OW2S 2XMFA 3JB9G 4DQ2A 1K0XA 3EGDB 2ZPGB 2MIOA 1YJNA 1X2KA 1Q82U 4PJOB 5KYUB 2RJCA 5GAOn 1D3BB 1LVKA 3OS5A 4OMNA 2MI6A 3LGFA 2EJ9A 2CH4W 2ZZDA 1X6OA 3CBPA 3FRNA 3QZ9B 4ZN3A 1ABOA 3I5RA 3EGXA 3EGUA 4OMOA 1PNJA 4M75A 2DTHA 4A54A 1JEGA 2OJ2A 2LTOA 4XU0A 4XTZA 1M1FA 1W2BP 2DL5A 1PKSA 2RJEA 4AFZC 2D8JA 4LDXA 2PTKA 3X24B 4JJCA 1OPKA 1UGQB 1K76A 2O4XB 2YWWA 2QEXA 2KROA 2CZ6B 4GLKA 5L23A 4Z02A 5L8RE 2HZYA 5DLQE 1NM7A 3KUFA 1SEMA 2LZ6B 1ZLMA 3PMIA 1GCPA 2QA4A 2DXBA 2E65A 5I21A 4IUVA 2BE9B 1AZEA 1Z9QA 3CMET 1SRLA 1M8MA 5CK9A 1VQNA 4PLLA 1QQJA 3PFSA 1BBZA 2K7AA 1S72Q 1SSFA 2D9TA 1SHGA 1MMAA 2DD4A 2HKQB 4XTXA 5GMKh 5LJ3j 1A0NB 3CCVT 3L2RA 1YJ9Q 2L0AA 2RQTA 4J6XA 3OS2A 3THKA 1M1GA 2IG0A 3OS0A 3CCEA 1KQSP 3S3OA 3VRYA 1QP2A 5GAN2 3VS1A 1KD1C 5GAOl 3H0FA 1YP5A 2E6NA 1RAFB 1IXDA 2CP7A 2I2LA 4JPBW 2DBKA 3JB9H 2EQIA 5GAOp 3ZEHA 2QQRA 1QVGA 2EWNA 2IPOB 1R8OB 4OF1A 1M3AA 3NTIA 3MKDA 1P92A 5LJ5d 1T0JA 3HFOA 3OYMA 5KE2A 2GQVA 1NEGA 5IH2A 2LCLA 1Q7YC 1D0XA 5LJ5h 4QVCA 1U1SA 4D6WA 4AFSC 4HVVA 3URGA 3H8ZA 5FU7B 2DIQA 1VQ6Q 1RAHB 2L8DA 5GAN5 2HSPA 1W2BS 1WHJA 2C0OA 1G3WA 3JCMX 2O2OA 4HKEA 1VYUA 4JJBA 2CP5A 3JV3A 3CCMT 1FMWA 2VXEA 2XICA 4X9DA 2YDLA 1VQ8A 2ZPFB 4LN2A 3J81E 4IUUA 3RKXA 3OYFA 2EYYA 2H3EB 2K2VA 1W70A 4M77G 4C8QB 1QKWA 4RKUE 3RDVA 3VS0A 1UHFA 4M77F 3JCMc 3X20B 4E7HA 5GAOm 1VOMA 5DY9A 2QASA 4HXJA 1RAIB 3HTRA 4ZN1A 4AT1B 3CC7Q 2D1XA 2DO3A 3M0SA 1QLYA 4AFQC 2DXCA 1SG5A 2SRCA 4PJLA 1KQSS 2DJZA 4PJOE 2LX9A 4F14A 4OMFB 2QQBA 4A4KA 2HEQA 3GPLA 4B9XA 3VJPA 3RIRA 2EQJA 4BE0A 2DBMA 3A1PA 2XDBA 4M78C 5GAMf 2R5MA 1UTIA 4LUDA 1Q81U 1NG2A 4VUBA 1VQ5T 3LWIA 3ULRB 1UGRB 3I5SA 3OBWA 2BKDN 4Y91A 3OYDA 1NYFA 1KG1A 4IUTA 3NTKA 2RK1A 5HKCA 1M3BA 1N9SA 2HBPA 1R77A 1TSFA 2QI2A 3VS2A 3LYIA 4DEXA 2Y4YA 2DZCA 4JS4A 3T9NA 2V8KA 1IGUA 4ELYC 5LJ3h 2FG0A 3CCQT 1H92A 2HL3A 1X27A 1OX8A 3OYGA 1WHLA 4M75C 3L42A 4RCCA 1OULA 4LDWA 3MJXA 1RACB 1HD3A 2LJ0A 2PQWA 4PNOA 1G3TA 2X4YA 4E7IA 5LJ5e 3MEAA 3M0QA 2K3XA 3JCMd 2VVKA 4A63B 1HSQA 1MNEA 4JDSA 3J80E 2LQ8A 4DBQA 2JOYA 3GNFB 2EYWA 4HCKA 4BY6B 4M7AF 2COWA 1H3ZA 1VQ7T 1X6GA 3CCVQ 2RD1A 1QP3A 4FW2A 2MWPA 3OYIA 5FRMA 1AHJB 1WQWA 4B6MA 2DZ9A 5AYFA 2BZYA 2QAZA 3QUIA 3CCJA 1VQPA 4PFZA 2CH4A 4J6YA 5FLXE 1TXQA 2KBTA 3LW5E 3AHUA 1WHHA 4DOVA 1Q7YR 4J8OA 3Q1JA 1BU1A 3JCMg 1JXOA 1IZ6A 4OB2B 3M4YA 1HK9A 1TUGB 4C92A 4D8KA 3JRZA 3HFNA 1OPLA 1YIJA 2NYSA 4KT0E 3VS6A 1BCOA 2C0IA 2JS0A 3QIIA 1YHQT 3CCUT 1VQMQ 2DL4A 1ZBXA 2RMOA 4MZMA 1Y7XA 2AK5A 1HYOA 1M90R 1VQ9Q 4XTUA 1NJIU 1LOJA 1V1CA 1ZX6A 4C8QE 2K57A 3OSSC 4E2FB 2RH2A 1VQ4Q 1G8XA 2QDLA 3QDRB 2PVDB 2L89A 1RI0A 2V8IA 4N4HA 4BDZA 1E6GA 2P0QA 2XI9A 3HRUA 2YRCA 1KC8R 2XIDA 1MNDA 2ZPHB 1B34A 2KE9A 2LX7A 1IREB 1QVPA 2J6FA 3OYLA 5KYXB 1WGSA 2DKGA 1AVZC 4J9BA 2MF2A 2XK0A 1EIFA 4RMOA 3CCLQ 1EZZB 1VQKT 1K0SA 2Y90A 3CCRQ 4M7DG 2RHIA 2EQMA 4HCZA 2CDTA 2XKOC 1TTHB 2F2XA 2CT4A 9ATCB 5LJ3e 4GBQA 1KJWA 4XK8E 4ME7A 1Q81R 2M9UA 4RUGA 5GAMj 2M0OA 4TVRA 3L2QA 3CPWP 2LT1A 4EDUA 4J6WA 2OTJA 2G3RA 3TSZA 1ZSZA 3OYNA 4C92D 2DF6A 1VQ5Q 5AT1B 3OYJA 4M7AD 1GFCA 2ED1A 1ARKA 3JCMe 4OB0B 2DLPA 3PVQA 4EMKB 1PHTA 3R6OA 4XTWA 4Z89A 3QHSA 4OMLA 1RLQC 1JJ2P 2DL3A 1YITT 1TG0A 4FM4B 1FMKA 2YRVA 2K5IA 1B07A 1E7OA 1YJNQ 2VYTA 5KH6A 4BI3A 1FXXA 5KE3A 2FZKB 3ZFJA 2XU8A 4F7UG 1VQOA 3HP9A 2AT1B 2CSIA 5HY6A 3CCQQ 4WCIA 4RTYA 4N4GA 3INZA 2CS7A 2KI7A 1YJ9T 1MV0B 4JRQA 1KHCA 4FYYB 5LJ3f 2R5AA 3R6NA 3JB9J 1I4K1 5IHNA 5D6XA 2DTOA 2E41A 3U23A 5DLOA 1LPLA 3CC4A 2COZA 2RM4A 3EFOA 1D1BA 1Z9ZA 3M57A 3CMAA 1K4US 3PMTA 3WVEB 2E5KA 1VQ7Q 1NPRA 1T3LA 1AWWA 3CPFA 3G6EA 4LE9A 2GBQA 2YUPA 2DRMA 4MDWA 3SWNB 2R58A 2FPDA 1XJWB 2JXBA 3QSUA 2DILA 4RTXA 2E4HA 3CCEQ 1RABB 5GJWB 3CXCA 1BI1A 2DPPB 3M0PA 2LJ3A 1UFFA 4C5IA 1K9MC 3VYGA 4M78F 1X01A 2LP5A 3L2ZA 2RK2A 5C6SA 1TUCA 4HVUA 1JJ2S 1YBYA 1M2VB 1BI2A 2CT3A 2JS2A 2RI5A 3CCUQ 1YHQQ 2YUQA 3A8GB 1X69A 1GFDA 2F5TX 2DVJA 3CCST 2LVMA 1PD0A 4C92C 2F2VA 2P4RA 3OYCA 4MZTA 1TS9A 4FYVB 1YI2A 4Z88A 2CP0A 5FROA 5CO7A 1IO6A 1FYNA 3RUXA 1QW1A 3CC7T 5GAMd 1IGQA 2PUKB 1C0MA 1ZSGA 4M75F 2FRWA 2J7IA 5GAMh 1K8AU 3QWXX 2LDMA 1VQ8Q 2RQWA 1NE8A 2K9GA 4IUPA 1WPYA 1TOVA 2CYZB 1JJ2A 3MO8A 4R0KA 5CQYA 3M55A 1PKTA 4LDVA 1VQKQ 1M2OA 1MHNA 2DX1A 1UECA 3JCMQ 1WFWA 3A8LB 4KH0B 3QJYA 4KGXB 1N27A 1WX6A 2K5LA 2DERA 3EH2A 4ZGDB 3M9QA 2CP6A 3EG9B 3SHWA 3OSVA 3G71A 3GNGA 1CKAA 1H641 3NMZC 4NS5A 2ZPEB 3META 1Q82C 1I81A 4J9HA 2QQAA 2KSSA 2F2WA 4OP0A 2AZVA 1ZUUA 3BDLA 1X75C 1C1AA 4J9DA 4M77B 2YRDA 3OW2A 3OYAA 1QWFA 3L2WA 3QG1A 4K11A 5IHKA 1YITQ 2NUTA 2PUOB 4HCCA 2QYZA 5D6WA 1ZSZC 1D1AA 3VS4A 2FO0A 1OYXA 4CC4B 2M0YA 1BI3A 3UATA 2V1QA 3I56A 2L3SA 5ECAA 4M78D 5CVIA 4BI8B 2KGTA 3BW1A 3FB9A 3FIFA 3FJ5A 3OYHA 2KRNA 2KK4A 3I55T 3TU4K 3QWYA 2JT4A 3PGGA 1X2QA 3SDZA 1N5ZA 1K73C 2K4YA 4XAXB 2BZXA 3P8HA 2DL8A 4YTLA 1FMVA 3TCJA 3NPFA 1UDLA 2HKNA 2RNAA 2WSEE 3MEVA 3M54A 1G5VA 2DK3A 1VQLT 1YJWA 2EJFA 3O5ZA 4Z8AA 3EFSA 1Q7YU 3L1AA 4M75D 4FSXA 1ABQA 2DAQA 4DBFA 4PJNA 4E7LA 1VQMT 1MMGA 1U5SA 4IURA 1PWTA 2VASA 5CKHA 4B9WA 3IQLA 5J39A 1SSHA 1BI0A 2DEQA 5GAMe 1FX7A 3RMSA 4R55A 1VQ9T 2O88A 2MK5A 3G4SA 2XHCA 4J7FA 2SEMA 2OTLA 3E9FA 1XOVA 3M59A 1VQ4T 2QQSA 1QVFP 3EG0A 1M90U 4AG2C 4QVDA 3CCJQ 2F5KA 1VQPQ 1KIKA 1UGVA 3FLGA 1G3YA 2MAMA 5LJ5g 2JVVA 3CC2A 3OY9A 2KYMA 4E7ZA 5CAIA 5M9OA 4M7AB 1Y71A 1OZ2A 3S6WA
chains in the Genus database with same CATH topology
2RI2A 3H6ZA 3X26B 1VQPA 3RESA 1KC8U 3I55A 3NTHA 4J6YA 2E6ZA 3BY7A 3LW5E 2JUFA 4C0DC 5FLXE 3V7RA 3AHUA 4EMKA 5J3BA 4DOVA 2KAFA 4QW2A 2EKOA 4GY5A 4J8OA 4RG8A 3Q1JA 3CCLT 3JCMg 3LWHA 2WSCE 1IZ6A 2WSFE 3M5AA 3SFMA 3JCMP 4OB2B 3V7SA 3JCMW 3M4YA 2VXFA 4F7UF 3L2UA 3DLLA 1HK9A 3CCRT 5I2MA 5A0DA 4QQDA 4C92A 2L5QA 2LRQA 1W2BA 2E64A 3MP1A 4M75E 3V8KA 3JRZA 3GF5A 3HFNA 3HPWA 3MEUA 1YIJA 4C0FA 1Y96B 2P4TA 3KBGA 3OYBA 4JJNK 4KT0E 3M4GA 3CCQA 3CXCS 4XTVA 3QPHA 2LT4A 3QIIA 3GLXA 3CCUT 1YHQT 2OTJT 4A4HA 3OQ5A 1M9SA 1VQLA 4N4IA 3M58A 1ZBXA 4DA4A 2RHYA 4MZMA 1Y7XA 4PJOA 4FU6A 3QZ5B 4J7IA 5GANj 1D3BA 2JTMA 4A4EA 3UT1A 1BIBA 4XTUA 5DM7R 3V7CA 1NJIU 1LOJA 4C8QE 2K57A 2RB6A 3OSSC 4CI0C 2RH2A 1VQMA 1M1KC 1KQ2A 4LDYA 3OYYA 4JUVA 1N6AA 2CGHA 3N5BB 3LX7A 4P5NA 3OYKA 5GANe 4EPCA 1XTDA 4LD6A 3QDRB 2NLUA 2PVDB 4JLGA 2L89A 1RI0A 2EYQA 2V8IA 4FL6A 4N4HA 1OI1A 4BDZA 3UPUA 2XI9A 2EQUA 2P0QA 3QYHB 3HRUA 4F7UA 1VQ9A 2K5FA 3A5ZB 1QVGS 1PSEA 4C0ZA 3JCMf 5GMKj 2IVWA 2LCCA 2XIDA 4HT9A 4ZGJB 3S3NA 2ZPHB 1B34A 3C94A 1VQ4A 1VQ6T 2X4WA 4C5HA 5HK0A 2O01E 4EMHA 1IREB 2CZ7B 1VQ7A 1QVPA 4HT8A 2LC4A 2WACA 3OYLA 1VQOT 5GMKe 4M77E 2O4XA 1WGSA 4L6V5 2DKGA 2MMPA 1YJNT 1BIAA 1K73U 3HRSA 1KD1U 4Q5WA 2MF2A 2XK0A 1EIFA 3CD6A 4RMOA 3QXEB 3C4SA 5LJ3d 3OB9A 3WVDB 2D6FA 1KQ1A 3MCAB 1KQSA 1WNLA 1VQKT 4M7DC 1UGPB 2XG8D 2Y90A 4J83A 1VIFA 1WJQA 4M7DG 2RHIA 5CKFA 5IN1A 1DJ7B 2EQMA 4HCZA 4FIBA 2XKOC 4M7DD 3A8OB 3SWNA 2EQKA 3CCLA 3QO3A 4XU1A 4C0GA 4MDXA 1S72A 3FEOA 2RHXA 5LJ3e 2KQWA 3VU3C 2GFAA 2YLBA 3ASKA 4BY6C 5GMKm 5LJ5j 3CCRA 3CC4T 2HQEA 4XK8E 3JCMV 4ME7A 2M9UA 3CBOA 4NOYA 5GAMj 4CRIA 2M0OA 3DKMA 3OBYA 3C12A 2QEXT 2E5QA 3ME9A 4TVRA 4X34A 2RHUA 5HK3A 3L2QA 3CMAT 2LT1A 4M7DB 4MZPA 4EDUA 2E70A 4J6WA 1YHQA 4C92G 3CCUA 2G3RA 4M7AC 2OTJA 3PNWC 3NFCA 1MGQA 4RG2A 3JAME 4BE2A 3OYNA 4M7AG 4O5VA 5GAN7 1O75A 4C92D 4O6JA 4ZTJA 4M7DE 3VUBA 3OMGA 4NL3A 4C92F 2FVUA 3OYJA 2KDSA 4M7AD 4J5YA 2BUDA 4IUQA 4M78A 4OB3B 2AHJB 5LJ3g 3G6ET 3S3MA 3JCMe 1ZHIA 2CZ1B 4OB0B 4EMKB 3R6OA 4XTWA 4C5GA 2QA4T 3L2VA 3QHSA 1NZ9A 4PJOG 5IAYA 1K8AC 4IKFA 2V8JA 1JB0E 5FU6C 3QYGB 1YITT 1VQNT 4HCBA 4PJOD 4BACA 4FM4B 4HA8A 2YRVA 3FDRA 2K5IA 4C92B 4JRPA 1JRIA 4PJOF 1W4SA 2RO0A 3C95A 2VC8A 5GAOr 2VYTA 5KH6A 1M4ZA 4BI3A 1FXXA 5KE3A 1VQ6A 3OW2S 3ZFJA 2XU8A 3FJPA 3QKJA 3JB9G 4F7UG 1TH7A 4DQ2A 1VQOA 3PIPA 1M90C 3HP9A 4BI4A 3CCET 2VGNA 3JB9D 3EFRA 2ZPGB 5HY6A 1YJNA 2QXFA 1Q82U 2QQ9A 2RJCA 4PJOB 5GAOn 5CIUA 1M8VA 1JBMA 1D3BB 2QDYB 3OS5A 2HAXA 2MI6A 3LGFA 2EJ9A 2ZZDA 2EJGA 5KCHA 2R57A 1X6OA 3CBPA 4N4GA 3FRNA 3QZ9B 4ZN3A 1N8RC 1VQKA 5FU6B 2E10A 3INZA 2CS7A 1YJ9T 5GAN6 4JRQA 4M75A 4PL6A 1KC8C 1KHCA 2DTHA 5LJ3f 3S6WA 2R5AA 2M16A 1PSFA 4A54A 3JB9J 1I4K1 2LTOA 4XU0A 5D6XA 4F7UB 1YI2T 4XTZA 1M1FA 2RJEA 4LDXA 2DTOA 3JCMb 3MP8A 2E41A 5DLOA 2LQKA 3X24B 2E12A 1B34B 3J7AF 3CC4A 1UGQB 5I2SA 3ER0A 4WF2A 2X35A 4EMGA 5GAN3 4M7AE 2RM4A 3TEEA 3GIBA 3G7ZA 2O4XB 2QEXA 3M57A 3CMAA 4L59A 1M1KU 2CZ6B 3PMTA 3WVEB 4GLKA 3X28B 4C8QA 2RI3A 3M53A 4Z02A 5L8RE 4JS5A 4A4FA 3QBYA 5DLQE 1NPRA 3MHXA 3KUFA 2K3YA 4R56A 5A0GA 3CPFA 3G6EA 3UDCA 2E1HA 1YCYA 3MP6A 5GANh 2GCXA 4MDWA 1M5Q1 3PMIA 3SWNB 2QA4A 1OZ3A 2R58A 3VV0A 2DXBA 2E65A 5I21A 2CZ0B 2X4JA 4IUVA 5CCAA 1Q81C 1VQ8T 3CMET 2VUBA 5CK9A 4MMKA 1YITA 4ATOA 1VQNA 4M77A 4PLLA 3QSUA 3PFSA 2EFIA 3CXCA 1BI1A 2DPPB 1U8RA 1O9SA 2FHDA 2JTFA 1HXDA 4C5IA 1K9MC 1SSFA 2D9TA 2DD4A 3HKSA 3VYGA 2EIFA 4M78F 4XTXA 4A4GA 4BDYA 4X9CA 5GMKh 3BDUA 5LJ3j 1X01A 3CCVT 4FT4A 3L2ZA 3G71T 3L2RA 3BFMA 1QVFS 2RK2A 4J6XA 3OS2A 4XU3A 3LGLA 5C6SA 1M1GA 2IG0A 3OS0A 3GP8A 3CCEA 5GAMg 3S3OA 1YBYA 1JJ2S 1BI2A 2Y4XA 1QP2A 5GAN2 1KD1C 2RI5A 4EMKC 5GAOl 3A8GB 4OB1B 2E6NA 3OMCA 4M78B 1YJ9A 2F5TX 2I2LA 3JB9H 2EAYA 5GAOp 3PIOA 3CCST 3ZEHA 2LVMA 2QQRA 2CKKA 2EWNA 1QVGA 1R8OB 4C92C 3E9GA 5KCOA 4OF1A 5IT9E 3NTIA 1I8FA 3RKYA 3OYCA 1Y07A 4MZTA 2ZPBB 1P92A 3HL8A 3HFOA 5LJ5d 3OYMA 1YI2A 1I5LA 4V2SA 2RHZA 4KUIA 1UGSB 5KE2A 5FROA 2JZ2A 2GQVA 5CO7A 3RUXA 1U1TA 1QW1A 2LCLA 5GAMd 1Q7YC 3CC7T 5LJ5h 2ZCFB 4QVCA 1U1SA 4D6WA 2PUKB 3FC3A 2DXUA 3URGA 4XQ3A 4PJOC 3HRTA 3H8ZA 4M75F 5FU7B 4Y28E 2DIQA 2DTIA 2VV5A 5GAMh 1K8AU 3RKWA 2L8DA 3P8BB 1V29B 3DB4A 2M1HA 5GAN5 2DVEA 2LDMA 1W2BS 3I56T 4QQGA 1QVFA 1G3WA 2KMTA 5CQXA 3JCMX 1NE8A 1XQHA 4OGCA 4IUPA 4HKEA 1VUBA 1WPYA 3JCMh 4C8QG 2CYZB 5J26A 1JJ2A 1WJSA 4M75B 1ZQ1A 3MO8A 2XD0A 2B8AA 5CQYA 3M55A 3CCMT 2VXEA 4LDVA 3DLMA 2XICA 4X9DA 1MHNA 4C8QD 3LLRA 5CKEA 4C8QF 2YLCA 3CEYA 3JCMQ 1VQ8A 4XTYA 3V8LA 2ZPFB 3CMEA 3JB9F 1Q86C 2MWOA 3J81E 3A8LB 3QJYA 1N27A 4IUUA 2K5LA 3PTAA 2FL7A 4ZGDB 3M9QA 3RKXA 1N8RU 3OYFA 3VKIA 4KULA 2K2VA 3MEWA 4JLIA 3OSVA 4OVAA 4M77G 3CCVA 1S72T 4C8QB 3G71A 3GNGA 5A2QE 4N0AA 4RKUE 1H641 3A8HB 1KHIA 4NS5A 4M77D 5A0LA 2ZPEB 2P0PA 3META 4M77F 3SD4A 1I81A 5GAN4 3A8MB 1Q82C 3JCMc 3X20B 1YJWT 2QQAA 2KSSA 3JSCA 5GMKl 5CKDA 4C92E 3SWNC 4E7HA 5GAOm 4PLIA 5DY9A 1LJOA 4OP0A 2KY9A 2LNVA 4BE1A 2GF7A 3TREA 2DIGA 1NPPA 3O8VA 3HSBA 4BD3A 4ZN1A 3CCSA 4ZGEB 4KUDK 3EAEA 3BDLA 1X75C 4M7AA 3RMQA 2DO3A 1FWZA 5FRNA 4OGEA 2DXCA 4M77B 1BYMA 2A7YA 4E7JA 3OW2A 1KQSS 1GXIE 3OS1A 3OYAA 3L2WA 2DJZA 4PJOE 2LX9A 1N9RA 5GANd 3QG1A 1WQ7A 3VYHB 2PUOB 4C0DB 4E7KA 2D0QB 3G4ST 4OMFB 2QQBA 4A4KA 3CC7A 2OTLT 4HCCA 5D6WA 4ELZC 5LJ5f 3GPLA 2BIVA 4B9XA 3VJPA 2HNIA 3RIRA 2EQJA 2JNGA 4BE0A 1NJIC 2FB7A 1OYXA 3QJ6A 2PVGB 2XDBA 3CPWS 1BI3A 4M78C 4FT2A 2R5MA 3WXMB 4DOWA 5GAMf 3KXTA 1Y96A 1Q81U 2QTXA 4F7UE 5GMKi 4M78G 4VUBA 4PKCC 3I56A 1VQ5T 3LWIA 1UGRB 4JRIA 3CC2T 5EG2A 3OBWA 2BKDN 2JN0A 4M78D 5CVIA 4Y91A 3OYDA 4BI8B 4C5EA 3OA6A 3BW1A 4IUTA 2GFUA 3FB9A 1K9MU 1KG1A 3FIFA 3CCMA 3CCJT 3NTKA 2HQXA 5CR2A 3OYHA 4E47A 2RK1A 5HKCA 1VQPT 5LL6S 2KK4A 4BB7A 4L5GA 3I55T 3TU4K 1N9SA 3PGGA 4RCBA 3SDZA 5GAOq 2HBPA 2RJDA 2YHTA 3X25B 1UB4A 4BUGA 3LH0A 1K73C 2QI2A 2K4YA 4XAXB 2H3JA 5FU7C 3VUZA 3PT9A 2P0KA 3LYIA 3GOXA 5GANg 2ZGWA 3JB9I 3P8HA 3P8DA 1XNIA 2RA2A 2Y4YA 2DZCA 4YTLA 4JS4A 3T9NA 4LDUA 3TCJA 1YIJT 2V8KA 4ELYC 3V8JA 5LJ3h 3CCQT 2C06A 2DD5A 2WSEE 3OYGA 3MEVA 3L42A 3M54A 4M75C 1G5VA 1BKBA 1LNXA 2DK3A 4N0AC 4RCCA 4LDWA 5CKBA 5C0MA 4ZTFA 1YJWA 1VQLT 4M7DF 2EJFA 4M75G 3CPWA 3RERA 4KBMB 3EFSA 1Q7YU 3L1AA 4M75D 3ZBDA 2XDPA 3E1SA 2DXTA 2F69A 3CBMA 4FSXA 2PQWA 4PNOA 1G3TA 1UEBA 2X4YA 2DAQA 4E7LA 5LJ5e 3MEAA 4E7IA 1VQMT 4IURA 5CKHA 4B9WA 2K3XA 2PU9B 3JCMd 5J39A 4NL2A 2KVQG 2A3LA 1BI0A 2DEQA 4C8QC 4XU2A 1FX7A 4JDSA 4QQ6A 3RMSA 3UWNA 5GAMe 4R55A 3J80E 2LQ8A 1VQ9T 3G4SA 2XHCA 4J7FA 4M78E 2HD0A 4II1A 2JOYA 3E9FA 3JCMJ 2OTLA 4UC4A 3GNFB 1WJRA 2RJFA 4A53A 2PVOB 1XOVA 1VIEA 3M59A 5GANf 1VQ4T 2QQSA 4BY6B 4LD9K 4M7AF 4MMLA 1H3ZA 3DB3A 3F70A 1M90U 1VQ7T 4QVDA 2XDDA 2RD1A 2F5KA 2VGMA 1QP3A 2L3RA 3E19A 3OYEA 1RL2A 3SB2A 4JRKA 3HHTB 5D6YA 5GAN8 1Q86U 1VQ5A 2OAUA 2MWPA 3FLGA 4M7DA 1G3YA 2MAMA 2X4XA 3M56A 5LJ5g 2JVVA 4QVZA 3OYIA 3CC2A 5FRMA 1AHJB 1WQWA 3CD6T 2DZ9A 5AYFA 3OY9A 2ZPIB 4M77C 5CAIA 3QUIA 5M9OA 4M7AB 1G3SA 3CCJA 1Y71A 1OZ2A 2FYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KG1 A; 
#chains in the Genus database with same CATH topology
 1OV3 A;  3X26 B;  4ESR A;  1KC8 U;  3NTH A;  2E6Z A;  3CCS Q;  4C0D C;  1W1F A;  2JUF A;  4RG8 A;  3CCL T;  1PD1 A;  2WSC E;  3CCR T;  5I2M A;  2YT6 A;  1K8A R;  1QCN A;  2L5Q A;  4DBH A;  4Y92 A;  1W2B A;  3MP1 A;  4C0F A;  1Y96 B;  2K6D A;  4JJN K;  3H0I A;  3QPH A;  3GLX A;  3EGD A;  2KXD A;  4N4I A;  3M58 A;  1SPK A;  4PJO A;  5KYU A;  3NHN A;  5GAN j;  1D3B A;  2JTM A;  3UT1 A;  1BIB A;  4IIM A;  3V7C A;  3TSW A;  4RTT A;  4CI0 C;  2OI3 A;  1M1K C;  1YCS B;  1KQ2 A;  3OYY A;  7AT1 B;  3N5B B;  4P5N A;  2EYZ A;  4PK4 A;  3UPU A;  1OI1 A;  1Y57 A;  1WXT A;  3A5Z B;  2IVW A;  2EW3 A;  4HT9 A;  3C94 A;  2ABL A;  5GJV B;  4C5H A;  5HK0 A;  2CZ7 B;  2EGC A;  2WAC A;  5GMK e;  4M77 E;  2O4X A;  1AWX A;  5KYN A;  1YJN T;  4KRT A;  1PG5 B;  4Q5W A;  5HCK A;  3CD6 A;  2GGR A;  3C4S A;  3QXE B;  5LJ3 d;  1KQ1 A;  1KQS A;  1WNL A;  1OEB A;  1UGP B;  2XG8 D;  4J83 A;  1VIF A;  2YUO A;  5CKF A;  1DJ7 B;  3QO3 A;  4MDX A;  1S72 A;  2RHX A;  4IKF A;  2OTJ Q;  1RLP C;  2HQE A;  3JCM V;  1YN8 A;  2X3W D;  4CRI A;  3C12 A;  2QEX T;  3ME9 A;  4M7D B;  4MZP A;  3REB B;  2E70 A;  4C92 G;  3I35 A;  6AT1 B;  3NFC A;  1G2B A;  4M7A G;  2K3B A;  1O75 A;  4JZ3 A;  4C92 F;  2FVU A;  3C0C A;  3VS7 A;  5KYW B;  4J9E A;  4J5Y A;  1WXU A;  2BUD A;  5LJ3 g;  4OB3 B;  2AHJ B;  2J6K A;  3S3M A;  1K73 R;  1KD1 R;  3RBB B;  4C5G A;  2QA4 T;  3I55 Q;  1VQN T;  4PJO D;  4FW1 A;  1JRI A;  3EHQ A;  2YUN A;  2FPF A;  1VQ6 A;  3QKJ A;  2JJ9 A;  4BI4 A;  2W0Z A;  3CCE T;  1X6B A;  2I0N A;  1BCM A;  2MPX C;  2QXF A;  2QQ9 A;  5CIU A;  1JBM A;  2EJG A;  1VQL Q;  2R57 A;  1N8R C;  5FU6 B;  5GAN 6;  2KXC A;  3CC4 Q;  4X1V A;  1OQK A;  1PSF A;  1AWO A;  4F7U B;  3CMA Q;  1IB8 A;  1QCO A;  3JCM b;  3MP8 A;  3NGP A;  4FYW B;  2VWF A;  5I2S A;  3ER0 A;  4WF2 A;  4M7A E;  3TEE A;  3GIB A;  5KYY B;  1E6H A;  4L59 A;  3G6E Q;  4C8Q A;  4DEY A;  2QK0 A;  3M53 A;  3QBY A;  3MHX A;  4R56 A;  1G83 A;  1HJD A;  3MP6 A;  2W10 A;  2GCX A;  5GAN h;  3VV0 A;  4QKU A;  1B7T A;  2JW4 A;  2CUD A;  2EPD A;  2X4J A;  5CCA A;  1RAE B;  1VQ8 T;  2FPE A;  4ATO A;  3D7S B;  2DYI A;  4FCY A;  2ECZ A;  1D0Y A;  2DRK A;  1O9S A;  2O31 A;  3HKS A;  3EHR A;  2F1L A;  3BDU A;  1UJY A;  3BFM A;  3GP8 A;  3LGL A;  4OMM A;  2K79 A;  2QG9 B;  2M02 A;  2NUP B;  2Y4X A;  2E3I A;  4F17 A;  1YI2 Q;  4M78 B;  1M1K R;  3I9Q A;  1ZA2 B;  2KEA A;  2EGE A;  2EAY A;  3PIO A;  2OAW A;  2CKK A;  3E9G A;  1QCF A;  5KCO A;  5IT9 E;  1I8F A;  3HL8 A;  1I5L A;  2O9S A;  4V2S A;  2JM8 A;  1OOT A;  2RHZ A;  4KUI A;  3REA B;  1UGS B;  1MUZ A;  2X51 A;  4AG1 C;  2DNU A;  1U1T A;  2ZCF B;  3FC3 A;  4PJO C;  1RI9 A;  4XQ3 A;  3HRT A;  2BZ8 A;  2NUZ A;  2VV5 A;  3P8B B;  1V29 B;  1JQQ A;  2M1H A;  3DB4 A;  1U3O A;  2KMT A;  5CQX A;  4OGC A;  3EGX B;  1VUB A;  1WJS A;  4M75 B;  1ZQ1 A;  2B8A A;  1ZUK A;  4C8Q D;  2HDA A;  2QTV A;  4M7D E;  3CEY A;  2MCN A;  1SHF A;  3V8L A;  3CME A;  3G71 Q;  1Q86 C;  1IHW A;  2ROL A;  2FL7 A;  3VKI A;  4KUL A;  3MEW A;  4OVA A;  1WZO A;  1PRM C;  3CCV A;  5A2Q E;  1WI7 A;  2KRS A;  2YXY A;  1KHI A;  1GCQ A;  5IXB A;  4ANJ A;  5A0L A;  4WTO B;  2QEX Q;  2PZ1 A;  3JSC A;  5GMK l;  5CKD A;  2V1R A;  4PLI A;  2GF7 A;  1NPP A;  3O8V A;  3SEM A;  3HSB A;  4BD3 A;  4KUD K;  2K2M A;  3RMQ A;  1FWZ A;  5FRN A;  4OGE A;  1BYM A;  4E7J A;  2QA4 Q;  3VYH B;  1VQN Q;  4E7K A;  2D0Q B;  4ELZ C;  4FYX B;  2HNI A;  2LMJ A;  2ATC B;  3QJ6 A;  2PVG B;  3CPW S;  4ZNX A;  4FT2 A;  2LQN A;  3WXM B;  4DOW A;  3KXT A;  2QTX A;  1N8R R;  4F7U E;  5GMK i;  4M78 G;  4PKC C;  2KYB A;  4C5E A;  3OA6 A;  1K9M U;  3CCM A;  3QDF A;  3CCJ T;  2HQX A;  4LXC A;  1VQP T;  4L5G A;  2CP3 A;  5GAO q;  1UB4 A;  4BUG A;  3LH0 A;  1VA7 A;  2JMA A;  2MOX A;  5FU7 C;  3PT9 A;  2P0K A;  2Z0W A;  3GOX A;  2COY A;  2ZGW A;  3P8D A;  2RA2 A;  3VS5 A;  1T0H A;  1JU5 C;  2DM1 A;  4LDU A;  1YIJ T;  2BE7 D;  2C06 A;  1AOJ A;  2DJQ A;  4JJD A;  1BKB A;  5C0M A;  1NEB A;  4N0A C;  5CKB A;  8AT1 B;  5KYX A;  2LNH B;  1RAD B;  2DL7 A;  4M75 G;  3CPW A;  1QVG P;  3RER A;  3G1J A;  2YSQ A;  3E1S A;  3CBM A;  3CQT A;  3G4S Q;  2OTL Q;  2ROT A;  1T3S A;  1OX9 A;  1B3Q A;  2PU9 B;  2KVQ G;  2VB6 A;  2A3L A;  4CC2 A;  4C8Q C;  4CC3 A;  4QQ6 A;  2A08 A;  3JCM J;  4M78 E;  4II1 A;  1WHM A;  2KR3 A;  4UC4 A;  2RJF A;  3CC2 Q;  2HBW A;  5GAN f;  2ESW A;  2CRE A;  3F70 A;  2VGM A;  3OYE A;  4JRK A;  2JMC A;  3HHT B;  1VQ5 A;  2HQH A;  2ZPI B;  2CP2 A;  1G3S A;  1UG1 A;  5GAM g;  2RI2 A;  3H6Z A;  4DBR A;  3V7R A;  4EMK A;  5J3B A;  2EKO A;  2C0T A;  3M0T A;  4PFO A;  3JCM P;  3JB9 F;  3V7S A;  3L2U A;  3DLL A;  4IIO A;  2E64 A;  3V8K A;  4M75 E;  3HPW A;  3KBG A;  1OU8 A;  3CCQ A;  2J05 A;  2A28 A;  2LT4 A;  2OTJ T;  1M9S A;  1YWP A;  3H41 A;  2EVR A;  4DA4 A;  3QZ5 B;  4J7I A;  4M4Z A;  1Q86 R;  2FEI A;  2RB6 A;  1RUW A;  2KRM A;  4LDY A;  4JUV A;  1N6A A;  2CGH A;  3OYK A;  3RR6 A;  1ZUY A;  1XTD A;  4LD6 A;  4JLG A;  2NLU A;  1NLO C;  1QVG S;  4C0Z A;  1QWE A;  2RPN A;  2LCC A;  2D0N A;  1GRI A;  1I5O B;  3CD6 Q;  2O01 E;  4EMH A;  1VQ7 A;  2LC4 A;  1VQO T;  1ZA1 B;  3A98 A;  4L6V 5;  2MMP A;  1KSW A;  1BIA A;  1K73 U;  3HRS A;  2GTO A;  1KD1 U;  1WHK A;  2B86 A;  3OB9 A;  2D6F A;  2FRY A;  4M7D C;  2DA9 A;  3EG3 A;  1YNZ A;  3A8O B;  2DMO A;  4KGZ B;  3SWN A;  2EQK A;  4XU1 A;  5I11 A;  1GCQ C;  2HL5 C;  1SRM A;  3VU3 C;  2GFA A;  2YLB A;  3ASK A;  4BY6 C;  4AMC A;  2MYS A;  2KT8 A;  3CC4 T;  1PCX A;  3DKM A;  3OBY A;  2ENM A;  3CMA T;  2RHU A;  1RAA B;  1YHQ A;  1EX4 A;  1ACM B;  3CCU A;  1K9M R;  2EBP A;  4RG2 A;  4BE2 A;  1M2V A;  4ZTJ A;  2J6O A;  2KDS A;  4IUQ A;  3G6E T;  2RQU A;  2G6F X;  1K1Z A;  3L2V A;  4PJO G;  1KK7 A;  2DEU A;  2HCK A;  5FU6 C;  3QYG B;  4HCB A;  4BAC A;  2D8H A;  4HA8 A;  4C92 B;  4JRP A;  4KH1 B;  4PFP A;  4PJO F;  3C95 A;  2VC8 A;  5GAO r;  1M4Z A;  2LQW A;  1WDX A;  3E2U A;  3FJP A;  1TH7 A;  1M90 C;  3PIP A;  1YIJ Q;  2VGN A;  3JB9 D;  3EFR A;  1M8V A;  2QDY B;  2HAX A;  5KCH A;  4ORZ A;  1F1B B;  1VQK A;  2E10 A;  3LH5 A;  4PL6 A;  1KC8 C;  2M16 A;  1YI2 T;  2AIR B;  5IHI A;  4OMP A;  2LQK A;  2E12 A;  1B34 B;  3J7A F;  2X35 A;  4EMG A;  5GAN 3;  1R0C B;  3EG9 A;  3G7Z A;  1M1K U;  3X28 B;  2RI3 A;  1YFN A;  2RF0 A;  4JS5 A;  4A4F A;  2X9H A;  4KGV B;  2K3Y A;  2JM9 A;  5A0G A;  3UDC A;  2E1H A;  1YCY A;  1Q82 R;  1M5Q 1;  1OZ3 A;  4E7S A;  1UUE A;  3EG1 A;  2DYB A;  2CZ0 B;  2A0F B;  1Q81 C;  2VUB A;  4MMK A;  1YIT A;  4M77 A;  4PJJ A;  2EFI A;  1U8R A;  1I07 A;  2FHD A;  2JTF A;  1HXD A;  2NWM A;  4D8D A;  2EIF A;  4A4G A;  4BDY A;  4X9C A;  5D7U A;  2CUB A;  4FT4 A;  3G71 T;  1QVF S;  1TUD A;  2FZC B;  4XU3 A;  1NBE B;  1ZSZ B;  2HSE B;  1D0Z A;  3PE0 A;  4F04 B;  4EMK C;  4F16 A;  4OB1 B;  1BK2 A;  3OMC A;  1YJ9 A;  4J9G A;  1H3H A;  2ED0 A;  4QT7 A;  3RKY A;  1Y07 A;  2ZPB B;  3UF4 A;  5FWC A;  2JZ2 A;  1GBR A;  3VS3 A;  1D09 B;  1I1J A;  2DXU A;  1TU0 B;  2DE0 X;  1UE9 A;  4Y28 E;  2DTI A;  2J06 A;  3RKW A;  2EKH A;  2DVE A;  1VQO Q;  1W6X A;  3I56 T;  4QQG A;  1ZBJ A;  1QVF A;  1WIE A;  3CME Q;  1XQH A;  5I22 A;  3JCM h;  4C8Q G;  1QMC A;  1S1N A;  5J26 A;  1EFN A;  2XD0 A;  2L3P A;  4FSS A;  4RTU A;  2FZG B;  4RTZ A;  4PJM A;  3DLM A;  4LNP A;  4RTW A;  3RNJ A;  1GBQ A;  3LLR A;  5CKE A;  4E6R A;  1J3T A;  1JXM A;  1WHG A;  4C8Q F;  2YLC A;  4XTY A;  1VYV A;  2MWO A;  3GBQ A;  2JTE A;  1Q95 G;  3PTA A;  2M51 A;  3EFO B;  1R0B G;  1N8R U;  4JLI A;  1D1C A;  5IXF A;  1V76 A;  4N0A A;  1WLP B;  3A8H B;  3H9N A;  1C6V X;  1BB9 A;  4M77 D;  4LUE A;  1PC0 A;  2P0P A;  3SD4 A;  5GAN 4;  3A8M B;  3TQ7 P;  1YJW T;  4C92 E;  3SWN C;  1LJO A;  2KY9 A;  2LNV A;  4BE1 A;  2AKL A;  3TRE A;  2X3X D;  2DIG A;  1LCK A;  1IHV A;  1UJ0 A;  3CCS A;  4ZGE B;  2GNC A;  3EAE A;  4M7A A;  1UHC A;  2A7Y A;  1AWJ A;  1VYT A;  1GXI E;  3OS1 A;  1N9R A;  5GAN d;  1WQ7 A;  1RAG B;  4C0D B;  3G4S T;  3CC7 A;  4GLM A;  2OTL T;  5LJ5 f;  2BIV A;  1M30 A;  2JNG A;  3H0H A;  1NJI C;  2FB7 A;  1PRL C;  3CCM Q;  2E3H A;  1IRX A;  1Y96 A;  2KNB B;  2LCS A;  4JRI A;  2GQI A;  3CC2 T;  5EG2 A;  4AFU C;  2JN0 A;  4J9I A;  2GFU A;  2GTJ A;  1MMN A;  3UA6 A;  5CR2 A;  4E47 A;  5LL6 S;  4BB7 A;  3CXC P;  4RCB A;  2RJD A;  2YHT A;  3X25 B;  2OX7 A;  2H3J A;  3VUZ A;  5GAN g;  1MV3 A;  3JB9 I;  1XNI A;  5EC7 A;  1WYX A;  1K9A A;  2AKK A;  3V8J A;  2DD5 A;  2H8H A;  4JZ4 A;  2RQR A;  3M0R A;  4ZTF A;  1LNX A;  4M7D F;  4KBM B;  3AT1 B;  3ZBD A;  2L3Q A;  2XDP A;  2DXT A;  2F69 A;  3MPU B;  1UEB A;  1WXB A;  1X43 A;  1PM3 A;  4NL2 A;  4OMQ A;  3BE3 A;  3PVL A;  4XU2 A;  3UWN A;  3M0U A;  2HD0 A;  2QGG A;  1KFZ A;  1M3C A;  2QGF B;  1WJR A;  4A53 A;  2PVO B;  1VIE A;  4LD9 K;  5FWB A;  4MML A;  2A37 A;  3DB3 A;  2BTT A;  1M27 C;  2XDD A;  2L3R A;  3E19 A;  1RL2 A;  3SB2 A;  5D6Y A;  5GAN 8;  1Q86 U;  1SF9 A;  2L2P A;  4M7D A;  2OAU A;  3M56 A;  2X4X A;  2P84 A;  2A36 A;  4QVZ A;  3CD6 T;  1SKU B;  4M77 C;  4EIK A;  1GL5 A;  2AZS A;  2FYK A;  3RES A;  5KYW A;  3I55 A;  3BY7 A;  2DFU A;  3EH1 A;  2KAF A;  4QW2 A;  4GY5 A;  2NUT B;  2EGA A;  3LWH A;  2WSF E;  3M5A A;  1S72 T;  3SFM A;  1Y0M A;  3JCM W;  2VXF A;  4F7U F;  5A0D A;  4QQD A;  2LRQ A;  3GF5 A;  3MEU A;  4CC7 A;  2P4T A;  4RTV A;  3OYB A;  2RQV A;  4J9F A;  4J9C A;  3M4G A;  3CXC S;  3UA7 A;  4XTV A;  4A4H A;  3OQ5 A;  1VQL A;  1AD5 A;  2RHY A;  3I56 Q;  4FU6 A;  2V26 A;  4A4E A;  3OW2 P;  5DM7 R;  1OU9 A;  1VQM A;  1YWO A;  3LX7 A;  5GAN e;  4EPC A;  4FL6 A;  2EYQ A;  1H8K A;  2EQU A;  4F7U A;  3QYH B;  1VQ9 A;  1AT1 B;  2K5F A;  1PSE A;  2EYX A;  3JCM f;  5GMK j;  2DET A;  1NYG A;  4ZGJ B;  2LJ1 A;  3S3N A;  2HMA A;  1VQ4 A;  1VQ6 T;  2X4W A;  2O9V A;  4HT8 A;  1QKX A;  1CSK A;  1TWB A;  5KYY A;  2IIM A;  1U06 A;  2KT1 A;  3WVD B;  1YJW Q;  3MCA B;  2RN8 A;  2ZAE A;  1WJQ A;  5FW9 A;  5IN1 A;  4FIB A;  1AEY A;  1MMD A;  4M7D D;  2CSQ A;  3CCL A;  4C0G A;  3FEO A;  2KQW A;  5LJ5 j;  1NJI R;  5GMK m;  4HVW A;  3CCR A;  3CBO A;  4NOY A;  1AZG B;  2E5Q A;  4X34 A;  5HK3 A;  1CKB A;  4M7A C;  1I0C A;  3PNW C;  1MGQ A;  2PNI A;  3JAM E;  3EG2 A;  4O5V A;  5GAN 7;  2NUP A;  4O6J A;  3VRZ A;  3OMG A;  3VUB A;  4NL3 A;  1WA7 A;  4M78 A;  3KFV A;  3ZL7 C;  1ZHI A;  2CZ1 B;  3TVT A;  1NZ9 A;  1K8A C;  5IAY A;  2V8J A;  1JB0 E;  1JO8 A;  3FDR A;  1W4S A;  2RO0 A;  2VKN A;  1NLP C;  8ATC B;  3OW2 S;  2XMF A;  3JB9 G;  4DQ2 A;  1K0X A;  3EGD B;  2ZPG B;  2MIO A;  1YJN A;  1X2K A;  1Q82 U;  4PJO B;  5KYU B;  2RJC A;  5GAO n;  1D3B B;  1LVK A;  3OS5 A;  4OMN A;  2MI6 A;  3LGF A;  2EJ9 A;  2CH4 W;  2ZZD A;  1X6O A;  3CBP A;  3FRN A;  3QZ9 B;  4ZN3 A;  1ABO A;  3I5R A;  3EGX A;  3EGU A;  4OMO A;  1PNJ A;  4M75 A;  2DTH A;  4A54 A;  1JEG A;  2OJ2 A;  2LTO A;  4XU0 A;  4XTZ A;  1M1F A;  1W2B P;  2DL5 A;  1PKS A;  2RJE A;  4AFZ C;  2D8J A;  4LDX A;  2PTK A;  3X24 B;  4JJC A;  1OPK A;  1UGQ B;  1K76 A;  2O4X B;  2YWW A;  2QEX A;  2KRO A;  2CZ6 B;  4GLK A;  5L23 A;  4Z02 A;  5L8R E;  2HZY A;  5DLQ E;  1NM7 A;  3KUF A;  1SEM A;  2LZ6 B;  1ZLM A;  3PMI A;  1GCP A;  2QA4 A;  2DXB A;  2E65 A;  5I21 A;  4IUV A;  2BE9 B;  1AZE A;  1Z9Q A;  3CME T;  1SRL A;  1M8M A;  5CK9 A;  1VQN A;  4PLL A;  1QQJ A;  3PFS A;  1BBZ A;  2K7A A;  1S72 Q;  1SSF A;  2D9T A;  1SHG A;  1MMA A;  2DD4 A;  2HKQ B;  4XTX A;  5GMK h;  5LJ3 j;  1A0N B;  3CCV T;  3L2R A;  1YJ9 Q;  2L0A A;  2RQT A;  4J6X A;  3OS2 A;  3THK A;  1M1G A;  2IG0 A;  3OS0 A;  3CCE A;  1KQS P;  3S3O A;  3VRY A;  1QP2 A;  5GAN 2;  3VS1 A;  1KD1 C;  5GAO l;  3H0F A;  1YP5 A;  2E6N A;  1RAF B;  1IXD A;  2CP7 A;  2I2L A;  4JPB W;  2DBK A;  3JB9 H;  2EQI A;  5GAO p;  3ZEH A;  2QQR A;  1QVG A;  2EWN A;  2IPO B;  1R8O B;  4OF1 A;  1M3A A;  3NTI A;  3MKD A;  1P92 A;  5LJ5 d;  1T0J A;  3HFO A;  3OYM A;  5KE2 A;  2GQV A;  1NEG A;  5IH2 A;  2LCL A;  1Q7Y C;  1D0X A;  5LJ5 h;  4QVC A;  1U1S A;  4D6W A;  4AFS C;  4HVV A;  3URG A;  3H8Z A;  5FU7 B;  2DIQ A;  1VQ6 Q;  1RAH B;  2L8D A;  5GAN 5;  2HSP A;  1W2B S;  1WHJ A;  2C0O A;  1G3W A;  3JCM X;  2O2O A;  4HKE A;  1VYU A;  4JJB A;  2CP5 A;  3JV3 A;  3CCM T;  1FMW A;  2VXE A;  2XIC A;  4X9D A;  2YDL A;  1VQ8 A;  2ZPF B;  4LN2 A;  3J81 E;  4IUU A;  3RKX A;  3OYF A;  2EYY A;  2H3E B;  2K2V A;  1W70 A;  4M77 G;  4C8Q B;  1QKW A;  4RKU E;  3RDV A;  3VS0 A;  1UHF A;  4M77 F;  3JCM c;  3X20 B;  4E7H A;  5GAO m;  1VOM A;  5DY9 A;  2QAS A;  4HXJ A;  1RAI B;  3HTR A;  4ZN1 A;  4AT1 B;  3CC7 Q;  2D1X A;  2DO3 A;  3M0S A;  1QLY A;  4AFQ C;  2DXC A;  1SG5 A;  2SRC A;  4PJL A;  1KQS S;  2DJZ A;  4PJO E;  2LX9 A;  4F14 A;  4OMF B;  2QQB A;  4A4K A;  2HEQ A;  3GPL A;  4B9X A;  3VJP A;  3RIR A;  2EQJ A;  4BE0 A;  2DBM A;  3A1P A;  2XDB A;  4M78 C;  5GAM f;  2R5M A;  1UTI A;  4LUD A;  1Q81 U;  1NG2 A;  4VUB A;  1VQ5 T;  3LWI A;  3ULR B;  1UGR B;  3I5S A;  3OBW A;  2BKD N;  4Y91 A;  3OYD A;  1NYF A;  1KG1 A;  4IUT A;  3NTK A;  2RK1 A;  5HKC A;  1M3B A;  1N9S A;  2HBP A;  1R77 A;  1TSF A;  2QI2 A;  3VS2 A;  3LYI A;  4DEX A;  2Y4Y A;  2DZC A;  4JS4 A;  3T9N A;  2V8K A;  1IGU A;  4ELY C;  5LJ3 h;  2FG0 A;  3CCQ T;  1H92 A;  2HL3 A;  1X27 A;  1OX8 A;  3OYG A;  1WHL A;  4M75 C;  3L42 A;  4RCC A;  1OUL A;  4LDW A;  3MJX A;  1RAC B;  1HD3 A;  2LJ0 A;  2PQW A;  4PNO A;  1G3T A;  2X4Y A;  4E7I A;  5LJ5 e;  3MEA A;  3M0Q A;  2K3X A;  3JCM d;  2VVK A;  4A63 B;  1HSQ A;  1MNE A;  4JDS A;  3J80 E;  2LQ8 A;  4DBQ A;  2JOY A;  3GNF B;  2EYW A;  4HCK A;  4BY6 B;  4M7A F;  2COW A;  1H3Z A;  1VQ7 T;  1X6G A;  3CCV Q;  2RD1 A;  1QP3 A;  4FW2 A;  2MWP A;  3OYI A;  5FRM A;  1AHJ B;  1WQW A;  4B6M A;  2DZ9 A;  5AYF A;  2BZY A;  2QAZ A;  3QUI A;  3CCJ A;  1VQP A;  4PFZ A;  2CH4 A;  4J6Y A;  5FLX E;  1TXQ A;  2KBT A;  3LW5 E;  3AHU A;  1WHH A;  4DOV A;  1Q7Y R;  4J8O A;  3Q1J A;  1BU1 A;  3JCM g;  1JXO A;  1IZ6 A;  4OB2 B;  3M4Y A;  1HK9 A;  1TUG B;  4C92 A;  4D8K A;  3JRZ A;  3HFN A;  1OPL A;  1YIJ A;  2NYS A;  4KT0 E;  3VS6 A;  1BCO A;  2C0I A;  2JS0 A;  3QII A;  1YHQ T;  3CCU T;  1VQM Q;  2DL4 A;  1ZBX A;  2RMO A;  4MZM A;  1Y7X A;  2AK5 A;  1HYO A;  1M90 R;  1VQ9 Q;  4XTU A;  1NJI U;  1LOJ A;  1V1C A;  1ZX6 A;  4C8Q E;  2K57 A;  3OSS C;  4E2F B;  2RH2 A;  1VQ4 Q;  1G8X A;  2QDL A;  3QDR B;  2PVD B;  2L89 A;  1RI0 A;  2V8I A;  4N4H A;  4BDZ A;  1E6G A;  2P0Q A;  2XI9 A;  3HRU A;  2YRC A;  1KC8 R;  2XID A;  1MND A;  2ZPH B;  1B34 A;  2KE9 A;  2LX7 A;  1IRE B;  1QVP A;  2J6F A;  3OYL A;  5KYX B;  1WGS A;  2DKG A;  1AVZ C;  4J9B A;  2MF2 A;  2XK0 A;  1EIF A;  4RMO A;  3CCL Q;  1EZZ B;  1VQK T;  1K0S A;  2Y90 A;  3CCR Q;  4M7D G;  2RHI A;  2EQM A;  4HCZ A;  2CDT A;  2XKO C;  1TTH B;  2F2X A;  2CT4 A;  9ATC B;  5LJ3 e;  4GBQ A;  1KJW A;  4XK8 E;  4ME7 A;  1Q81 R;  2M9U A;  4RUG A;  5GAM j;  2M0O A;  4TVR A;  3L2Q A;  3CPW P;  2LT1 A;  4EDU A;  4J6W A;  2OTJ A;  2G3R A;  3TSZ A;  1ZSZ A;  3OYN A;  4C92 D;  2DF6 A;  1VQ5 Q;  5AT1 B;  3OYJ A;  4M7A D;  1GFC A;  2ED1 A;  1ARK A;  3JCM e;  4OB0 B;  2DLP A;  3PVQ A;  4EMK B;  1PHT A;  3R6O A;  4XTW A;  4Z89 A;  3QHS A;  4OML A;  1RLQ C;  1JJ2 P;  2DL3 A;  1YIT T;  1TG0 A;  4FM4 B;  1FMK A;  2YRV A;  2K5I A;  1B07 A;  1E7O A;  1YJN Q;  2VYT A;  5KH6 A;  4BI3 A;  1FXX A;  5KE3 A;  2FZK B;  3ZFJ A;  2XU8 A;  4F7U G;  1VQO A;  3HP9 A;  2AT1 B;  2CSI A;  5HY6 A;  3CCQ Q;  4WCI A;  4RTY A;  4N4G A;  3INZ A;  2CS7 A;  2KI7 A;  1YJ9 T;  1MV0 B;  4JRQ A;  1KHC A;  4FYY B;  5LJ3 f;  2R5A A;  3R6N A;  3JB9 J;  1I4K 1;  5IHN A;  5D6X A;  2DTO A;  2E41 A;  3U23 A;  5DLO A;  1LPL A;  3CC4 A;  2COZ A;  2RM4 A;  3EFO A;  1D1B A;  1Z9Z A;  3M57 A;  3CMA A;  1K4U S;  3PMT A;  3WVE B;  2E5K A;  1VQ7 Q;  1NPR A;  1T3L A;  1AWW A;  3CPF A;  3G6E A;  4LE9 A;  2GBQ A;  2YUP A;  2DRM A;  4MDW A;  3SWN B;  2R58 A;  2FPD A;  1XJW B;  2JXB A;  3QSU A;  2DIL A;  4RTX A;  2E4H A;  3CCE Q;  1RAB B;  5GJW B;  3CXC A;  1BI1 A;  2DPP B;  3M0P A;  2LJ3 A;  1UFF A;  4C5I A;  1K9M C;  3VYG A;  4M78 F;  1X01 A;  2LP5 A;  3L2Z A;  2RK2 A;  5C6S A;  1TUC A;  4HVU A;  1JJ2 S;  1YBY A;  1M2V B;  1BI2 A;  2CT3 A;  2JS2 A;  2RI5 A;  3CCU Q;  1YHQ Q;  2YUQ A;  3A8G B;  1X69 A;  1GFD A;  2F5T X;  2DVJ A;  3CCS T;  2LVM A;  1PD0 A;  4C92 C;  2F2V A;  2P4R A;  3OYC A;  4MZT A;  1TS9 A;  4FYV B;  1YI2 A;  4Z88 A;  2CP0 A;  5FRO A;  5CO7 A;  1IO6 A;  1FYN A;  3RUX A;  1QW1 A;  3CC7 T;  5GAM d;  1IGQ A;  2PUK B;  1C0M A;  1ZSG A;  4M75 F;  2FRW A;  2J7I A;  5GAM h;  1K8A U;  3QWX X;  2LDM A;  1VQ8 Q;  2RQW A;  1NE8 A;  2K9G A;  4IUP A;  1WPY A;  1TOV A;  2CYZ B;  1JJ2 A;  3MO8 A;  4R0K A;  5CQY A;  3M55 A;  1PKT A;  4LDV A;  1VQK Q;  1M2O A;  1MHN A;  2DX1 A;  1UEC A;  3JCM Q;  1WFW A;  3A8L B;  4KH0 B;  3QJY A;  4KGX B;  1N27 A;  1WX6 A;  2K5L A;  2DER A;  3EH2 A;  4ZGD B;  3M9Q A;  2CP6 A;  3EG9 B;  3SHW A;  3OSV A;  3G71 A;  3GNG A;  1CKA A;  1H64 1;  3NMZ C;  4NS5 A;  2ZPE B;  3MET A;  1Q82 C;  1I81 A;  4J9H A;  2QQA A;  2KSS A;  2F2W A;  4OP0 A;  2AZV A;  1ZUU A;  3BDL A;  1X75 C;  1C1A A;  4J9D A;  4M77 B;  2YRD A;  3OW2 A;  3OYA A;  1QWF A;  3L2W A;  3QG1 A;  4K11 A;  5IHK A;  1YIT Q;  2NUT A;  2PUO B;  4HCC A;  2QYZ A;  5D6W A;  1ZSZ C;  1D1A A;  3VS4 A;  2FO0 A;  1OYX A;  4CC4 B;  2M0Y A;  1BI3 A;  3UAT A;  2V1Q A;  3I56 A;  2L3S A;  5ECA A;  4M78 D;  5CVI A;  4BI8 B;  2KGT A;  3BW1 A;  3FB9 A;  3FIF A;  3FJ5 A;  3OYH A;  2KRN A;  2KK4 A;  3I55 T;  3TU4 K;  3QWY A;  2JT4 A;  3PGG A;  1X2Q A;  3SDZ A;  1N5Z A;  1K73 C;  2K4Y A;  4XAX B;  2BZX A;  3P8H A;  2DL8 A;  4YTL A;  1FMV A;  3TCJ A;  3NPF A;  1UDL A;  2HKN A;  2RNA A;  2WSE E;  3MEV A;  3M54 A;  1G5V A;  2DK3 A;  1VQL T;  1YJW A;  2EJF A;  3O5Z A;  4Z8A A;  3EFS A;  1Q7Y U;  3L1A A;  4M75 D;  4FSX A;  1ABQ A;  2DAQ A;  4DBF A;  4PJN A;  4E7L A;  1VQM T;  1MMG A;  1U5S A;  4IUR A;  1PWT A;  2VAS A;  5CKH A;  4B9W A;  3IQL A;  5J39 A;  1SSH A;  1BI0 A;  2DEQ A;  5GAM e;  1FX7 A;  3RMS A;  4R55 A;  1VQ9 T;  2O88 A;  2MK5 A;  3G4S A;  2XHC A;  4J7F A;  2SEM A;  2OTL A;  3E9F A;  1XOV A;  3M59 A;  1VQ4 T;  2QQS A;  1QVF P;  3EG0 A;  1M90 U;  4AG2 C;  4QVD A;  3CCJ Q;  2F5K A;  1VQP Q;  1KIK A;  1UGV A;  3FLG A;  1G3Y A;  2MAM A;  5LJ5 g;  2JVV A;  3CC2 A;  3OY9 A;  2KYM A;  4E7Z A;  5CAI A;  5M9O A;  4M7A B;  1Y71 A;  1OZ2 A;  3S6W A; 
#chains in the Genus database with same CATH homology
 2RI2 A;  3H6Z A;  3X26 B;  1VQP A;  3RES A;  1KC8 U;  3I55 A;  3NTH A;  4J6Y A;  2E6Z A;  3BY7 A;  3LW5 E;  2JUF A;  4C0D C;  5FLX E;  3V7R A;  3AHU A;  4EMK A;  5J3B A;  4DOV A;  2KAF A;  4QW2 A;  2EKO A;  4GY5 A;  4J8O A;  4RG8 A;  3Q1J A;  3CCL T;  3JCM g;  3LWH A;  2WSC E;  1IZ6 A;  2WSF E;  3M5A A;  3SFM A;  3JCM P;  4OB2 B;  3V7S A;  3JCM W;  3M4Y A;  2VXF A;  4F7U F;  3L2U A;  3DLL A;  1HK9 A;  3CCR T;  5I2M A;  5A0D A;  4QQD A;  4C92 A;  2L5Q A;  2LRQ A;  1W2B A;  2E64 A;  3MP1 A;  4M75 E;  3V8K A;  3JRZ A;  3GF5 A;  3HFN A;  3HPW A;  3MEU A;  1YIJ A;  4C0F A;  1Y96 B;  2P4T A;  3KBG A;  3OYB A;  4JJN K;  4KT0 E;  3M4G A;  3CCQ A;  3CXC S;  4XTV A;  3QPH A;  2LT4 A;  3QII A;  3GLX A;  3CCU T;  1YHQ T;  2OTJ T;  4A4H A;  3OQ5 A;  1M9S A;  1VQL A;  4N4I A;  3M58 A;  1ZBX A;  4DA4 A;  2RHY A;  4MZM A;  1Y7X A;  4PJO A;  4FU6 A;  3QZ5 B;  4J7I A;  5GAN j;  1D3B A;  2JTM A;  4A4E A;  3UT1 A;  1BIB A;  4XTU A;  5DM7 R;  3V7C A;  1NJI U;  1LOJ A;  4C8Q E;  2K57 A;  2RB6 A;  3OSS C;  4CI0 C;  2RH2 A;  1VQM A;  1M1K C;  1KQ2 A;  4LDY A;  3OYY A;  4JUV A;  1N6A A;  2CGH A;  3N5B B;  3LX7 A;  4P5N A;  3OYK A;  5GAN e;  4EPC A;  1XTD A;  4LD6 A;  3QDR B;  2NLU A;  2PVD B;  4JLG A;  2L89 A;  1RI0 A;  2EYQ A;  2V8I A;  4FL6 A;  4N4H A;  1OI1 A;  4BDZ A;  3UPU A;  2XI9 A;  2EQU A;  2P0Q A;  3QYH B;  3HRU A;  4F7U A;  1VQ9 A;  2K5F A;  3A5Z B;  1QVG S;  1PSE A;  4C0Z A;  3JCM f;  5GMK j;  2IVW A;  2LCC A;  2XID A;  4HT9 A;  4ZGJ B;  3S3N A;  2ZPH B;  1B34 A;  3C94 A;  1VQ4 A;  1VQ6 T;  2X4W A;  4C5H A;  5HK0 A;  2O01 E;  4EMH A;  1IRE B;  2CZ7 B;  1VQ7 A;  1QVP A;  4HT8 A;  2LC4 A;  2WAC A;  3OYL A;  1VQO T;  5GMK e;  4M77 E;  2O4X A;  1WGS A;  4L6V 5;  2DKG A;  2MMP A;  1YJN T;  1BIA A;  1K73 U;  3HRS A;  1KD1 U;  4Q5W A;  2MF2 A;  2XK0 A;  1EIF A;  3CD6 A;  4RMO A;  3QXE B;  3C4S A;  5LJ3 d;  3OB9 A;  3WVD B;  2D6F A;  1KQ1 A;  3MCA B;  1KQS A;  1WNL A;  1VQK T;  4M7D C;  1UGP B;  2XG8 D;  2Y90 A;  4J83 A;  1VIF A;  1WJQ A;  4M7D G;  2RHI A;  5CKF A;  5IN1 A;  1DJ7 B;  2EQM A;  4HCZ A;  4FIB A;  2XKO C;  4M7D D;  3A8O B;  3SWN A;  2EQK A;  3CCL A;  3QO3 A;  4XU1 A;  4C0G A;  4MDX A;  1S72 A;  3FEO A;  2RHX A;  5LJ3 e;  2KQW A;  3VU3 C;  2GFA A;  2YLB A;  3ASK A;  4BY6 C;  5GMK m;  5LJ5 j;  3CCR A;  3CC4 T;  2HQE A;  4XK8 E;  3JCM V;  4ME7 A;  2M9U A;  3CBO A;  4NOY A;  5GAM j;  4CRI A;  2M0O A;  3DKM A;  3OBY A;  3C12 A;  2QEX T;  2E5Q A;  3ME9 A;  4TVR A;  4X34 A;  2RHU A;  5HK3 A;  3L2Q A;  3CMA T;  2LT1 A;  4M7D B;  4MZP A;  4EDU A;  2E70 A;  4J6W A;  1YHQ A;  4C92 G;  3CCU A;  2G3R A;  4M7A C;  2OTJ A;  3PNW C;  3NFC A;  1MGQ A;  4RG2 A;  3JAM E;  4BE2 A;  3OYN A;  4M7A G;  4O5V A;  5GAN 7;  1O75 A;  4C92 D;  4O6J A;  4ZTJ A;  4M7D E;  3VUB A;  3OMG A;  4NL3 A;  4C92 F;  2FVU A;  3OYJ A;  2KDS A;  4M7A D;  4J5Y A;  2BUD A;  4IUQ A;  4M78 A;  4OB3 B;  2AHJ B;  5LJ3 g;  3G6E T;  3S3M A;  3JCM e;  1ZHI A;  2CZ1 B;  4OB0 B;  4EMK B;  3R6O A;  4XTW A;  4C5G A;  2QA4 T;  3L2V A;  3QHS A;  1NZ9 A;  4PJO G;  5IAY A;  1K8A C;  4IKF A;  2V8J A;  1JB0 E;  5FU6 C;  3QYG B;  1YIT T;  1VQN T;  4HCB A;  4PJO D;  4BAC A;  4FM4 B;  4HA8 A;  2YRV A;  3FDR A;  2K5I A;  4C92 B;  4JRP A;  1JRI A;  4PJO F;  1W4S A;  2RO0 A;  3C95 A;  2VC8 A;  5GAO r;  2VYT A;  5KH6 A;  1M4Z A;  4BI3 A;  1FXX A;  5KE3 A;  1VQ6 A;  3OW2 S;  3ZFJ A;  2XU8 A;  3FJP A;  3QKJ A;  3JB9 G;  4F7U G;  1TH7 A;  4DQ2 A;  1VQO A;  3PIP A;  1M90 C;  3HP9 A;  4BI4 A;  3CCE T;  2VGN A;  3JB9 D;  3EFR A;  2ZPG B;  5HY6 A;  1YJN A;  2QXF A;  1Q82 U;  2QQ9 A;  2RJC A;  4PJO B;  5GAO n;  5CIU A;  1M8V A;  1JBM A;  1D3B B;  2QDY B;  3OS5 A;  2HAX A;  2MI6 A;  3LGF A;  2EJ9 A;  2ZZD A;  2EJG A;  5KCH A;  2R57 A;  1X6O A;  3CBP A;  4N4G A;  3FRN A;  3QZ9 B;  4ZN3 A;  1N8R C;  1VQK A;  5FU6 B;  2E10 A;  3INZ A;  2CS7 A;  1YJ9 T;  5GAN 6;  4JRQ A;  4M75 A;  4PL6 A;  1KC8 C;  1KHC A;  2DTH A;  5LJ3 f;  3S6W A;  2R5A A;  2M16 A;  1PSF A;  4A54 A;  3JB9 J;  1I4K 1;  2LTO A;  4XU0 A;  5D6X A;  4F7U B;  1YI2 T;  4XTZ A;  1M1F A;  2RJE A;  4LDX A;  2DTO A;  3JCM b;  3MP8 A;  2E41 A;  5DLO A;  2LQK A;  3X24 B;  2E12 A;  1B34 B;  3J7A F;  3CC4 A;  1UGQ B;  5I2S A;  3ER0 A;  4WF2 A;  2X35 A;  4EMG A;  5GAN 3;  4M7A E;  2RM4 A;  3TEE A;  3GIB A;  3G7Z A;  2O4X B;  2QEX A;  3M57 A;  3CMA A;  4L59 A;  1M1K U;  2CZ6 B;  3PMT A;  3WVE B;  4GLK A;  3X28 B;  4C8Q A;  2RI3 A;  3M53 A;  4Z02 A;  5L8R E;  4JS5 A;  4A4F A;  3QBY A;  5DLQ E;  1NPR A;  3MHX A;  3KUF A;  2K3Y A;  4R56 A;  5A0G A;  3CPF A;  3G6E A;  3UDC A;  2E1H A;  1YCY A;  3MP6 A;  5GAN h;  2GCX A;  4MDW A;  1M5Q 1;  3PMI A;  3SWN B;  2QA4 A;  1OZ3 A;  2R58 A;  3VV0 A;  2DXB A;  2E65 A;  5I21 A;  2CZ0 B;  2X4J A;  4IUV A;  5CCA A;  1Q81 C;  1VQ8 T;  3CME T;  2VUB A;  5CK9 A;  4MMK A;  1YIT A;  4ATO A;  1VQN A;  4M77 A;  4PLL A;  3QSU A;  3PFS A;  2EFI A;  3CXC A;  1BI1 A;  2DPP B;  1U8R A;  1O9S A;  2FHD A;  2JTF A;  1HXD A;  4C5I A;  1K9M C;  1SSF A;  2D9T A;  2DD4 A;  3HKS A;  3VYG A;  2EIF A;  4M78 F;  4XTX A;  4A4G A;  4BDY A;  4X9C A;  5GMK h;  3BDU A;  5LJ3 j;  1X01 A;  3CCV T;  4FT4 A;  3L2Z A;  3G71 T;  3L2R A;  3BFM A;  1QVF S;  2RK2 A;  4J6X A;  3OS2 A;  4XU3 A;  3LGL A;  5C6S A;  1M1G A;  2IG0 A;  3OS0 A;  3GP8 A;  3CCE A;  5GAM g;  3S3O A;  1YBY A;  1JJ2 S;  1BI2 A;  2Y4X A;  1QP2 A;  5GAN 2;  1KD1 C;  2RI5 A;  4EMK C;  5GAO l;  3A8G B;  4OB1 B;  2E6N A;  3OMC A;  4M78 B;  1YJ9 A;  2F5T X;  2I2L A;  3JB9 H;  2EAY A;  5GAO p;  3PIO A;  3CCS T;  3ZEH A;  2LVM A;  2QQR A;  2CKK A;  2EWN A;  1QVG A;  1R8O B;  4C92 C;  3E9G A;  5KCO A;  4OF1 A;  5IT9 E;  3NTI A;  1I8F A;  3RKY A;  3OYC A;  1Y07 A;  4MZT A;  2ZPB B;  1P92 A;  3HL8 A;  3HFO A;  5LJ5 d;  3OYM A;  1YI2 A;  1I5L A;  4V2S A;  2RHZ A;  4KUI A;  1UGS B;  5KE2 A;  5FRO A;  2JZ2 A;  2GQV A;  5CO7 A;  3RUX A;  1U1T A;  1QW1 A;  2LCL A;  5GAM d;  1Q7Y C;  3CC7 T;  5LJ5 h;  2ZCF B;  4QVC A;  1U1S A;  4D6W A;  2PUK B;  3FC3 A;  2DXU A;  3URG A;  4XQ3 A;  4PJO C;  3HRT A;  3H8Z A;  4M75 F;  5FU7 B;  4Y28 E;  2DIQ A;  2DTI A;  2VV5 A;  5GAM h;  1K8A U;  3RKW A;  2L8D A;  3P8B B;  1V29 B;  3DB4 A;  2M1H A;  5GAN 5;  2DVE A;  2LDM A;  1W2B S;  3I56 T;  4QQG A;  1QVF A;  1G3W A;  2KMT A;  5CQX A;  3JCM X;  1NE8 A;  1XQH A;  4OGC A;  4IUP A;  4HKE A;  1VUB A;  1WPY A;  3JCM h;  4C8Q G;  2CYZ B;  5J26 A;  1JJ2 A;  1WJS A;  4M75 B;  1ZQ1 A;  3MO8 A;  2XD0 A;  2B8A A;  5CQY A;  3M55 A;  3CCM T;  2VXE A;  4LDV A;  3DLM A;  2XIC A;  4X9D A;  1MHN A;  4C8Q D;  3LLR A;  5CKE A;  4C8Q F;  2YLC A;  3CEY A;  3JCM Q;  1VQ8 A;  4XTY A;  3V8L A;  2ZPF B;  3CME A;  3JB9 F;  1Q86 C;  2MWO A;  3J81 E;  3A8L B;  3QJY A;  1N27 A;  4IUU A;  2K5L A;  3PTA A;  2FL7 A;  4ZGD B;  3M9Q A;  3RKX A;  1N8R U;  3OYF A;  3VKI A;  4KUL A;  2K2V A;  3MEW A;  4JLI A;  3OSV A;  4OVA A;  4M77 G;  3CCV A;  1S72 T;  4C8Q B;  3G71 A;  3GNG A;  5A2Q E;  4N0A A;  4RKU E;  1H64 1;  3A8H B;  1KHI A;  4NS5 A;  4M77 D;  5A0L A;  2ZPE B;  2P0P A;  3MET A;  4M77 F;  3SD4 A;  1I81 A;  5GAN 4;  3A8M B;  1Q82 C;  3JCM c;  3X20 B;  1YJW T;  2QQA A;  2KSS A;  3JSC A;  5GMK l;  5CKD A;  4C92 E;  3SWN C;  4E7H A;  5GAO m;  4PLI A;  5DY9 A;  1LJO A;  4OP0 A;  2KY9 A;  2LNV A;  4BE1 A;  2GF7 A;  3TRE A;  2DIG A;  1NPP A;  3O8V A;  3HSB A;  4BD3 A;  4ZN1 A;  3CCS A;  4ZGE B;  4KUD K;  3EAE A;  3BDL A;  1X75 C;  4M7A A;  3RMQ A;  2DO3 A;  1FWZ A;  5FRN A;  4OGE A;  2DXC A;  4M77 B;  1BYM A;  2A7Y A;  4E7J A;  3OW2 A;  1KQS S;  1GXI E;  3OS1 A;  3OYA A;  3L2W A;  2DJZ A;  4PJO E;  2LX9 A;  1N9R A;  5GAN d;  3QG1 A;  1WQ7 A;  3VYH B;  2PUO B;  4C0D B;  4E7K A;  2D0Q B;  3G4S T;  4OMF B;  2QQB A;  4A4K A;  3CC7 A;  2OTL T;  4HCC A;  5D6W A;  4ELZ C;  5LJ5 f;  3GPL A;  2BIV A;  4B9X A;  3VJP A;  2HNI A;  3RIR A;  2EQJ A;  2JNG A;  4BE0 A;  1NJI C;  2FB7 A;  1OYX A;  3QJ6 A;  2PVG B;  2XDB A;  3CPW S;  1BI3 A;  4M78 C;  4FT2 A;  2R5M A;  3WXM B;  4DOW A;  5GAM f;  3KXT A;  1Y96 A;  1Q81 U;  2QTX A;  4F7U E;  5GMK i;  4M78 G;  4VUB A;  4PKC C;  3I56 A;  1VQ5 T;  3LWI A;  1UGR B;  4JRI A;  3CC2 T;  5EG2 A;  3OBW A;  2BKD N;  2JN0 A;  4M78 D;  5CVI A;  4Y91 A;  3OYD A;  4BI8 B;  4C5E A;  3OA6 A;  3BW1 A;  4IUT A;  2GFU A;  3FB9 A;  1K9M U;  1KG1 A;  3FIF A;  3CCM A;  3CCJ T;  3NTK A;  2HQX A;  5CR2 A;  3OYH A;  4E47 A;  2RK1 A;  5HKC A;  1VQP T;  5LL6 S;  2KK4 A;  4BB7 A;  4L5G A;  3I55 T;  3TU4 K;  1N9S A;  3PGG A;  4RCB A;  3SDZ A;  5GAO q;  2HBP A;  2RJD A;  2YHT A;  3X25 B;  1UB4 A;  4BUG A;  3LH0 A;  1K73 C;  2QI2 A;  2K4Y A;  4XAX B;  2H3J A;  5FU7 C;  3VUZ A;  3PT9 A;  2P0K A;  3LYI A;  3GOX A;  5GAN g;  2ZGW A;  3JB9 I;  3P8H A;  3P8D A;  1XNI A;  2RA2 A;  2Y4Y A;  2DZC A;  4YTL A;  4JS4 A;  3T9N A;  4LDU A;  3TCJ A;  1YIJ T;  2V8K A;  4ELY C;  3V8J A;  5LJ3 h;  3CCQ T;  2C06 A;  2DD5 A;  2WSE E;  3OYG A;  3MEV A;  3L42 A;  3M54 A;  4M75 C;  1G5V A;  1BKB A;  1LNX A;  2DK3 A;  4N0A C;  4RCC A;  4LDW A;  5CKB A;  5C0M A;  4ZTF A;  1YJW A;  1VQL T;  4M7D F;  2EJF A;  4M75 G;  3CPW A;  3RER A;  4KBM B;  3EFS A;  1Q7Y U;  3L1A A;  4M75 D;  3ZBD A;  2XDP A;  3E1S A;  2DXT A;  2F69 A;  3CBM A;  4FSX A;  2PQW A;  4PNO A;  1G3T A;  1UEB A;  2X4Y A;  2DAQ A;  4E7L A;  5LJ5 e;  3MEA A;  4E7I A;  1VQM T;  4IUR A;  5CKH A;  4B9W A;  2K3X A;  2PU9 B;  3JCM d;  5J39 A;  4NL2 A;  2KVQ G;  2A3L A;  1BI0 A;  2DEQ A;  4C8Q C;  4XU2 A;  1FX7 A;  4JDS A;  4QQ6 A;  3RMS A;  3UWN A;  5GAM e;  4R55 A;  3J80 E;  2LQ8 A;  1VQ9 T;  3G4S A;  2XHC A;  4J7F A;  4M78 E;  2HD0 A;  4II1 A;  2JOY A;  3E9F A;  3JCM J;  2OTL A;  4UC4 A;  3GNF B;  1WJR A;  2RJF A;  4A53 A;  2PVO B;  1XOV A;  1VIE A;  3M59 A;  5GAN f;  1VQ4 T;  2QQS A;  4BY6 B;  4LD9 K;  4M7A F;  4MML A;  1H3Z A;  3DB3 A;  3F70 A;  1M90 U;  1VQ7 T;  4QVD A;  2XDD A;  2RD1 A;  2F5K A;  2VGM A;  1QP3 A;  2L3R A;  3E19 A;  3OYE A;  1RL2 A;  3SB2 A;  4JRK A;  3HHT B;  5D6Y A;  5GAN 8;  1Q86 U;  1VQ5 A;  2OAU A;  2MWP A;  3FLG A;  4M7D A;  1G3Y A;  2MAM A;  2X4X A;  3M56 A;  5LJ5 g;  2JVV A;  4QVZ A;  3OYI A;  3CC2 A;  5FRM A;  1AHJ B;  1WQW A;  3CD6 T;  2DZ9 A;  5AYF A;  3OY9 A;  2ZPI B;  4M77 C;  5CAI A;  3QUI A;  5M9O A;  4M7A B;  1G3S A;  3CCJ A;  1Y71 A;  1OZ2 A;  2FYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...