1KG1A

Nmr structure of the nip1 elicitor protein from rhynchosporium secalis
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
60
structure length
60
Chain Sequence
b'DRCRYTLCCDGALKAVSACLHESESCLVPGDCCRGKSRLTLCSYGEGGNGFQCPTGYRQC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Necrosis Inducing Protein 1
molecule tags Toxin
source organism Rhynchosporium secalis
publication title Solution Structure of the Plant Disease Resistance-triggering Protein NIP1 from the Fungus Rhynchosporium secalis Shows a Novel beta-Sheet Fold.
pubmed doi rcsb
total genus 4
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2001-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.460 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1kg1A02
1KG1A
chains in the Genus database with same CATH superfamily
4Z02A 2ROTA 2MYSA 3CXCA 1DJ7B 2A0FB 4FL6A 3VYHB 5AYFA 4EMKB 4PLLA 3UDCA 2YDLA 1QP3A 4C92C 3A98A 4C92F 4HA8A 1VQ8A 3FDRA 3H0IA 2OTLQ 3S3OA 1FXXA 2K5IA 3E9GA 2DK3A 2J6FA 3NMZC 4C8QD 2ATCB 1M1KU 2YRDA 1QVGP 1KC8U 2V26A 2KSSA 4L5GA 3FIFA 1PWTA 2CP6A 2CYZB 2AT1B 5GAOl 3GP8A 2VXEA 2L2PA 3CCST 4TVRA 2ABLA 3CBOA 5GAOr 2JZ2A 2R58A 1YNZA 3ULRB 3RESA 1VQKA 3WVDB 4JS4A 1KQ1A 5GAN5 2DXUA 2KXDA 1NJIR 3QG1A 3CC4T 1KC8R 3CC2Q 1QW1A 4LUEA 4HT9A 3M0TA 4PJOC 4FSXA 3X26B 5LJ3d 4M78E 1JRIA 1ZA2B 3TREA 3LH5A 4EMHA 2FZCB 4KBMB 3I55A 2LT4A 5EG2A 1W6XA 1ZX6A 1M1KR 1G3SA 3G71A 2HZYA 1KHCA 2OAWA 4V2SA 3OSVA 3RNJA 1JJ2S 3CCRA 2CSQA 4M77G 1VQKQ 3OW2P 1VQ6Q 3OYDA 2RJEA 2E3IA 3ZBDA 1VQOT 1V1CA 2NLUA 2KMTA 5IHKA 2D0NA 2EKHA 4J9BA 3OYGA 2QDLA 2L3SA 3HRUA 4N0AA 2FPFA 2P0QA 4FYWB 4A54A 5L23A 4AFSC 2XKOC 4KGZB 3HP9A 2BZ8A 2RI5A 1TXQA 4HVWA 2YLCA 4LDWA 1UGRB 4C8QB 1M2VA 3X20B 1OU8A 1N5ZA 3RKYA 4CC4B 1D1AA 1G2BA 1MMAA 4KH1B 1Y7XA 1U06A 1UHCA 2DZ9A 2JS0A 3GLXA 3LH0A 5GAOn 3CD6Q 1K8AC 1TOVA 3FB9A 1TS9A 3G1JA 2RQRA 2HKQB 4C5GA 2P0KA 4QVDA 1HSQA 2HEQA 1M1FA 2L8DA 3I5SA 1FX7A 1WDXA 2XICA 1IXDA 3VV0A 2QQ9A 5L8RE 4M75F 1IHVA 1WXBA 2PUKB 3EG3A 2O9VA 1VIEA 2PTKA 4FU6A 1AZEA 3G4SA 4KT0E 2GTOA 2RQUA 4M7DD 1H3HA 3OQ5A 2LJ3A 3SWNC 3URGA 1WLPB 1IZ6A 1OULA 1AWWA 3C4SA 4DBRA 3X25B 2VXFA 2C0TA 2FHDA 4N4IA 1NLPC 2GQVA 1M2VB 5IH2A 4F7UE 2D8JA 1WQ7A 2COZA 2QA4A 1T0HA 4ZN3A 2KAFA 1UDLA 3HHTB 1M1KC 3KFVA 4D6WA 2JTFA 3JCMc 2LQ8A 4OMNA 9ATCB 3CPWS 4RG2A 1WJSA 2AZVA 2LNVA 2QI2A 3REAB 1PD0A 2J06A 2V8KA 5CCAA 1ACMB 1BU1A 1G3YA 1JQQA 3MEVA 2K9GA 2MWPA 3CC2T 2OTJT 3QXEB 1OPLA 2PNIA 2HQXA 4C92E 2AK5A 5FW9A 1YCYA 1NLOC 1RAEB 1X69A 4OMFB 3OS0A 1JJ2P 2X4YA 4MDXA 3SWNA 3MP6A 1JXMA 4HVVA 2LCCA 2EGAA 2KQWA 3OYAA 4PJNA 4J7FA 1XJWB 3H6ZA 4RTVA 2CUDA 2HDAA 1XQHA 4XU2A 1YJWQ 4RTYA 3C0CA 2Y4YA 1HD3A 3UA7A 2FPEA 1M8MA 2V8IA 1V76A 2W0ZA 1OEBA 4XTYA 5J3BA 2YHTA 4JJCA 1WQWA 3ASKA 4XU3A 2QTVA 2P84A 3TCJA 4PJJA 4XTXA 2OAUA 3CPWA 2CZ0B 3HRSA 4CC3A 1YJ9A 3OY9A 3HFOA 3THKA 4OB2B 2AKKA 5KYWA 1R77A 5GAN3 3SHWA 2H3EB 2VWFA 4J9EA 1RI9A 4X34A 2GFUA 1JO8A 3BFMA 1RLQC 4XK8E 1WGSA 2F1LA 2HCKA 1SG5A 1YWOA 2KYMA 1JU5C 1Q81U 3NTIA 1UGSB 2M1HA 1M90U 1VYUA 4FT2A 4KGVB 1X27A 4LDUA 2EQKA 2DXCA 2NUTA 2DXBA 3FEOA 1ZSZC 3MP8A 5KYUB 3CC4A 4JPBW 4DEXA 3X28B 2EW3A 5GAMj 1B7TA 3OYJA 1ZSGA 2KROA 4A4GA 4QQDA 4R55A 1VQLQ 2LCLA 2AKLA 1UJYA 1M2OA 3J80E 2QEXT 3I5RA 3NHNA 3VS3A 2KT8A 2A36A 4NOYA 4FW2A 5GAMf 3CCRQ 3X24B 2QGFB 2EAYA 2F5TX 2VYTA 1QVPA 2QGGA 3GNFB 2EGCA 3EG9B 3EH1A 2RHZA 1Q7YU 1I8FA 2EQJA 2DYBA 3GOXA 2DJQA 2QXFA 5C6SA 4E47A 2NUPB 2RHIA 4C0ZA 2EKOA 4PJOF 5J26A 4JLGA 3CCEQ 4F17A 3L1AA 2E64A 5A0GA 3JCMf 2JT4A 2M0OA 4M7AC 3CC2A 4KRTA 1BI1A 3OYNA 2GBQA 2DLPA 2K57A 1NPRA 2LMJA 3FC3A 4RTTA 1ZSZB 1M3CA 2CGHA 2YLBA 1OU9A 4PFZA 1IO6A 2ZCFB 5CVIA 1W2BS 3S3MA 1WXUA 4FW1A 1HJDA 1S72A 1M3BA 2VVKA 2OJ2A 1H92A 2O2OA 5FU7B 1Q86C 3PGGA 2KEAA 3CCUQ 1G3TA 3HTRA 2XIDA 1MHNA 4M7DB 3QYHB 1X6OA 2FRYA 5ECAA 2MI6A 4R56A 3DB3A 2HQEA 3L2ZA 4J83A 2QAZA 1G5VA 4GLMA 1M8VA 2RI2A 4ATOA 1VQ7T 1WHHA 2YT6A 2DPPB 3JCMJ 2X4WA 1YI2T 1EX4A 4BE1A 3GBQA 4M7AA 1TG0A 4DBFA 4E7ZA 5KYUA 3OYCA 4JS5A 2E6NA 2RF0A 3JV3A 4M77E 1RUWA 1QP2A 4M78A 4F7UB 5LJ3f 1NEGA 4HXJA 2DRKA 1NE8A 2R5AA 1BCMA 2DVEA 1KHIA 1I1JA 2CUBA 2J6KA 4BY6B 5FRNA 2AZSA 3BDLA 4Y28E 4BACA 3VUBA 1VQ5T 2NYSA 1TUCA 1UTIA 1YHQQ 4LDVA 1M9SA 2DO3A 4C5HA 1QWFA 5GAMh 2VC8A 2KVQG 4X9DA 3G71T 4EMKC 1Y57A 3S6WA 1VQMT 3REBB 2DNUA 2DBMA 2KK4A 4C92B 2E65A 3A8OB 4PFOA 1MMNA 3A1PA 3M5AA 4P5NA 4E7LA 2MK5A 2EGEA 1M90C 1YJWT 2EYWA 2X4JA 4AFUC 2PZ1A 2NWMA 2M9UA 3JRZA 4C8QG 3CCLT 4M75D 3JB9I 2QEXQ 3J81E 1VQNQ 2DIQA 2HAXA 4DQ2A 2EQMA 1OI1A 1BB9A 1M30A 2MMPA 2Y90A 1WJQA 5GAN6 5FRMA 1IB8A 4EPCA 1W4SA 4J6WA 4MZPA 4PJOD 3SWNB 4KH0B 1I0CA 5J39A 3CCVA 1PRLC 2M0YA 5GANj 1FMVA 1B34A 1BCOA 4XU0A 2XI9A 4M77C 4M7AE 2X4XA 5GMKi 4CRIA 5I2SA 1C0MA 3H0FA 2WSCE 5CQXA 4BE2A 1M1GA 3M0SA 3RBBB 2DEQA 5A0LA 5CAIA 2LNHB 3M54A 4VUBA 5GAOq 1S72Q 5D7UA 3CPWP 1LCKA 3V8KA 3ZEHA 1W70A 3OMCA 3V7SA 5GAMg 2VKNA 3CCVT 2RD1A 4C92D 2JMAA 4DA4A 4HKEA 1UUEA 1PRMC 2EJGA 3KXTA 3UWNA 4F16A 2LDMA 2QTXA 4M7AG 4FM4B 1ZA1B 1SRMA 1K9MR 1R8OB 1G83A 1R0CB 2K2VA 2P4RA 2YRVA 2DTHA 1X2KA 2DRMA 5GAMe 2HBWA 2EIFA 4ZGDB 1MGQA 2RMOA 2C06A 1Q95G 3EG0A 1ZBJA 5D6XA 1PM3A 2CZ1B 4OB3B 3BDUA 3EGXB 2KGTA 3VS6A 3TEEA 2IPOB 2JS2A 5HCKA 1VQLA 2X35A 1VIFA 1K0SA 2X3WD 2HNIA 2RJCA 5KYYA 3CCQA 1R0BG 1O75A 3P8HA 3M58A 1WX6A 4HCKA 5GANg 1I5OB 3MKDA 2DL7A 2V1QA 5GAOm 4BD3A 4QQ6A 1RAIB 3CC7T 1O9SA 4O5VA 2D8HA 2EYYA 2GTJA 2CZ7B 2VUBA 1ABQA 1TUGB 1AWJA 4OF1A 1EZZB 1OPKA 1K8AU 2VGMA 2DAQA 4JRQA 1RAAB 3E19A 2DVJA 2KYBA 5FU6B 3CCRT 1P92A 3LGLA 2L3RA 5LJ3g 2XDDA 5IHNA 4PJOA 1Q7YR 1K1ZA 1WHGA 1VYTA 1BI0A 4K11A 2FZGB 2LQNA 2E70A 3ZFJA 3QJ6A 1Y96A 1UFFA 1D0YA 1HXDA 4J6XA 1EIFA 1SSFA 2PVOB 1PHTA 1VQ7A 4HCCA 3E1SA 2LP5A 4D8KA 2MOXA 2EJFA 2K3YA 2L3QA 2C0IA 2DF6A 1NEBA 3AT1B 4XTUA 3OYMA 3I9QA 3OSSC 4M78D 1WJRA 1BIAA 3DLMA 2XDPA 5LL6S 5CK9A 3CMET 1QCNA 4M7AB 2O9SA 2HSEB 1VQPT 2HD0A 2RHUA 3CCJT 5CKFA 1JBMA 1GCQC 2DXTA 3OS5A 4N4HA 2JOYA 2XDBA 1N27A 4NS5A 3G6EA 5CKDA 1M3AA 5C0MA 2O31A 1YITA 3HRTA 3PE0A 3UT1A 3JB9F 3T9NA 1YN8A 5FU7C 1N6AA 2ZPBB 5LJ3h 3JCMP 3FRNA 3V8LA 1G8XA 1N8RR 1KG1A 3OB9A 3OYKA 2DX1A 2QA4Q 3PMIA 4LE9A 3M59A 3O8VA 4A4KA 2A08A 2JM9A 2LZ6B 1TTHB 3H9NA 3F70A 3CBPA 3JCMQ 2Y4XA 3I56T 5GMKh 2CT4A 3EGDB 4PJLA 1QCOA 4DOVA 1CKBA 1VQMA 4J9HA 2JUFA 3CCET 4CC7A 1H3ZA 3META 2MAMA 4OGCA 1BBZA 2DTIA 1MV3A 2DMOA 1RADB 1OZ3A 1IRXA 4QVCA 2L5QA 1LOJA 3M0UA 4XTWA 4NL3A 5CKBA 3LX7A 1KIKA 1TUDA 3RUXA 5A2QE 4QT7A 2WSFE 1GFCA 1M4ZA 4IKFA 4CI0C 3P8DA 1FYNA 4UC4A 1Y0MA 3I55T 1LJOA 2DTOA 1YBYA 1B07A 1BI3A 2ZPFB 2EPDA 2KBTA 2JTEA 1JEGA 1WPYA 2HQHA 1Q81C 2E5QA 2RHYA 2IG0A 2A37A 2ESWA 3SFMA 4AFZC 3M55A 1CSKA 4BDZA 3QZ9B 2DM1A 3A8GB 2XK0A 4DEYA 3LLRA 4N0AC 4M75C 1KK7A 1GFDA 2E6ZA 3PMTA 1KQSP 1X6BA 2PVGB 1AVZC 2KE9A 1AHJB 1TH7A 3OYFA 1MNDA 1K9MC 5LJ5f 2CH4W 5LJ5h 4Y92A 2YRCA 5GMKl 4J8OA 4C8QC 1S72T 1TU0B 4A4EA 2YSQA 4FYYB 3D7SB 1Q7YC 2VASA 4JRKA 4E7HA 2LVMA 4L59A 3G71Q 4WTOB 3J7AF 2OTJA 3HKSA 2O4XA 1FMWA 2RNAA 3M4YA 3G6ET 4MMKA 4BB7A 1N9SA 4RTZA 2K7AA 2H3JA 3VS7A 3JCMh 1K73C 4ME7A 4B6MA 4M75B 3MCAB 4RTUA 4JRIA 2V1RA 3SEMA 5HK0A 5HKCA 3CBMA 3WVEB 2Z0WA 1OZ2A 5D6WA 1WHMA 1LNXA 3RKWA 2QEXA 1W1FA 3PTAA 2EQUA 1RLPC 4Z8AA 2QA4T 2CP3A 4EMGA 4JJBA 2JW4A 1WZOA 4RMOA 3JB9D 3JCMb 1JB0E 4RG8A 2QK0A 4JJNK 1ZUYA 4MZTA 4BY6C 3CQTA 4D8DA 1FMKA 3CCJA 3PVLA 4E7KA 1VA7A 4J6YA 2CH4A 2OTLA 2DZCA 1K73R 1VQ8Q 3CCSA 3G4ST 3OW2A 2LX7A 1SEMA 3QPHA 2YUPA 2MIOA 4N4GA 5KYNA 2CDTA 3L2UA 3CMAA 4AT1B 4DBHA 4JZ4A 1VQ5A 2I2LA 2FPDA 2RH2A 3PFSA 3NFCA 1Q82R 1PNJA 7AT1B 2E1HA 2F69A 3LWIA 3EG9A 1UGQB 2FRWA 4RCCA 2WSEE 3IQLA 1ZUKA 3EFOB 1K9AA 2BUDA 3QWXX 2EJ9A 4XTZA 4F14A 2K4YA 2VB6A 1AEYA 1QMCA 2ZPGB 1QVGS 1UHFA 1YFNA 4OMLA 5LJ5d 3S3NA 2M02A 4B9XA 1OX8A 1OYXA 1T3SA 4ELYC 3RKXA 4QKUA 2RB6A 3LWHA 4C92G 1NPPA 2XG8D 3R6OA 5I21A 1WYXA 2K3BA 2RHXA 1PSFA 3UPUA 4OB1B 1AT1B 4PKCC 5I22A 2XHCA 4X1VA 2NUTB 3A8HB 4HVUA 4KUIA 2DA9A 2AHJB 4M77B 4Y91A 3CCUA 4IIOA 2EWNA 1NZ9A 3QUIA 3EHQA 2DIGA 2B8AA 2M16A 3QBYA 2YWWA 2JM8A 3ZL7C 1YJNQ 1K4US 2FVUA 3CCQT 1D0XA 4LNPA 4MZMA 3NTKA 1UE9A 1WXTA 1QVFP 2MF2A 2DERA 4KUDK 5IAYA 3U23A 3MEWA 4F04B 3CCEA 4WCIA 3RDVA 4M77A 3EFRA 4BI3A 2FB7A 2X3XD 1GRIA 2JXBA 3GNGA 2O88A 2DBKA 1MUZA 1SHGA 4KULA 2O4XB 2HMAA 3JB9H 3I35A 1A0NB 3MP1A 4ZGJB 1U1SA 1WA7A 2CS7A 2PQWA 3OS2A 5CIUA 1VQKT 1SF9A 1E7OA 2K3XA 3VJPA 4XU1A 2L89A 4M77F 1GXIE 4J9CA 5GAN8 2SRCA 1VUBA 5DLQE 2A7YA 3OBYA 4F7UF 2LRQA 5CR2A 2G6FX 3CXCP 4J9DA 4ZTJA 3EG2A 2CP5A 2KI7A 3OYIA 1QLYA 3QKJA 1SPKA 1T0JA 1VQ4Q 3UA6A 1HYOA 3GF5A 5HK3A 1T3LA 1Q82U 3OBWA 1OX9A 2KT1A 3TVTA 1QKWA 5A0DA 4PJOB 4PL6A 1YJ9T 3BW1A 3JCMd 1VQ8T 4FIBA 2RN8A 5GAOp 5GAN2 1W2BP 1UG1A 2BTTA 2FEIA 2BZYA 1D09B 3HL8A 1H641 4GY5A 1UB4A 3VYGA 2ED0A 1BI2A 3OYYA 4GBQA 2KDSA 2KRNA 5KYXB 1KQSA 2QYZA 1Q81R 4M78G 4JRPA 2COYA 1SKUB 1Z9QA 3JCMg 3UF4A 1VQ4A 2QQRA 2ZPIB 4OMMA 3VRYA 1QKXA 5LJ3e 2CREA 2EYQA 2DL8A 2D0QB 2EYXA 3KBGA 1WFWA 3EFSA 1VYVA 1MV0B 3QSUA 1N9RA 5GANe 1PG5B 4XTVA 1X6GA 4M7DC 1X01A 4C5IA 3JB9J 2DYIA 3JCMX 2J7IA 4AG2C 3EGDA 4M75E 1SSHA 4ORZA 3I56Q 3M0PA 3OYEA 4ANJA 1UEBA 1I4K1 2DILA 4HCZA 2LTOA 5GJWB 2D6FA 5LJ5e 4MDWA 4PFPA 4L6V5 1K76A 1XTDA 2K2MA 1NJIC 1YITQ 3QWYA 4BE0A 2DEUA 6AT1B 3QHSA 3JAME 3M0RA 2DL3A 3G6EQ 1RACB 2DD4A 2HBPA 2OX7A 3V8JA 2ECZA 4OMQA 3R6NA 1YJNA 2YUOA 4M75A 5GMKj 5GMKe 1QWEA 3CD6T 2RJDA 2BE9B 4IUTA 3JCMe 1WHKA 3VKIA 3VU3C 2JNGA 2LC4A 4A63B 2K5LA 3SD4A 4IUQA 5KE3A 1VQ4T 2KNBB 4LD6A 1B3QA 3NGPA 1PKTA 3QJYA 5GAN7 1YI2A 3TQ7P 2OI3A 3MJXA 1CKAA 3TSZA 2LX9A 1VQ7Q 3KUFA 3L2WA 1RAHB 2COWA 5FWCA 1V29B 1B34B 2D9TA 1XOVA 4OMOA 2K79A 5IT9E 4M77D 2QG9B 2JJ9A 2RI3A 4LN2A 3M53A 3FLGA 1WIEA 2DD5A 4YTLA 4NL2A 4IURA 4C8QE 3INZA 2FO0A 1M5Q1 2F2XA 4BDYA 2XU8A 3RERA 1VQ5Q 3OS1A 3DLLA 1U1TA 1IHWA 2RPNA 3CMAQ 3CD6A 5D6YA 1OOTA 5GMKm 2J6OA 1KD1R 4LD9K 3HFNA 2LJ1A 3CCSQ 3JSCA 2BKDN 4AMCA 4ELZC 3QIIA 4LDXA 3CMEQ 1IREB 1KQSS 4JJDA 4C92A 4EDUA 3MO8A 1D3BB 2NUPA 3CCJQ 3CC7A 2MPXC 3QYGB 1NG2A 4E7SA 2P0PA 4II1A 2BIVA 3EH2A 2E4HA 3LGFA 1SRLA 2BE7D 2DKGA 1QQJA 1I5LA 1TSFA 4IUPA 1WHJA 2FZKB 5KH6A 3C95A 1F1BB 1E6GA 2DJZA 2AIRB 4OP0A 1U5SA 1D1CA 2ZPHB 3M9QA 1JJ2A 4FT4A 5LJ5j 1PSEA 3HPWA 4M78B 4F7UA 1VQ9A 1C1AA 5IXFA 1VQ6A 1UECA 1C6VX 2J05A 4ESRA 1NBEB 1VQ6T 3PT9A 3EG1A 1GL5A 4J9GA 3H41A 4ZN1A 1G3WA 2VV5A 2JN0A 1AOJA 5HY6A 4A53A 3CEYA 8ATCB 4M7DG 2OTJQ 2QDYB 1J3TA 4PJOG 5DY9A 3I55Q 4E7IA 5GJVB 5FLXE 4RKUE 4E2FB 2ZZDA 3AHUA 2L3PA 3FJ5A 2GNCA 1UGPB 3JCMW 4F7UG 3EGUA 3QZ5B 1BYMA 4LUDA 4KGXB 1NJIU 1K9MU 4C8QA 2IVWA 3VRZA 4J7IA 4J9IA 2E12A 2M51A 4JUVA 1ZSZA 1E6HA 2BZXA 1M90R 1S1NA 3CCMT 1LVKA 5EC7A 1JXOA 4M7AF 1UGVA 3H8ZA 4PLIA 3LYIA 5LJ3j 1WHLA 1ZUUA 4QVZA 4A4HA 2OTLT 2E5KA 3L2VA 3MPUB 3BE3A 4PJMA 3OYBA 4O6JA 5FU6C 2LQKA 3CCVQ 2B86A 1TWBA 2EFIA 3EFOA 4AG1C 3L2QA 4C0DC 1K73U 1ZBXA 1PD1A 3CMAT 2LCSA 2ZGWA 1NYGA 1YCSB 4OVAA 2JTMA 1VQ9Q 2K6DA 4M78F 5KYYB 2QQSA 1VQNA 5KCOA 3V7RA 1QCFA 1YITT 1K0XA 4XAXB 2QQAA 1VQPQ 3OW2S 1QVFA 3PVQA 1SHFA 3VS1A 2PVDB 1AWOA 2DE0X 1YHQT 2DFUA 2VGNA 3CC7Q 2W10A 3QDFA 2RQVA 4IUUA 3UATA 2RQTA 1YIJT 3CMEA 2EVRA 4E7JA 1VQMQ 3N5BB 2XMFA 3BY7A 2QASA 1X43A 3Q1JA 4RCBA 1H8KA 2ENMA 2YUNA 3A8MB 5IN1A 2EYZA 4OMPA 2F5KA 5CO7A 1GCQA 5FROA 5KE2A 2LT1A 3MEAA 1EFNA 3DB4A 4C8QF 1KFZA 2PU9B 2GFAA 5CQYA 4RTWA 3CCLA 1U3OA 5KYWB 5M9OA 2HL3A 3LW5E 4X9CA 5GANh 4HT8A 2SEMA 4R0KA 2F2WA 2QQBA 2FL7A 2YXYA 2A3LA 2D1XA 2O01E 1YI2Q 4FSSA 4A4FA 1ZHIA 5CKHA 1KSWA 2HL5C 2ED1A 1I81A 3MEUA 1RABB 2JMCA 3GIBA 3SDZA 1W2BA 4JZ3A 1ZLMA 4M7DA 3M57A 3QO3A 3CCUT 3MHXA 4E6RA 3A8LB 1N8RU 3RMQA 2RK1A 1YP5A 1QVGA 1WNLA 2DL4A 2E3HA 2EQIA 4DBQA 5KYXA 4AFQC 1Y96B 1D3BA 2V8JA 4ZTFA 2RK2A 2YUQA 3L42A 5CKEA 3OA6A 2GCXA 4M7AD 2DETA 2GF7A 3JB9G 2EBPA 1KD1U 2IIMA 3CCMQ 3VS4A 2E10A 4C0GA 2F2VA 1KJWA 4OB0B 2XD0A 1VQOA 4XQ3A 4M4ZA 4GLKA 2GQIA 3E2UA 3L2RA 3M0QA 3HSBA 3I56A 3DKMA 4RTXA 3NTHA 3GPLA 2CT3A 3QDRB 4QQGA 5GAMd 4CC2A 4BI8B 2KRSA 4PNOA 1AWXA 4J9FA 1GBQA 1VQNT 4LXCA 4WF2A 1NM7A 1X2QA 1YIJA 1PC0A 1VQ9T 1RI0A 3RIRA 1HK9A 1D1BA 1X75C 5IHIA 3V7CA 2MWOA 3SB2A 3CCQQ 4EMKA 3OYHA 2ROLA 3OMGA 2R57A 3G7ZA 2HKNA 3EGXA 5AT1B 3CC4Q 5KCHA 2PUOB 1Q82C 8AT1B 4B9WA 1AZGB 1K8AR 5GANd 3PIPA 1WI7A 4FCYA 1PCXA 3P8BB 3JCMV 1YIJQ 2NUZA 2X51A 4BUGA 1IGQA 4IUVA 3C94A 2HSPA 1NYFA 4OGEA 2WACA 3TU4K 1MNEA 1BKBA 4M7DF 1RAGB 5IXBA 4DOWA 2DL5A 2JVVA 1Q86R 1KC8C 1VOMA 1VQOQ 3H0HA 1OV3A 3RMSA 1RL2A 4C5EA 3CCMA 2LQWA 5I2MA 1YJ9Q 2CP0A 1ARKA 1Y07A 2KXCA 4M7DE 1I07A 1OQKA 1RAFB 4M78C 4C0FA 1KQ2A 4Z88A 4PJOE 4M75G 3OYLA 4JLIA 3M56A 3VS2A 2RJFA 2ZPEB 2I0NA 1ABOA 1M27C 1ZQ1A 4BI4A 3TSWA 1YJWA 4QW2A 1GBRA 1Q86U 3EAEA 1Z9ZA 3PIOA 1AD5A 2A28A 1LPLA 4FYXB 3VS0A 5GAN4 5DM7R 3VUZA 5FWBA 4J5YA 4IIMA 4RUGA 3WXMB 4PK4A 1Y71A 1D0ZA 4Q5WA 2RA2A 5LJ5g 2L0AA 4MMLA 1U8RA 2FG0A 3O5ZA 1N8RC 1MMDA 1PKSA 2CP2A 3CPFA 2FYKA 1VQLT 2E41A 4Z89A 3CCLQ 3VS5A 3FJPA 1GCPA 3CXCS 1BK2A 2X9HA 1KD1C 3NPFA 1XNIA 4LDYA 3M4GA 4FYVB 1FWZA 4JDSA 3C12A 3PNWC 1YJNT 1IGUA 2RO0A 4EIKA 3A5ZB 1MMGA 5GANf 2CKKA 2G3RA 2ZAEA 2CZ6B 4C0DB 2MCNA 3G4SQ 1UJ0A 2H8HA 2RM4A 1YHQA 1YWPA 2K5FA 3RR6A 4HCBA 2CP7A 3E9FA 1BIBA 5DLOA 1QVFS 1VQPA 4ZGEB 2R5MA 2KRMA 2KY9A 5I11A 3ER0A 4ZNXA 2KR3A 2LJ0A 2CSIA 2C0OA 2GGRA 2RQWA 3EHRA 2P4TA 3ME9A
chains in the Genus database with same CATH topology
4Z02A 2E6NA 4MMKA 1G3WA 2VV5A 1N9SA 4M77E 4BB7A 2JN0A 4ZN1A 3CXCA 1QP2A 5HY6A 1DJ7B 3CEYA 4A53A 2H3JA 4M78A 5LJ3f 4F7UB 4M7DG 3JCMh 2QDYB 4FL6A 3VYHB 5AYFA 1NE8A 4EMKB 1K73C 2R5AA 4PLLA 4ME7A 3UDCA 2DVEA 4M75B 1KHIA 3MCAB 5DY9A 4JRIA 4PJOG 4E7IA 5HK0A 4BY6B 1QP3A 4C92C 5HKCA 4C92F 4HA8A 1VQ8A 3CBMA 5FRNA 3BDLA 3FDRA 4Y28E 3WVEB 4BACA 3VUBA 5FLXE 1VQ5T 1OZ2A 4RKUE 2ZZDA 5D6WA 1LNXA 3RKWA 3AHUA 2QEXA 3S3OA 1FXXA 4LDVA 1M9SA 2DO3A 2K5IA 2EQUA 3PTAA 3E9GA 2DK3A 4C5HA 2QA4T 1UGPB 5GAMh 3JCMW 4EMGA 4F7UG 2VC8A 2KVQG 4X9DA 3QZ5B 4RMOA 4EMKC 3G71T 3JB9D 4C8QD 1NJIU 1M1KU 1BYMA 3S6WA 3JCMb 1JB0E 1K9MU 1KC8U 4C8QA 2IVWA 4RG8A 1VQMT 2KK4A 4JJNK 2KSSA 4MZTA 2E65A 4BY6C 4L5GA 4C92B 3A8OB 3FIFA 2CYZB 4J7IA 3CCJA 2E12A 5GAOl 3M5AA 4JUVA 4P5NA 4E7KA 3GP8A 2VXEA 4E7LA 3CCST 4J6YA 2OTLA 4TVRA 1M90C 3CBOA 1YJWT 5GAOr 2DZCA 2X4JA 4ATOA 3CCMT 2JZ2A 2R58A 3CCSA 3G4ST 4M7AF 3OW2A 3H8ZA 2M9UA 3JRZA 3QPHA 3RESA 4PLIA 3LYIA 4C8QG 5LJ3j 1VQKA 4N4GA 3WVDB 3CCLT 1KQ1A 5GAN5 2DXUA 4M75D 3L2UA 4JS4A 3QG1A 3CMAA 3JB9I 3CC4T 4QVZA 3J81E 1QW1A 4A4HA 4HT9A 4PJOC 2DIQA 2HAXA 2OTLT 4FSXA 3L2VA 1VQ5A 3X26B 5LJ3d 2I2LA 2RH2A 4M78E 4DQ2A 1JRIA 3PFSA 3TREA 2EQMA 4O6JA 3NFCA 1OI1A 5FU6C 4KBMB 4EMHA 3I55A 2LQKA 2LT4A 2E1HA 2F69A 3LWIA 2MMPA 2Y90A 2EFIA 1WJQA 5GAN6 5FRMA 5EG2A 3L2QA 4C0DC 4EPCA 1K73U 1ZBXA 1G3SA 1W4SA 1UGQB 4J6WA 4MZPA 3G71A 3CMAT 3SWNB 4PJOD 5J39A 1KHCA 2ZGWA 3CCVA 4OVAA 2JTMA 4RCCA 5GANj 2WSEE 4V2SA 1B34A 4M78F 3OSVA 1JJ2S 2QQSA 2BUDA 4XTZA 2EJ9A 3CCRA 1VQNA 2K4YA 4XU0A 5KCOA 2XI9A 4M77C 4M77G 2ZPGB 2X4XA 3V7RA 5GMKi 4CRIA 5I2SA 1QVGS 1YITT 4M7AE 2WSCE 5CQXA 3OYDA 4XAXB 2RJEA 2QQAA 4BE2A 1M1GA 5LJ5d 3ZBDA 3S3NA 1VQOT 4B9XA 2NLUA 2DEQA 1OYXA 4ELYC 3RKXA 5A0LA 3OW2S 2KMTA 2RB6A 3LWHA 4C92G 1QVFA 3OYGA 1NPPA 2XG8D 2PVDB 1YHQT 3R6OA 5CAIA 5I21A 4VUBA 3M54A 5GAOq 2RHXA 2VGNA 1PSFA 3HRUA 4N0AA 2P0QA 4A54A 3UPUA 4OB1B 2XKOC 4PKCC 4IUUA 2XHCA 3A8HB 4KUIA 4M77B 2AHJB 3HP9A 1YIJT 2RI5A 3CMEA 4Y91A 3CCUA 4LDWA 2YLCA 3N5BB 4E7JA 3V8KA 2EWNA 3ZEHA 1NZ9A 3BY7A 1UGRB 3Q1JA 4C8QB 3OMCA 3V7SA 5GAMg 4RCBA 3QUIA 3X20B 3CCVT 2RD1A 4C92D 3A8MB 5IN1A 3RKYA 2DIGA 3G6ET 2B8AA 4DA4A 2M16A 3QBYA 4HKEA 2F5KA 1Y7XA 2EJGA 5CO7A 2FVUA 3CCQT 3KXTA 2DZ9A 5FROA 3UWNA 4MZMA 5KE2A 3NTKA 3GLXA 2LDMA 2LT1A 2QTXA 3LH0A 3MEAA 4M7AG 4FM4B 5GAOn 1K8AC 2MF2A 3DB4A 3FB9A 4C8QF 2PU9B 2GFAA 5CQYA 1R8OB 2K2VA 1QVFS 2YRVA 3CCLA 2DTHA 5M9OA 4KUDK 5IAYA 5GAMe 3MEWA 3LW5E 2EIFA 4X9CA 4ZGDB 5GANh 3CCEA 4HT8A 1MGQA 4M77A 4C5GA 2C06A 3EFRA 2P0KA 4BI3A 2FB7A 4QVDA 1M1FA 5D6XA 2L8DA 2QQBA 2FL7A 3GNGA 2CZ1B 4OB3B 2A3LA 4KULA 2O4XB 1FX7A 3BDUA 2O01E 3JB9H 2XICA 3VV0A 2QQ9A 3MP1A 4ZGJB 1U1SA 5L8RE 3TEEA 4M75F 4A4FA 2CS7A 1ZHIA 2PQWA 3OS2A 5CKHA 2PUKB 5CIUA 1VQKT 1VQLA 1VIEA 4FU6A 1I81A 2K3XA 2X35A 3MEUA 1VIFA 4XU1A 3VJPA 2L89A 3G4SA 4M77F 3GIBA 1GXIE 4KT0E 5GAN8 1VUBA 2HNIA 3SDZA 5DLQE 1W2BA 2A7YA 2RJCA 3CCQA 4M7DD 3OBYA 1O75A 4F7UF 2LRQA 3OQ5A 3P8HA 5CR2A 3SWNC 3URGA 4M7DA 3M57A 1IZ6A 3M58A 3QO3A 5GANg 3CCUT 4ZTJA 5GAOm 3C4SA 3MHXA 3OYIA 3X25B 4BD3A 3A8LB 4QQ6A 3RMQA 1N8RU 3CC7T 2VXFA 2RK1A 3QKJA 1O9SA 2FHDA 4O5VA 1QVGA 1WNLA 4N4IA 2CZ7B 2VUBA 1Y96B 2GQVA 1D3BA 2V8JA 4F7UE 4ZTFA 2RK2A 3GF5A 1WQ7A 5CKEA 3L42A 5HK3A 3OA6A 2QA4A 4OF1A 2GCXA 1Q82U 4ZN3A 4M7AD 2KAFA 3OBWA 2GF7A 1K8AU 2VGMA 3HHTB 3JB9G 1KD1U 1M1KC 2DAQA 5A0DA 4JRQA 4PJOB 3E19A 4D6WA 4PL6A 2JTFA 3JCMc 2LQ8A 3CPWS 3BW1A 3JCMd 1YJ9T 1VQ8T 4RG2A 1WJSA 5FU6B 2E10A 2LNVA 4FIBA 3CCRT 2QI2A 1P92A 4C0GA 3LGLA 2L3RA 5GAOp 2V8KA 5CCAA 2XD0A 4OB0B 5GAN2 1VQOA 1G3YA 5LJ3g 3MEVA 2XDDA 4PJOA 4XQ3A 2MWPA 3CC2T 2OTJT 4GLKA 3HL8A 1H641 4GY5A 1UB4A 1BI0A 3QXEB 3VYGA 3L2RA 1BI2A 3OYYA 3HSBA 3I56A 2E70A 3DKMA 2KDSA 3ZFJA 3NTHA 1Y96A 2HQXA 3QJ6A 3GPLA 4C92E 3QDRB 4QQGA 5GAMd 1YCYA 1KQSA 4BI8B 4PNOA 4M78G 4JRPA 1HXDA 4J6XA 1VQNT 4OMFB 1EIFA 3OS0A 4WF2A 1SSFA 2X4YA 3JCMg 2PVOB 3SWNA 1YIJA 4MDXA 1VQ9T 1VQ4A 3MP6A 2QQRA 1VQ7A 1RI0A 2LCCA 2KQWA 3OYAA 4HCCA 3E1SA 2ZPIB 4J7FA 3RIRA 1HK9A 1X75C 5LJ3e 3H6ZA 2EYQA 2EJFA 3V7CA 1XQHA 2D0QB 2K3YA 4XU2A 2MWOA 3KBGA 3EFSA 3SB2A 2Y4YA 4EMKA 3OYHA 3OMGA 2R57A 3QSUA 4XTUA 1N9RA 5GANe 3OYMA 3G7ZA 3OSSC 4M78D 2V8IA 4XTVA 4M7DC 1X01A 1WJRA 4XTYA 4C5IA 1BIAA 3DLMA 2XDPA 5J3BA 5KCHA 2YHTA 5LL6S 3JB9J 1WQWA 3ASKA 5CK9A 2PUOB 4XU3A 3JCMX 3CMET 1Q82C 4M7AB 3TCJA 1VQPT 4B9WA 4XTXA 2HD0A 2OAUA 5GANd 2RHUA 4M75E 3PIPA 3CPWA 3CCJT 2CZ0B 5CKFA 1JBMA 3HRSA 3P8BB 3OYEA 3JCMV 1YJ9A 3OY9A 4BUGA 2DXTA 3HFOA 4OB2B 4IUVA 3OS5A 1UEBA 1I4K1 4N4HA 2JOYA 4HCZA 1N27A 2LTOA 3C94A 2XDBA 4NS5A 5LJ5e 5CKDA 4MDWA 3G6EA 2D6FA 5C0MA 4OGEA 5GAN3 4L6V5 2WACA 3TU4K 1YITA 3HRTA 1BKBA 3UT1A 4M7DF 4X34A 3JB9F 2GFUA 1XTDA 3T9NA 4DOWA 3BFMA 2JVVA 5FU7C 1NJIC 4BE0A 3QHSA 1N6AA 2ZPBB 4XK8E 1WGSA 5LJ3h 3JAME 1KC8C 3JCMP 3FRNA 3V8LA 1KG1A 3OB9A 3OYKA 2DD4A 2HBPA 3V8JA 3PMIA 3RMSA 1Q81U 1RL2A 3M59A 4C5EA 1YJNA 3O8VA 4A4KA 3NTIA 3CCMA 4M75A 1UGSB 2M1HA 5I2MA 5GMKj 5GMKe 1M90U 4FT2A 4LDUA 1Y07A 4M7DE 3CD6T 2EQKA 2DXCA 2DXBA 2RJDA 3CBPA 3F70A 2Y4XA 4M78C 4C0FA 4IUTA 5GMKh 3JCMQ 3I56T 1KQ2A 3JCMe 3FEOA 4DOVA 3VKIA 1VQMA 3MP8A 4M75G 4PJOE 3VU3C 3CC4A 2JUFA 3X28B 3OYLA 3CCET 4JLIA 2JNGA 3M56A 5GAMj 2LC4A 2K5LA 3META 3SD4A 3OYJA 1H3ZA 2MAMA 2RJFA 2ZPEB 4OGCA 4QQDA 4IUQA 4A4GA 4R55A 2LCLA 5KE3A 1VQ4T 2DTIA 1ZQ1A 4LD6A 4BI4A 1YJWA 3J80E 2QEXT 1OZ3A 4QW2A 4QVCA 2L5QA 3QJYA 5GAN7 1Q86U 1LOJA 3EAEA 1YI2A 4XTWA 4NL3A 5CKBA 3LX7A 3PIOA 2LX9A 4NOYA 3KUFA 3RUXA 3L2WA 5GAN4 5A2QE 5DM7R 2WSFE 3VUZA 1M4ZA 1V29B 5GAMf 4IKFA 1B34B 2D9TA 4CI0C 3P8DA 1XOVA 4J5YA 3X24B 1VQ9A 2VYTA 2EAYA 2F5TX 1QVPA 4UC4A 5IT9E 3WXMB 3GNFB 1LJOA 4M77D 3I55T 2RHZA 1Y71A 1Q7YU 2DTOA 2RI3A 4Q5WA 1I8FA 1YBYA 2RA2A 3M53A 3FLGA 2EQJA 5LJ5g 4MMLA 3GOXA 1BI3A 2QXFA 2ZPFB 5C6SA 1U8RA 2DD5A 4YTLA 4E47A 4NL2A 2RHIA 4IURA 2EKOA 3INZA 4PJOF 4C0ZA 4C8QE 1N8RC 1M5Q1 1WPYA 4BDYA 5J26A 4JLGA 3CPFA 1Q81C 2XU8A 2E5QA 2RHYA 2FYKA 1VQLT 3RERA 3L1AA 2E41A 2E64A 5A0GA 2IG0A 3JCMf 3OS1A 3SFMA 3OYBA 3DLLA 1U1TA 2M0OA 3M55A 3CC2A 4M7AC 4BDZA 1BI1A 3FJPA 3QZ9B 3OYNA 1VQ7T 3A8GB 3CD6A 5D6YA 2K57A 3CXCS 1NPRA 1KD1C 5GMKm 2XK0A 3LLRA 3FC3A 1XNIA 4LDYA 4LD9K 3HFNA 4N0AC 3JSCA 4M75C 2BKDN 4ELZC 2CGHA 3QIIA 4LDXA 2YLBA 3M4GA 2E6ZA 1FWZA 1IREB 1KQSS 2ZCFB 5CVIA 4C92A 4EDUA 3S3MA 3PMTA 1W2BS 4JDSA 3C12A 3PNWC 3MO8A 1YJNT 2PVGB 1S72A 1D3BB 2RO0A 3CC7A 3A5ZB 3QYGB 5GANf 2P0PA 1AHJB 5FU7B 2CKKA 2G3RA 4II1A 1Q86C 3PGGA 1TH7A 2CZ6B 2BIVA 3OYFA 3LGFA 1G3TA 4C0DB 2DKGA 1K9MC 5LJ5f 2XIDA 1MHNA 1I5LA 4M7DB 3QYHB 5LJ5h 1X6OA 4IUPA 5GMKl 2MI6A 4J8OA 4C8QC 5KH6A 1S72T 4R56A 3DB3A 3C95A 2HQEA 2RM4A 1YHQA 2K5FA 2DJZA 3L2ZA 4A4EA 4OP0A 4HCBA 4J83A 3M9QA 2ZPHB 1JJ2A 1G5VA 3E9FA 1M8VA 1Q7YC 4FT4A 2RI2A 1BIBA 4JRKA 5DLOA 1PSEA 3HPWA 4M78B 4F7UA 2LVMA 5LJ5j 2DPPB 4ZGEB 4E7HA 3JCMJ 1VQPA 2R5MA 4L59A 2X4WA 1VQ6A 1YI2T 2KY9A 3J7AF 2OTJA 3ER0A 3HKSA 2O4XA 4BE1A 1VQ6T 3PT9A 4M7AA 2P4TA 3M4YA 3OYCA 3ME9A 4JS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KG1 A; 
#chains in the Genus database with same CATH topology
 4Z02 A;  2ROT A;  2MYS A;  3CXC A;  1DJ7 B;  2A0F B;  4FL6 A;  3VYH B;  5AYF A;  4EMK B;  4PLL A;  3UDC A;  2YDL A;  1QP3 A;  4C92 C;  3A98 A;  4C92 F;  4HA8 A;  1VQ8 A;  3FDR A;  3H0I A;  2OTL Q;  3S3O A;  1FXX A;  2K5I A;  3E9G A;  2DK3 A;  2J6F A;  3NMZ C;  4C8Q D;  2ATC B;  1M1K U;  2YRD A;  1QVG P;  1KC8 U;  2V26 A;  2KSS A;  4L5G A;  3FIF A;  1PWT A;  2CP6 A;  2CYZ B;  2AT1 B;  5GAO l;  3GP8 A;  2VXE A;  2L2P A;  3CCS T;  4TVR A;  2ABL A;  3CBO A;  5GAO r;  2JZ2 A;  2R58 A;  1YNZ A;  3ULR B;  3RES A;  1VQK A;  3WVD B;  4JS4 A;  1KQ1 A;  5GAN 5;  2DXU A;  2KXD A;  1NJI R;  3QG1 A;  3CC4 T;  1KC8 R;  3CC2 Q;  1QW1 A;  4LUE A;  4HT9 A;  3M0T A;  4PJO C;  4FSX A;  3X26 B;  5LJ3 d;  4M78 E;  1JRI A;  1ZA2 B;  3TRE A;  3LH5 A;  4EMH A;  2FZC B;  4KBM B;  3I55 A;  2LT4 A;  5EG2 A;  1W6X A;  1ZX6 A;  1M1K R;  1G3S A;  3G71 A;  2HZY A;  1KHC A;  2OAW A;  4V2S A;  3OSV A;  3RNJ A;  1JJ2 S;  3CCR A;  2CSQ A;  4M77 G;  1VQK Q;  3OW2 P;  1VQ6 Q;  3OYD A;  2RJE A;  2E3I A;  3ZBD A;  1VQO T;  1V1C A;  2NLU A;  2KMT A;  5IHK A;  2D0N A;  2EKH A;  4J9B A;  3OYG A;  2QDL A;  2L3S A;  3HRU A;  4N0A A;  2FPF A;  2P0Q A;  4FYW B;  4A54 A;  5L23 A;  4AFS C;  2XKO C;  4KGZ B;  3HP9 A;  2BZ8 A;  2RI5 A;  1TXQ A;  4HVW A;  2YLC A;  4LDW A;  1UGR B;  4C8Q B;  1M2V A;  3X20 B;  1OU8 A;  1N5Z A;  3RKY A;  4CC4 B;  1D1A A;  1G2B A;  1MMA A;  4KH1 B;  1Y7X A;  1U06 A;  1UHC A;  2DZ9 A;  2JS0 A;  3GLX A;  3LH0 A;  5GAO n;  3CD6 Q;  1K8A C;  1TOV A;  3FB9 A;  1TS9 A;  3G1J A;  2RQR A;  2HKQ B;  4C5G A;  2P0K A;  4QVD A;  1HSQ A;  2HEQ A;  1M1F A;  2L8D A;  3I5S A;  1FX7 A;  1WDX A;  2XIC A;  1IXD A;  3VV0 A;  2QQ9 A;  5L8R E;  4M75 F;  1IHV A;  1WXB A;  2PUK B;  3EG3 A;  2O9V A;  1VIE A;  2PTK A;  4FU6 A;  1AZE A;  3G4S A;  4KT0 E;  2GTO A;  2RQU A;  4M7D D;  1H3H A;  3OQ5 A;  2LJ3 A;  3SWN C;  3URG A;  1WLP B;  1IZ6 A;  1OUL A;  1AWW A;  3C4S A;  4DBR A;  3X25 B;  2VXF A;  2C0T A;  2FHD A;  4N4I A;  1NLP C;  2GQV A;  1M2V B;  5IH2 A;  4F7U E;  2D8J A;  1WQ7 A;  2COZ A;  2QA4 A;  1T0H A;  4ZN3 A;  2KAF A;  1UDL A;  3HHT B;  1M1K C;  3KFV A;  4D6W A;  2JTF A;  3JCM c;  2LQ8 A;  4OMN A;  9ATC B;  3CPW S;  4RG2 A;  1WJS A;  2AZV A;  2LNV A;  2QI2 A;  3REA B;  1PD0 A;  2J06 A;  2V8K A;  5CCA A;  1ACM B;  1BU1 A;  1G3Y A;  1JQQ A;  3MEV A;  2K9G A;  2MWP A;  3CC2 T;  2OTJ T;  3QXE B;  1OPL A;  2PNI A;  2HQX A;  4C92 E;  2AK5 A;  5FW9 A;  1YCY A;  1NLO C;  1RAE B;  1X69 A;  4OMF B;  3OS0 A;  1JJ2 P;  2X4Y A;  4MDX A;  3SWN A;  3MP6 A;  1JXM A;  4HVV A;  2LCC A;  2EGA A;  2KQW A;  3OYA A;  4PJN A;  4J7F A;  1XJW B;  3H6Z A;  4RTV A;  2CUD A;  2HDA A;  1XQH A;  4XU2 A;  1YJW Q;  4RTY A;  3C0C A;  2Y4Y A;  1HD3 A;  3UA7 A;  2FPE A;  1M8M A;  2V8I A;  1V76 A;  2W0Z A;  1OEB A;  4XTY A;  5J3B A;  2YHT A;  4JJC A;  1WQW A;  3ASK A;  4XU3 A;  2QTV A;  2P84 A;  3TCJ A;  4PJJ A;  4XTX A;  2OAU A;  3CPW A;  2CZ0 B;  3HRS A;  4CC3 A;  1YJ9 A;  3OY9 A;  3HFO A;  3THK A;  4OB2 B;  2AKK A;  5KYW A;  1R77 A;  5GAN 3;  3SHW A;  2H3E B;  2VWF A;  4J9E A;  1RI9 A;  4X34 A;  2GFU A;  1JO8 A;  3BFM A;  1RLQ C;  4XK8 E;  1WGS A;  2F1L A;  2HCK A;  1SG5 A;  1YWO A;  2KYM A;  1JU5 C;  1Q81 U;  3NTI A;  1UGS B;  2M1H A;  1M90 U;  1VYU A;  4FT2 A;  4KGV B;  1X27 A;  4LDU A;  2EQK A;  2DXC A;  2NUT A;  2DXB A;  3FEO A;  1ZSZ C;  3MP8 A;  5KYU B;  3CC4 A;  4JPB W;  4DEX A;  3X28 B;  2EW3 A;  5GAM j;  1B7T A;  3OYJ A;  1ZSG A;  2KRO A;  4A4G A;  4QQD A;  4R55 A;  1VQL Q;  2LCL A;  2AKL A;  1UJY A;  1M2O A;  3J80 E;  2QEX T;  3I5R A;  3NHN A;  3VS3 A;  2KT8 A;  2A36 A;  4NOY A;  4FW2 A;  5GAM f;  3CCR Q;  3X24 B;  2QGF B;  2EAY A;  2F5T X;  2VYT A;  1QVP A;  2QGG A;  3GNF B;  2EGC A;  3EG9 B;  3EH1 A;  2RHZ A;  1Q7Y U;  1I8F A;  2EQJ A;  2DYB A;  3GOX A;  2DJQ A;  2QXF A;  5C6S A;  4E47 A;  2NUP B;  2RHI A;  4C0Z A;  2EKO A;  4PJO F;  5J26 A;  4JLG A;  3CCE Q;  4F17 A;  3L1A A;  2E64 A;  5A0G A;  3JCM f;  2JT4 A;  2M0O A;  4M7A C;  3CC2 A;  4KRT A;  1BI1 A;  3OYN A;  2GBQ A;  2DLP A;  2K57 A;  1NPR A;  2LMJ A;  3FC3 A;  4RTT A;  1ZSZ B;  1M3C A;  2CGH A;  2YLB A;  1OU9 A;  4PFZ A;  1IO6 A;  2ZCF B;  5CVI A;  1W2B S;  3S3M A;  1WXU A;  4FW1 A;  1HJD A;  1S72 A;  1M3B A;  2VVK A;  2OJ2 A;  1H92 A;  2O2O A;  5FU7 B;  1Q86 C;  3PGG A;  2KEA A;  3CCU Q;  1G3T A;  3HTR A;  2XID A;  1MHN A;  4M7D B;  3QYH B;  1X6O A;  2FRY A;  5ECA A;  2MI6 A;  4R56 A;  3DB3 A;  2HQE A;  3L2Z A;  4J83 A;  2QAZ A;  1G5V A;  4GLM A;  1M8V A;  2RI2 A;  4ATO A;  1VQ7 T;  1WHH A;  2YT6 A;  2DPP B;  3JCM J;  2X4W A;  1YI2 T;  1EX4 A;  4BE1 A;  3GBQ A;  4M7A A;  1TG0 A;  4DBF A;  4E7Z A;  5KYU A;  3OYC A;  4JS5 A;  2E6N A;  2RF0 A;  3JV3 A;  4M77 E;  1RUW A;  1QP2 A;  4M78 A;  4F7U B;  5LJ3 f;  1NEG A;  4HXJ A;  2DRK A;  1NE8 A;  2R5A A;  1BCM A;  2DVE A;  1KHI A;  1I1J A;  2CUB A;  2J6K A;  4BY6 B;  5FRN A;  2AZS A;  3BDL A;  4Y28 E;  4BAC A;  3VUB A;  1VQ5 T;  2NYS A;  1TUC A;  1UTI A;  1YHQ Q;  4LDV A;  1M9S A;  2DO3 A;  4C5H A;  1QWF A;  5GAM h;  2VC8 A;  2KVQ G;  4X9D A;  3G71 T;  4EMK C;  1Y57 A;  3S6W A;  1VQM T;  3REB B;  2DNU A;  2DBM A;  2KK4 A;  4C92 B;  2E65 A;  3A8O B;  4PFO A;  1MMN A;  3A1P A;  3M5A A;  4P5N A;  4E7L A;  2MK5 A;  2EGE A;  1M90 C;  1YJW T;  2EYW A;  2X4J A;  4AFU C;  2PZ1 A;  2NWM A;  2M9U A;  3JRZ A;  4C8Q G;  3CCL T;  4M75 D;  3JB9 I;  2QEX Q;  3J81 E;  1VQN Q;  2DIQ A;  2HAX A;  4DQ2 A;  2EQM A;  1OI1 A;  1BB9 A;  1M30 A;  2MMP A;  2Y90 A;  1WJQ A;  5GAN 6;  5FRM A;  1IB8 A;  4EPC A;  1W4S A;  4J6W A;  4MZP A;  4PJO D;  3SWN B;  4KH0 B;  1I0C A;  5J39 A;  3CCV A;  1PRL C;  2M0Y A;  5GAN j;  1FMV A;  1B34 A;  1BCO A;  4XU0 A;  2XI9 A;  4M77 C;  4M7A E;  2X4X A;  5GMK i;  4CRI A;  5I2S A;  1C0M A;  3H0F A;  2WSC E;  5CQX A;  4BE2 A;  1M1G A;  3M0S A;  3RBB B;  2DEQ A;  5A0L A;  5CAI A;  2LNH B;  3M54 A;  4VUB A;  5GAO q;  1S72 Q;  5D7U A;  3CPW P;  1LCK A;  3V8K A;  3ZEH A;  1W70 A;  3OMC A;  3V7S A;  5GAM g;  2VKN A;  3CCV T;  2RD1 A;  4C92 D;  2JMA A;  4DA4 A;  4HKE A;  1UUE A;  1PRM C;  2EJG A;  3KXT A;  3UWN A;  4F16 A;  2LDM A;  2QTX A;  4M7A G;  4FM4 B;  1ZA1 B;  1SRM A;  1K9M R;  1R8O B;  1G83 A;  1R0C B;  2K2V A;  2P4R A;  2YRV A;  2DTH A;  1X2K A;  2DRM A;  5GAM e;  2HBW A;  2EIF A;  4ZGD B;  1MGQ A;  2RMO A;  2C06 A;  1Q95 G;  3EG0 A;  1ZBJ A;  5D6X A;  1PM3 A;  2CZ1 B;  4OB3 B;  3BDU A;  3EGX B;  2KGT A;  3VS6 A;  3TEE A;  2IPO B;  2JS2 A;  5HCK A;  1VQL A;  2X35 A;  1VIF A;  1K0S A;  2X3W D;  2HNI A;  2RJC A;  5KYY A;  3CCQ A;  1R0B G;  1O75 A;  3P8H A;  3M58 A;  1WX6 A;  4HCK A;  5GAN g;  1I5O B;  3MKD A;  2DL7 A;  2V1Q A;  5GAO m;  4BD3 A;  4QQ6 A;  1RAI B;  3CC7 T;  1O9S A;  4O5V A;  2D8H A;  2EYY A;  2GTJ A;  2CZ7 B;  2VUB A;  1ABQ A;  1TUG B;  1AWJ A;  4OF1 A;  1EZZ B;  1OPK A;  1K8A U;  2VGM A;  2DAQ A;  4JRQ A;  1RAA B;  3E19 A;  2DVJ A;  2KYB A;  5FU6 B;  3CCR T;  1P92 A;  3LGL A;  2L3R A;  5LJ3 g;  2XDD A;  5IHN A;  4PJO A;  1Q7Y R;  1K1Z A;  1WHG A;  1VYT A;  1BI0 A;  4K11 A;  2FZG B;  2LQN A;  2E70 A;  3ZFJ A;  3QJ6 A;  1Y96 A;  1UFF A;  1D0Y A;  1HXD A;  4J6X A;  1EIF A;  1SSF A;  2PVO B;  1PHT A;  1VQ7 A;  4HCC A;  3E1S A;  2LP5 A;  4D8K A;  2MOX A;  2EJF A;  2K3Y A;  2L3Q A;  2C0I A;  2DF6 A;  1NEB A;  3AT1 B;  4XTU A;  3OYM A;  3I9Q A;  3OSS C;  4M78 D;  1WJR A;  1BIA A;  3DLM A;  2XDP A;  5LL6 S;  5CK9 A;  3CME T;  1QCN A;  4M7A B;  2O9S A;  2HSE B;  1VQP T;  2HD0 A;  2RHU A;  3CCJ T;  5CKF A;  1JBM A;  1GCQ C;  2DXT A;  3OS5 A;  4N4H A;  2JOY A;  2XDB A;  1N27 A;  4NS5 A;  3G6E A;  5CKD A;  1M3A A;  5C0M A;  2O31 A;  1YIT A;  3HRT A;  3PE0 A;  3UT1 A;  3JB9 F;  3T9N A;  1YN8 A;  5FU7 C;  1N6A A;  2ZPB B;  5LJ3 h;  3JCM P;  3FRN A;  3V8L A;  1G8X A;  1N8R R;  1KG1 A;  3OB9 A;  3OYK A;  2DX1 A;  2QA4 Q;  3PMI A;  4LE9 A;  3M59 A;  3O8V A;  4A4K A;  2A08 A;  2JM9 A;  2LZ6 B;  1TTH B;  3H9N A;  3F70 A;  3CBP A;  3JCM Q;  2Y4X A;  3I56 T;  5GMK h;  2CT4 A;  3EGD B;  4PJL A;  1QCO A;  4DOV A;  1CKB A;  1VQM A;  4J9H A;  2JUF A;  3CCE T;  4CC7 A;  1H3Z A;  3MET A;  2MAM A;  4OGC A;  1BBZ A;  2DTI A;  1MV3 A;  2DMO A;  1RAD B;  1OZ3 A;  1IRX A;  4QVC A;  2L5Q A;  1LOJ A;  3M0U A;  4XTW A;  4NL3 A;  5CKB A;  3LX7 A;  1KIK A;  1TUD A;  3RUX A;  5A2Q E;  4QT7 A;  2WSF E;  1GFC A;  1M4Z A;  4IKF A;  4CI0 C;  3P8D A;  1FYN A;  4UC4 A;  1Y0M A;  3I55 T;  1LJO A;  2DTO A;  1YBY A;  1B07 A;  1BI3 A;  2ZPF B;  2EPD A;  2KBT A;  2JTE A;  1JEG A;  1WPY A;  2HQH A;  1Q81 C;  2E5Q A;  2RHY A;  2IG0 A;  2A37 A;  2ESW A;  3SFM A;  4AFZ C;  3M55 A;  1CSK A;  4BDZ A;  3QZ9 B;  2DM1 A;  3A8G B;  2XK0 A;  4DEY A;  3LLR A;  4N0A C;  4M75 C;  1KK7 A;  1GFD A;  2E6Z A;  3PMT A;  1KQS P;  1X6B A;  2PVG B;  1AVZ C;  2KE9 A;  1AHJ B;  1TH7 A;  3OYF A;  1MND A;  1K9M C;  5LJ5 f;  2CH4 W;  5LJ5 h;  4Y92 A;  2YRC A;  5GMK l;  4J8O A;  4C8Q C;  1S72 T;  1TU0 B;  4A4E A;  2YSQ A;  4FYY B;  3D7S B;  1Q7Y C;  2VAS A;  4JRK A;  4E7H A;  2LVM A;  4L59 A;  3G71 Q;  4WTO B;  3J7A F;  2OTJ A;  3HKS A;  2O4X A;  1FMW A;  2RNA A;  3M4Y A;  3G6E T;  4MMK A;  4BB7 A;  1N9S A;  4RTZ A;  2K7A A;  2H3J A;  3VS7 A;  3JCM h;  1K73 C;  4ME7 A;  4B6M A;  4M75 B;  3MCA B;  4RTU A;  4JRI A;  2V1R A;  3SEM A;  5HK0 A;  5HKC A;  3CBM A;  3WVE B;  2Z0W A;  1OZ2 A;  5D6W A;  1WHM A;  1LNX A;  3RKW A;  2QEX A;  1W1F A;  3PTA A;  2EQU A;  1RLP C;  4Z8A A;  2QA4 T;  2CP3 A;  4EMG A;  4JJB A;  2JW4 A;  1WZO A;  4RMO A;  3JB9 D;  3JCM b;  1JB0 E;  4RG8 A;  2QK0 A;  4JJN K;  1ZUY A;  4MZT A;  4BY6 C;  3CQT A;  4D8D A;  1FMK A;  3CCJ A;  3PVL A;  4E7K A;  1VA7 A;  4J6Y A;  2CH4 A;  2OTL A;  2DZC A;  1K73 R;  1VQ8 Q;  3CCS A;  3G4S T;  3OW2 A;  2LX7 A;  1SEM A;  3QPH A;  2YUP A;  2MIO A;  4N4G A;  5KYN A;  2CDT A;  3L2U A;  3CMA A;  4AT1 B;  4DBH A;  4JZ4 A;  1VQ5 A;  2I2L A;  2FPD A;  2RH2 A;  3PFS A;  3NFC A;  1Q82 R;  1PNJ A;  7AT1 B;  2E1H A;  2F69 A;  3LWI A;  3EG9 A;  1UGQ B;  2FRW A;  4RCC A;  2WSE E;  3IQL A;  1ZUK A;  3EFO B;  1K9A A;  2BUD A;  3QWX X;  2EJ9 A;  4XTZ A;  4F14 A;  2K4Y A;  2VB6 A;  1AEY A;  1QMC A;  2ZPG B;  1QVG S;  1UHF A;  1YFN A;  4OML A;  5LJ5 d;  3S3N A;  2M02 A;  4B9X A;  1OX8 A;  1OYX A;  1T3S A;  4ELY C;  3RKX A;  4QKU A;  2RB6 A;  3LWH A;  4C92 G;  1NPP A;  2XG8 D;  3R6O A;  5I21 A;  1WYX A;  2K3B A;  2RHX A;  1PSF A;  3UPU A;  4OB1 B;  1AT1 B;  4PKC C;  5I22 A;  2XHC A;  4X1V A;  2NUT B;  3A8H B;  4HVU A;  4KUI A;  2DA9 A;  2AHJ B;  4M77 B;  4Y91 A;  3CCU A;  4IIO A;  2EWN A;  1NZ9 A;  3QUI A;  3EHQ A;  2DIG A;  2B8A A;  2M16 A;  3QBY A;  2YWW A;  2JM8 A;  3ZL7 C;  1YJN Q;  1K4U S;  2FVU A;  3CCQ T;  1D0X A;  4LNP A;  4MZM A;  3NTK A;  1UE9 A;  1WXT A;  1QVF P;  2MF2 A;  2DER A;  4KUD K;  5IAY A;  3U23 A;  3MEW A;  4F04 B;  3CCE A;  4WCI A;  3RDV A;  4M77 A;  3EFR A;  4BI3 A;  2FB7 A;  2X3X D;  1GRI A;  2JXB A;  3GNG A;  2O88 A;  2DBK A;  1MUZ A;  1SHG A;  4KUL A;  2O4X B;  2HMA A;  3JB9 H;  3I35 A;  1A0N B;  3MP1 A;  4ZGJ B;  1U1S A;  1WA7 A;  2CS7 A;  2PQW A;  3OS2 A;  5CIU A;  1VQK T;  1SF9 A;  1E7O A;  2K3X A;  3VJP A;  4XU1 A;  2L89 A;  4M77 F;  1GXI E;  4J9C A;  5GAN 8;  2SRC A;  1VUB A;  5DLQ E;  2A7Y A;  3OBY A;  4F7U F;  2LRQ A;  5CR2 A;  2G6F X;  3CXC P;  4J9D A;  4ZTJ A;  3EG2 A;  2CP5 A;  2KI7 A;  3OYI A;  1QLY A;  3QKJ A;  1SPK A;  1T0J A;  1VQ4 Q;  3UA6 A;  1HYO A;  3GF5 A;  5HK3 A;  1T3L A;  1Q82 U;  3OBW A;  1OX9 A;  2KT1 A;  3TVT A;  1QKW A;  5A0D A;  4PJO B;  4PL6 A;  1YJ9 T;  3BW1 A;  3JCM d;  1VQ8 T;  4FIB A;  2RN8 A;  5GAO p;  5GAN 2;  1W2B P;  1UG1 A;  2BTT A;  2FEI A;  2BZY A;  1D09 B;  3HL8 A;  1H64 1;  4GY5 A;  1UB4 A;  3VYG A;  2ED0 A;  1BI2 A;  3OYY A;  4GBQ A;  2KDS A;  2KRN A;  5KYX B;  1KQS A;  2QYZ A;  1Q81 R;  4M78 G;  4JRP A;  2COY A;  1SKU B;  1Z9Q A;  3JCM g;  3UF4 A;  1VQ4 A;  2QQR A;  2ZPI B;  4OMM A;  3VRY A;  1QKX A;  5LJ3 e;  2CRE A;  2EYQ A;  2DL8 A;  2D0Q B;  2EYX A;  3KBG A;  1WFW A;  3EFS A;  1VYV A;  1MV0 B;  3QSU A;  1N9R A;  5GAN e;  1PG5 B;  4XTV A;  1X6G A;  4M7D C;  1X01 A;  4C5I A;  3JB9 J;  2DYI A;  3JCM X;  2J7I A;  4AG2 C;  3EGD A;  4M75 E;  1SSH A;  4ORZ A;  3I56 Q;  3M0P A;  3OYE A;  4ANJ A;  1UEB A;  1I4K 1;  2DIL A;  4HCZ A;  2LTO A;  5GJW B;  2D6F A;  5LJ5 e;  4MDW A;  4PFP A;  4L6V 5;  1K76 A;  1XTD A;  2K2M A;  1NJI C;  1YIT Q;  3QWY A;  4BE0 A;  2DEU A;  6AT1 B;  3QHS A;  3JAM E;  3M0R A;  2DL3 A;  3G6E Q;  1RAC B;  2DD4 A;  2HBP A;  2OX7 A;  3V8J A;  2ECZ A;  4OMQ A;  3R6N A;  1YJN A;  2YUO A;  4M75 A;  5GMK j;  5GMK e;  1QWE A;  3CD6 T;  2RJD A;  2BE9 B;  4IUT A;  3JCM e;  1WHK A;  3VKI A;  3VU3 C;  2JNG A;  2LC4 A;  4A63 B;  2K5L A;  3SD4 A;  4IUQ A;  5KE3 A;  1VQ4 T;  2KNB B;  4LD6 A;  1B3Q A;  3NGP A;  1PKT A;  3QJY A;  5GAN 7;  1YI2 A;  3TQ7 P;  2OI3 A;  3MJX A;  1CKA A;  3TSZ A;  2LX9 A;  1VQ7 Q;  3KUF A;  3L2W A;  1RAH B;  2COW A;  5FWC A;  1V29 B;  1B34 B;  2D9T A;  1XOV A;  4OMO A;  2K79 A;  5IT9 E;  4M77 D;  2QG9 B;  2JJ9 A;  2RI3 A;  4LN2 A;  3M53 A;  3FLG A;  1WIE A;  2DD5 A;  4YTL A;  4NL2 A;  4IUR A;  4C8Q E;  3INZ A;  2FO0 A;  1M5Q 1;  2F2X A;  4BDY A;  2XU8 A;  3RER A;  1VQ5 Q;  3OS1 A;  3DLL A;  1U1T A;  1IHW A;  2RPN A;  3CMA Q;  3CD6 A;  5D6Y A;  1OOT A;  5GMK m;  2J6O A;  1KD1 R;  4LD9 K;  3HFN A;  2LJ1 A;  3CCS Q;  3JSC A;  2BKD N;  4AMC A;  4ELZ C;  3QII A;  4LDX A;  3CME Q;  1IRE B;  1KQS S;  4JJD A;  4C92 A;  4EDU A;  3MO8 A;  1D3B B;  2NUP A;  3CCJ Q;  3CC7 A;  2MPX C;  3QYG B;  1NG2 A;  4E7S A;  2P0P A;  4II1 A;  2BIV A;  3EH2 A;  2E4H A;  3LGF A;  1SRL A;  2BE7 D;  2DKG A;  1QQJ A;  1I5L A;  1TSF A;  4IUP A;  1WHJ A;  2FZK B;  5KH6 A;  3C95 A;  1F1B B;  1E6G A;  2DJZ A;  2AIR B;  4OP0 A;  1U5S A;  1D1C A;  2ZPH B;  3M9Q A;  1JJ2 A;  4FT4 A;  5LJ5 j;  1PSE A;  3HPW A;  4M78 B;  4F7U A;  1VQ9 A;  1C1A A;  5IXF A;  1VQ6 A;  1UEC A;  1C6V X;  2J05 A;  4ESR A;  1NBE B;  1VQ6 T;  3PT9 A;  3EG1 A;  1GL5 A;  4J9G A;  3H41 A;  4ZN1 A;  1G3W A;  2VV5 A;  2JN0 A;  1AOJ A;  5HY6 A;  4A53 A;  3CEY A;  8ATC B;  4M7D G;  2OTJ Q;  2QDY B;  1J3T A;  4PJO G;  5DY9 A;  3I55 Q;  4E7I A;  5GJV B;  5FLX E;  4RKU E;  4E2F B;  2ZZD A;  3AHU A;  2L3P A;  3FJ5 A;  2GNC A;  1UGP B;  3JCM W;  4F7U G;  3EGU A;  3QZ5 B;  1BYM A;  4LUD A;  4KGX B;  1NJI U;  1K9M U;  4C8Q A;  2IVW A;  3VRZ A;  4J7I A;  4J9I A;  2E12 A;  2M51 A;  4JUV A;  1ZSZ A;  1E6H A;  2BZX A;  1M90 R;  1S1N A;  3CCM T;  1LVK A;  5EC7 A;  1JXO A;  4M7A F;  1UGV A;  3H8Z A;  4PLI A;  3LYI A;  5LJ3 j;  1WHL A;  1ZUU A;  4QVZ A;  4A4H A;  2OTL T;  2E5K A;  3L2V A;  3MPU B;  3BE3 A;  4PJM A;  3OYB A;  4O6J A;  5FU6 C;  2LQK A;  3CCV Q;  2B86 A;  1TWB A;  2EFI A;  3EFO A;  4AG1 C;  3L2Q A;  4C0D C;  1K73 U;  1ZBX A;  1PD1 A;  3CMA T;  2LCS A;  2ZGW A;  1NYG A;  1YCS B;  4OVA A;  2JTM A;  1VQ9 Q;  2K6D A;  4M78 F;  5KYY B;  2QQS A;  1VQN A;  5KCO A;  3V7R A;  1QCF A;  1YIT T;  1K0X A;  4XAX B;  2QQA A;  1VQP Q;  3OW2 S;  1QVF A;  3PVQ A;  1SHF A;  3VS1 A;  2PVD B;  1AWO A;  2DE0 X;  1YHQ T;  2DFU A;  2VGN A;  3CC7 Q;  2W10 A;  3QDF A;  2RQV A;  4IUU A;  3UAT A;  2RQT A;  1YIJ T;  3CME A;  2EVR A;  4E7J A;  1VQM Q;  3N5B B;  2XMF A;  3BY7 A;  2QAS A;  1X43 A;  3Q1J A;  4RCB A;  1H8K A;  2ENM A;  2YUN A;  3A8M B;  5IN1 A;  2EYZ A;  4OMP A;  2F5K A;  5CO7 A;  1GCQ A;  5FRO A;  5KE2 A;  2LT1 A;  3MEA A;  1EFN A;  3DB4 A;  4C8Q F;  1KFZ A;  2PU9 B;  2GFA A;  5CQY A;  4RTW A;  3CCL A;  1U3O A;  5KYW B;  5M9O A;  2HL3 A;  3LW5 E;  4X9C A;  5GAN h;  4HT8 A;  2SEM A;  4R0K A;  2F2W A;  2QQB A;  2FL7 A;  2YXY A;  2A3L A;  2D1X A;  2O01 E;  1YI2 Q;  4FSS A;  4A4F A;  1ZHI A;  5CKH A;  1KSW A;  2HL5 C;  2ED1 A;  1I81 A;  3MEU A;  1RAB B;  2JMC A;  3GIB A;  3SDZ A;  1W2B A;  4JZ3 A;  1ZLM A;  4M7D A;  3M57 A;  3QO3 A;  3CCU T;  3MHX A;  4E6R A;  3A8L B;  1N8R U;  3RMQ A;  2RK1 A;  1YP5 A;  1QVG A;  1WNL A;  2DL4 A;  2E3H A;  2EQI A;  4DBQ A;  5KYX A;  4AFQ C;  1Y96 B;  1D3B A;  2V8J A;  4ZTF A;  2RK2 A;  2YUQ A;  3L42 A;  5CKE A;  3OA6 A;  2GCX A;  4M7A D;  2DET A;  2GF7 A;  3JB9 G;  2EBP A;  1KD1 U;  2IIM A;  3CCM Q;  3VS4 A;  2E10 A;  4C0G A;  2F2V A;  1KJW A;  4OB0 B;  2XD0 A;  1VQO A;  4XQ3 A;  4M4Z A;  4GLK A;  2GQI A;  3E2U A;  3L2R A;  3M0Q A;  3HSB A;  3I56 A;  3DKM A;  4RTX A;  3NTH A;  3GPL A;  2CT3 A;  3QDR B;  4QQG A;  5GAM d;  4CC2 A;  4BI8 B;  2KRS A;  4PNO A;  1AWX A;  4J9F A;  1GBQ A;  1VQN T;  4LXC A;  4WF2 A;  1NM7 A;  1X2Q A;  1YIJ A;  1PC0 A;  1VQ9 T;  1RI0 A;  3RIR A;  1HK9 A;  1D1B A;  1X75 C;  5IHI A;  3V7C A;  2MWO A;  3SB2 A;  3CCQ Q;  4EMK A;  3OYH A;  2ROL A;  3OMG A;  2R57 A;  3G7Z A;  2HKN A;  3EGX A;  5AT1 B;  3CC4 Q;  5KCH A;  2PUO B;  1Q82 C;  8AT1 B;  4B9W A;  1AZG B;  1K8A R;  5GAN d;  3PIP A;  1WI7 A;  4FCY A;  1PCX A;  3P8B B;  3JCM V;  1YIJ Q;  2NUZ A;  2X51 A;  4BUG A;  1IGQ A;  4IUV A;  3C94 A;  2HSP A;  1NYF A;  4OGE A;  2WAC A;  3TU4 K;  1MNE A;  1BKB A;  4M7D F;  1RAG B;  5IXB A;  4DOW A;  2DL5 A;  2JVV A;  1Q86 R;  1KC8 C;  1VOM A;  1VQO Q;  3H0H A;  1OV3 A;  3RMS A;  1RL2 A;  4C5E A;  3CCM A;  2LQW A;  5I2M A;  1YJ9 Q;  2CP0 A;  1ARK A;  1Y07 A;  2KXC A;  4M7D E;  1I07 A;  1OQK A;  1RAF B;  4M78 C;  4C0F A;  1KQ2 A;  4Z88 A;  4PJO E;  4M75 G;  3OYL A;  4JLI A;  3M56 A;  3VS2 A;  2RJF A;  2ZPE B;  2I0N A;  1ABO A;  1M27 C;  1ZQ1 A;  4BI4 A;  3TSW A;  1YJW A;  4QW2 A;  1GBR A;  1Q86 U;  3EAE A;  1Z9Z A;  3PIO A;  1AD5 A;  2A28 A;  1LPL A;  4FYX B;  3VS0 A;  5GAN 4;  5DM7 R;  3VUZ A;  5FWB A;  4J5Y A;  4IIM A;  4RUG A;  3WXM B;  4PK4 A;  1Y71 A;  1D0Z A;  4Q5W A;  2RA2 A;  5LJ5 g;  2L0A A;  4MML A;  1U8R A;  2FG0 A;  3O5Z A;  1N8R C;  1MMD A;  1PKS A;  2CP2 A;  3CPF A;  2FYK A;  1VQL T;  2E41 A;  4Z89 A;  3CCL Q;  3VS5 A;  3FJP A;  1GCP A;  3CXC S;  1BK2 A;  2X9H A;  1KD1 C;  3NPF A;  1XNI A;  4LDY A;  3M4G A;  4FYV B;  1FWZ A;  4JDS A;  3C12 A;  3PNW C;  1YJN T;  1IGU A;  2RO0 A;  4EIK A;  3A5Z B;  1MMG A;  5GAN f;  2CKK A;  2G3R A;  2ZAE A;  2CZ6 B;  4C0D B;  2MCN A;  3G4S Q;  1UJ0 A;  2H8H A;  2RM4 A;  1YHQ A;  1YWP A;  2K5F A;  3RR6 A;  4HCB A;  2CP7 A;  3E9F A;  1BIB A;  5DLO A;  1QVF S;  1VQP A;  4ZGE B;  2R5M A;  2KRM A;  2KY9 A;  5I11 A;  3ER0 A;  4ZNX A;  2KR3 A;  2LJ0 A;  2CSI A;  2C0O A;  2GGR A;  2RQW A;  3EHR A;  2P4T A;  3ME9 A; 
#chains in the Genus database with same CATH homology
 4Z02 A;  2E6N A;  4MMK A;  1G3W A;  2VV5 A;  1N9S A;  4M77 E;  4BB7 A;  2JN0 A;  4ZN1 A;  3CXC A;  1QP2 A;  5HY6 A;  1DJ7 B;  3CEY A;  4A53 A;  2H3J A;  4M78 A;  5LJ3 f;  4F7U B;  4M7D G;  3JCM h;  2QDY B;  4FL6 A;  3VYH B;  5AYF A;  1NE8 A;  4EMK B;  1K73 C;  2R5A A;  4PLL A;  4ME7 A;  3UDC A;  2DVE A;  4M75 B;  1KHI A;  3MCA B;  5DY9 A;  4JRI A;  4PJO G;  4E7I A;  5HK0 A;  4BY6 B;  1QP3 A;  4C92 C;  5HKC A;  4C92 F;  4HA8 A;  1VQ8 A;  3CBM A;  5FRN A;  3BDL A;  3FDR A;  4Y28 E;  3WVE B;  4BAC A;  3VUB A;  5FLX E;  1VQ5 T;  1OZ2 A;  4RKU E;  2ZZD A;  5D6W A;  1LNX A;  3RKW A;  3AHU A;  2QEX A;  3S3O A;  1FXX A;  4LDV A;  1M9S A;  2DO3 A;  2K5I A;  2EQU A;  3PTA A;  3E9G A;  2DK3 A;  4C5H A;  2QA4 T;  1UGP B;  5GAM h;  3JCM W;  4EMG A;  4F7U G;  2VC8 A;  2KVQ G;  4X9D A;  3QZ5 B;  4RMO A;  4EMK C;  3G71 T;  3JB9 D;  4C8Q D;  1NJI U;  1M1K U;  1BYM A;  3S6W A;  3JCM b;  1JB0 E;  1K9M U;  1KC8 U;  4C8Q A;  2IVW A;  4RG8 A;  1VQM T;  2KK4 A;  4JJN K;  2KSS A;  4MZT A;  2E65 A;  4BY6 C;  4L5G A;  4C92 B;  3A8O B;  3FIF A;  2CYZ B;  4J7I A;  3CCJ A;  2E12 A;  5GAO l;  3M5A A;  4JUV A;  4P5N A;  4E7K A;  3GP8 A;  2VXE A;  4E7L A;  3CCS T;  4J6Y A;  2OTL A;  4TVR A;  1M90 C;  3CBO A;  1YJW T;  5GAO r;  2DZC A;  2X4J A;  4ATO A;  3CCM T;  2JZ2 A;  2R58 A;  3CCS A;  3G4S T;  4M7A F;  3OW2 A;  3H8Z A;  2M9U A;  3JRZ A;  3QPH A;  3RES A;  4PLI A;  3LYI A;  4C8Q G;  5LJ3 j;  1VQK A;  4N4G A;  3WVD B;  3CCL T;  1KQ1 A;  5GAN 5;  2DXU A;  4M75 D;  3L2U A;  4JS4 A;  3QG1 A;  3CMA A;  3JB9 I;  3CC4 T;  4QVZ A;  3J81 E;  1QW1 A;  4A4H A;  4HT9 A;  4PJO C;  2DIQ A;  2HAX A;  2OTL T;  4FSX A;  3L2V A;  1VQ5 A;  3X26 B;  5LJ3 d;  2I2L A;  2RH2 A;  4M78 E;  4DQ2 A;  1JRI A;  3PFS A;  3TRE A;  2EQM A;  4O6J A;  3NFC A;  1OI1 A;  5FU6 C;  4KBM B;  4EMH A;  3I55 A;  2LQK A;  2LT4 A;  2E1H A;  2F69 A;  3LWI A;  2MMP A;  2Y90 A;  2EFI A;  1WJQ A;  5GAN 6;  5FRM A;  5EG2 A;  3L2Q A;  4C0D C;  4EPC A;  1K73 U;  1ZBX A;  1G3S A;  1W4S A;  1UGQ B;  4J6W A;  4MZP A;  3G71 A;  3CMA T;  3SWN B;  4PJO D;  5J39 A;  1KHC A;  2ZGW A;  3CCV A;  4OVA A;  2JTM A;  4RCC A;  5GAN j;  2WSE E;  4V2S A;  1B34 A;  4M78 F;  3OSV A;  1JJ2 S;  2QQS A;  2BUD A;  4XTZ A;  2EJ9 A;  3CCR A;  1VQN A;  2K4Y A;  4XU0 A;  5KCO A;  2XI9 A;  4M77 C;  4M77 G;  2ZPG B;  2X4X A;  3V7R A;  5GMK i;  4CRI A;  5I2S A;  1QVG S;  1YIT T;  4M7A E;  2WSC E;  5CQX A;  3OYD A;  4XAX B;  2RJE A;  2QQA A;  4BE2 A;  1M1G A;  5LJ5 d;  3ZBD A;  3S3N A;  1VQO T;  4B9X A;  2NLU A;  2DEQ A;  1OYX A;  4ELY C;  3RKX A;  5A0L A;  3OW2 S;  2KMT A;  2RB6 A;  3LWH A;  4C92 G;  1QVF A;  3OYG A;  1NPP A;  2XG8 D;  2PVD B;  1YHQ T;  3R6O A;  5CAI A;  5I21 A;  4VUB A;  3M54 A;  5GAO q;  2RHX A;  2VGN A;  1PSF A;  3HRU A;  4N0A A;  2P0Q A;  4A54 A;  3UPU A;  4OB1 B;  2XKO C;  4PKC C;  4IUU A;  2XHC A;  3A8H B;  4KUI A;  4M77 B;  2AHJ B;  3HP9 A;  1YIJ T;  2RI5 A;  3CME A;  4Y91 A;  3CCU A;  4LDW A;  2YLC A;  3N5B B;  4E7J A;  3V8K A;  2EWN A;  3ZEH A;  1NZ9 A;  3BY7 A;  1UGR B;  3Q1J A;  4C8Q B;  3OMC A;  3V7S A;  5GAM g;  4RCB A;  3QUI A;  3X20 B;  3CCV T;  2RD1 A;  4C92 D;  3A8M B;  5IN1 A;  3RKY A;  2DIG A;  3G6E T;  2B8A A;  4DA4 A;  2M16 A;  3QBY A;  4HKE A;  2F5K A;  1Y7X A;  2EJG A;  5CO7 A;  2FVU A;  3CCQ T;  3KXT A;  2DZ9 A;  5FRO A;  3UWN A;  4MZM A;  5KE2 A;  3NTK A;  3GLX A;  2LDM A;  2LT1 A;  2QTX A;  3LH0 A;  3MEA A;  4M7A G;  4FM4 B;  5GAO n;  1K8A C;  2MF2 A;  3DB4 A;  3FB9 A;  4C8Q F;  2PU9 B;  2GFA A;  5CQY A;  1R8O B;  2K2V A;  1QVF S;  2YRV A;  3CCL A;  2DTH A;  5M9O A;  4KUD K;  5IAY A;  5GAM e;  3MEW A;  3LW5 E;  2EIF A;  4X9C A;  4ZGD B;  5GAN h;  3CCE A;  4HT8 A;  1MGQ A;  4M77 A;  4C5G A;  2C06 A;  3EFR A;  2P0K A;  4BI3 A;  2FB7 A;  4QVD A;  1M1F A;  5D6X A;  2L8D A;  2QQB A;  2FL7 A;  3GNG A;  2CZ1 B;  4OB3 B;  2A3L A;  4KUL A;  2O4X B;  1FX7 A;  3BDU A;  2O01 E;  3JB9 H;  2XIC A;  3VV0 A;  2QQ9 A;  3MP1 A;  4ZGJ B;  1U1S A;  5L8R E;  3TEE A;  4M75 F;  4A4F A;  2CS7 A;  1ZHI A;  2PQW A;  3OS2 A;  5CKH A;  2PUK B;  5CIU A;  1VQK T;  1VQL A;  1VIE A;  4FU6 A;  1I81 A;  2K3X A;  2X35 A;  3MEU A;  1VIF A;  4XU1 A;  3VJP A;  2L89 A;  3G4S A;  4M77 F;  3GIB A;  1GXI E;  4KT0 E;  5GAN 8;  1VUB A;  2HNI A;  3SDZ A;  5DLQ E;  1W2B A;  2A7Y A;  2RJC A;  3CCQ A;  4M7D D;  3OBY A;  1O75 A;  4F7U F;  2LRQ A;  3OQ5 A;  3P8H A;  5CR2 A;  3SWN C;  3URG A;  4M7D A;  3M57 A;  1IZ6 A;  3M58 A;  3QO3 A;  5GAN g;  3CCU T;  4ZTJ A;  5GAO m;  3C4S A;  3MHX A;  3OYI A;  3X25 B;  4BD3 A;  3A8L B;  4QQ6 A;  3RMQ A;  1N8R U;  3CC7 T;  2VXF A;  2RK1 A;  3QKJ A;  1O9S A;  2FHD A;  4O5V A;  1QVG A;  1WNL A;  4N4I A;  2CZ7 B;  2VUB A;  1Y96 B;  2GQV A;  1D3B A;  2V8J A;  4F7U E;  4ZTF A;  2RK2 A;  3GF5 A;  1WQ7 A;  5CKE A;  3L42 A;  5HK3 A;  3OA6 A;  2QA4 A;  4OF1 A;  2GCX A;  1Q82 U;  4ZN3 A;  4M7A D;  2KAF A;  3OBW A;  2GF7 A;  1K8A U;  2VGM A;  3HHT B;  3JB9 G;  1KD1 U;  1M1K C;  2DAQ A;  5A0D A;  4JRQ A;  4PJO B;  3E19 A;  4D6W A;  4PL6 A;  2JTF A;  3JCM c;  2LQ8 A;  3CPW S;  3BW1 A;  3JCM d;  1YJ9 T;  1VQ8 T;  4RG2 A;  1WJS A;  5FU6 B;  2E10 A;  2LNV A;  4FIB A;  3CCR T;  2QI2 A;  1P92 A;  4C0G A;  3LGL A;  2L3R A;  5GAO p;  2V8K A;  5CCA A;  2XD0 A;  4OB0 B;  5GAN 2;  1VQO A;  1G3Y A;  5LJ3 g;  3MEV A;  2XDD A;  4PJO A;  4XQ3 A;  2MWP A;  3CC2 T;  2OTJ T;  4GLK A;  3HL8 A;  1H64 1;  4GY5 A;  1UB4 A;  1BI0 A;  3QXE B;  3VYG A;  3L2R A;  1BI2 A;  3OYY A;  3HSB A;  3I56 A;  2E70 A;  3DKM A;  2KDS A;  3ZFJ A;  3NTH A;  1Y96 A;  2HQX A;  3QJ6 A;  3GPL A;  4C92 E;  3QDR B;  4QQG A;  5GAM d;  1YCY A;  1KQS A;  4BI8 B;  4PNO A;  4M78 G;  4JRP A;  1HXD A;  4J6X A;  1VQN T;  4OMF B;  1EIF A;  3OS0 A;  4WF2 A;  1SSF A;  2X4Y A;  3JCM g;  2PVO B;  3SWN A;  1YIJ A;  4MDX A;  1VQ9 T;  1VQ4 A;  3MP6 A;  2QQR A;  1VQ7 A;  1RI0 A;  2LCC A;  2KQW A;  3OYA A;  4HCC A;  3E1S A;  2ZPI B;  4J7F A;  3RIR A;  1HK9 A;  1X75 C;  5LJ3 e;  3H6Z A;  2EYQ A;  2EJF A;  3V7C A;  1XQH A;  2D0Q B;  2K3Y A;  4XU2 A;  2MWO A;  3KBG A;  3EFS A;  3SB2 A;  2Y4Y A;  4EMK A;  3OYH A;  3OMG A;  2R57 A;  3QSU A;  4XTU A;  1N9R A;  5GAN e;  3OYM A;  3G7Z A;  3OSS C;  4M78 D;  2V8I A;  4XTV A;  4M7D C;  1X01 A;  1WJR A;  4XTY A;  4C5I A;  1BIA A;  3DLM A;  2XDP A;  5J3B A;  5KCH A;  2YHT A;  5LL6 S;  3JB9 J;  1WQW A;  3ASK A;  5CK9 A;  2PUO B;  4XU3 A;  3JCM X;  3CME T;  1Q82 C;  4M7A B;  3TCJ A;  1VQP T;  4B9W A;  4XTX A;  2HD0 A;  2OAU A;  5GAN d;  2RHU A;  4M75 E;  3PIP A;  3CPW A;  3CCJ T;  2CZ0 B;  5CKF A;  1JBM A;  3HRS A;  3P8B B;  3OYE A;  3JCM V;  1YJ9 A;  3OY9 A;  4BUG A;  2DXT A;  3HFO A;  4OB2 B;  4IUV A;  3OS5 A;  1UEB A;  1I4K 1;  4N4H A;  2JOY A;  4HCZ A;  1N27 A;  2LTO A;  3C94 A;  2XDB A;  4NS5 A;  5LJ5 e;  5CKD A;  4MDW A;  3G6E A;  2D6F A;  5C0M A;  4OGE A;  5GAN 3;  4L6V 5;  2WAC A;  3TU4 K;  1YIT A;  3HRT A;  1BKB A;  3UT1 A;  4M7D F;  4X34 A;  3JB9 F;  2GFU A;  1XTD A;  3T9N A;  4DOW A;  3BFM A;  2JVV A;  5FU7 C;  1NJI C;  4BE0 A;  3QHS A;  1N6A A;  2ZPB B;  4XK8 E;  1WGS A;  5LJ3 h;  3JAM E;  1KC8 C;  3JCM P;  3FRN A;  3V8L A;  1KG1 A;  3OB9 A;  3OYK A;  2DD4 A;  2HBP A;  3V8J A;  3PMI A;  3RMS A;  1Q81 U;  1RL2 A;  3M59 A;  4C5E A;  1YJN A;  3O8V A;  4A4K A;  3NTI A;  3CCM A;  4M75 A;  1UGS B;  2M1H A;  5I2M A;  5GMK j;  5GMK e;  1M90 U;  4FT2 A;  4LDU A;  1Y07 A;  4M7D E;  3CD6 T;  2EQK A;  2DXC A;  2DXB A;  2RJD A;  3CBP A;  3F70 A;  2Y4X A;  4M78 C;  4C0F A;  4IUT A;  5GMK h;  3JCM Q;  3I56 T;  1KQ2 A;  3JCM e;  3FEO A;  4DOV A;  3VKI A;  1VQM A;  3MP8 A;  4M75 G;  4PJO E;  3VU3 C;  3CC4 A;  2JUF A;  3X28 B;  3OYL A;  3CCE T;  4JLI A;  2JNG A;  3M56 A;  5GAM j;  2LC4 A;  2K5L A;  3MET A;  3SD4 A;  3OYJ A;  1H3Z A;  2MAM A;  2RJF A;  2ZPE B;  4OGC A;  4QQD A;  4IUQ A;  4A4G A;  4R55 A;  2LCL A;  5KE3 A;  1VQ4 T;  2DTI A;  1ZQ1 A;  4LD6 A;  4BI4 A;  1YJW A;  3J80 E;  2QEX T;  1OZ3 A;  4QW2 A;  4QVC A;  2L5Q A;  3QJY A;  5GAN 7;  1Q86 U;  1LOJ A;  3EAE A;  1YI2 A;  4XTW A;  4NL3 A;  5CKB A;  3LX7 A;  3PIO A;  2LX9 A;  4NOY A;  3KUF A;  3RUX A;  3L2W A;  5GAN 4;  5A2Q E;  5DM7 R;  2WSF E;  3VUZ A;  1M4Z A;  1V29 B;  5GAM f;  4IKF A;  1B34 B;  2D9T A;  4CI0 C;  3P8D A;  1XOV A;  4J5Y A;  3X24 B;  1VQ9 A;  2VYT A;  2EAY A;  2F5T X;  1QVP A;  4UC4 A;  5IT9 E;  3WXM B;  3GNF B;  1LJO A;  4M77 D;  3I55 T;  2RHZ A;  1Y71 A;  1Q7Y U;  2DTO A;  2RI3 A;  4Q5W A;  1I8F A;  1YBY A;  2RA2 A;  3M53 A;  3FLG A;  2EQJ A;  5LJ5 g;  4MML A;  3GOX A;  1BI3 A;  2QXF A;  2ZPF B;  5C6S A;  1U8R A;  2DD5 A;  4YTL A;  4E47 A;  4NL2 A;  2RHI A;  4IUR A;  2EKO A;  3INZ A;  4PJO F;  4C0Z A;  4C8Q E;  1N8R C;  1M5Q 1;  1WPY A;  4BDY A;  5J26 A;  4JLG A;  3CPF A;  1Q81 C;  2XU8 A;  2E5Q A;  2RHY A;  2FYK A;  1VQL T;  3RER A;  3L1A A;  2E41 A;  2E64 A;  5A0G A;  2IG0 A;  3JCM f;  3OS1 A;  3SFM A;  3OYB A;  3DLL A;  1U1T A;  2M0O A;  3M55 A;  3CC2 A;  4M7A C;  4BDZ A;  1BI1 A;  3FJP A;  3QZ9 B;  3OYN A;  1VQ7 T;  3A8G B;  3CD6 A;  5D6Y A;  2K57 A;  3CXC S;  1NPR A;  1KD1 C;  5GMK m;  2XK0 A;  3LLR A;  3FC3 A;  1XNI A;  4LDY A;  4LD9 K;  3HFN A;  4N0A C;  3JSC A;  4M75 C;  2BKD N;  4ELZ C;  2CGH A;  3QII A;  4LDX A;  2YLB A;  3M4G A;  2E6Z A;  1FWZ A;  1IRE B;  1KQS S;  2ZCF B;  5CVI A;  4C92 A;  4EDU A;  3S3M A;  3PMT A;  1W2B S;  4JDS A;  3C12 A;  3PNW C;  3MO8 A;  1YJN T;  2PVG B;  1S72 A;  1D3B B;  2RO0 A;  3CC7 A;  3A5Z B;  3QYG B;  5GAN f;  2P0P A;  1AHJ B;  5FU7 B;  2CKK A;  2G3R A;  4II1 A;  1Q86 C;  3PGG A;  1TH7 A;  2CZ6 B;  2BIV A;  3OYF A;  3LGF A;  1G3T A;  4C0D B;  2DKG A;  1K9M C;  5LJ5 f;  2XID A;  1MHN A;  1I5L A;  4M7D B;  3QYH B;  5LJ5 h;  1X6O A;  4IUP A;  5GMK l;  2MI6 A;  4J8O A;  4C8Q C;  5KH6 A;  1S72 T;  4R56 A;  3DB3 A;  3C95 A;  2HQE A;  2RM4 A;  1YHQ A;  2K5F A;  2DJZ A;  3L2Z A;  4A4E A;  4OP0 A;  4HCB A;  4J83 A;  3M9Q A;  2ZPH B;  1JJ2 A;  1G5V A;  3E9F A;  1M8V A;  1Q7Y C;  4FT4 A;  2RI2 A;  1BIB A;  4JRK A;  5DLO A;  1PSE A;  3HPW A;  4M78 B;  4F7U A;  2LVM A;  5LJ5 j;  2DPP B;  4ZGE B;  4E7H A;  3JCM J;  1VQP A;  2R5M A;  4L59 A;  2X4W A;  1VQ6 A;  1YI2 T;  2KY9 A;  3J7A F;  2OTJ A;  3ER0 A;  3HKS A;  2O4X A;  4BE1 A;  1VQ6 T;  3PT9 A;  4M7A A;  2P4T A;  3M4Y A;  3OYC A;  3ME9 A;  4JS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...