1KG1A

Nmr structure of the nip1 elicitor protein from rhynchosporium secalis
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
60
structure length
60
Chain Sequence
DRCRYTLCCDGALKAVSACLHESESCLVPGDCCRGKSRLTLCSYGEGGNGFQCPTGYRQC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Necrosis Inducing Protein 1
publication title Solution Structure of the Plant Disease Resistance-triggering Protein NIP1 from the Fungus Rhynchosporium secalis Shows a Novel beta-Sheet Fold.
pubmed doi rcsb
source organism Rhynchosporium secalis
molecule tags Toxin
total genus 4
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2001-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.460 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1kg1A02
1KG1A
chains in the Genus database with same CATH superfamily
3X26B 3OS0A 2O31A 5GAN6 3EFOB 4CC4B 5KYXA 4PK4A 3CMEA 1Q81U 3FIFA 5FROA 4DEXA 2DBKA 1QVGP 1VQ4A 3KFVA 2GF7A 3V7CA 1U5SA 3MJXA 3RKXA 2HCKA 2QA4T 2XKOC 1YNZA 2ZPHB 4XTUA 1ZA1B 2R5MA 2K3BA 4LN2A 1ZBXA 3LH5A 4E47A 1KIKA 3SFMA 3JCMX 1IGQA 5D7UA 1K73U 3CCUA 2MWOA 1Y7XA 1X6BA 2DXCA 2KNBB 1QWFA 3EAEA 4FSXA 1GCQA 1UECA 4PJOC 2DE0X 4PNOA 3AHUA 2NYSA 1UGVA 1XTDA 2PTKA 3R6OA 3EG3A 3QYHB 1Y57A 2D0NA 1NM7A 2YRDA 5I2SA 3JCMd 2LCLA 4C8QD 3TEEA 4JS4A 3QSUA 2PNIA 5LJ5f 5LJ3g 3CCEQ 3SB2A 1GFDA 2QEXQ 1S72Q 4LDUA 4BI8B 1RI9A 1UGRB 1KHIA 1NYGA 3CXCS 2ZPEB 1VQ7T 2KR3A 1R77A 3DKMA 2K3YA 3LX7A 2EBPA 1QVPA 3OBYA 1KFZA 1G3TA 2E6NA 3M58A 4RCCA 1VQ8Q 3M56A 3HKSA 2O9VA 5GAOn 2K5IA 3M4YA 2X35A 3LW5E 1VQ6T 1Q82C 4C5EA 3J7AF 2XDPA 4X9CA 5CQXA 2E3IA 4NL2A 2NUPA 3BFMA 1MMAA 2EQJA 1U3OA 1ZBJA 1N8RU 5GMKl 1WGSA 4LDWA 2NUTA 4GY5A 2E70A 1OX9A 1RI0A 3H41A 1K8AR 5FRMA 4IURA 3OYNA 3OYAA 1E7OA 4ZN3A 4PKCC 1HYOA 4PJOG 1RAHB 3A8HB 2LT1A 4GLMA 1N27A 3M55A 4KRTA 3QDRB 4LDXA 3A5ZB 3HRTA 4AG2C 1VQ9T 2BE9B 3QWYA 2E5KA 2EYXA 3I56Q 4FYWB 3CC7A 2PZ1A 1YJWQ 1YITQ 3KXTA 1UJYA 1VOMA 1YJNT 4A4KA 5FWCA 4PJOF 2DL8A 3H6ZA 3VS4A 2KT1A 2O88A 1ZSGA 5GAOq 3CCRA 3QJ6A 2E3HA 4A4EA 2GFAA 4HVVA 2KEAA 1NJIR 1YJ9Q 3CCLT 2RPNA 3E1SA 4WCIA 3RBBB 4MZMA 4XTZA 2L5QA 1QP2A 1PKTA 4E7IA 2P0KA 3EFOA 1D1AA 3EG2A 4M75G 5CKBA 1Q7YC 3QHSA 1FWZA 3JCMP 3CC4T 1YIJA 3A8MB 3G71A 4OMMA 1UFFA 2DNUA 1H8KA 3CEYA 5CAIA 4ELYC 1K9AA 1QP3A 2HL3A 4FYVB 2GQIA 2EVRA 1EX4A 2OI3A 5GAMe 3WXMB 4C92D 4JDSA 4JRQA 2D6FA 3L2UA 1OX8A 1YBYA 2K2MA 3CCVT 1JJ2P 1TU0B 2M9UA 2RHXA 3HFOA 4M77C 3CPFA 2K5LA 1M1GA 5A0DA 2QA4Q 4FM4B 2XIDA 2P4TA 3NHNA 1M90U 3HRSA 1QVGA 1NPPA 1WXBA 4C92E 2P4RA 5IXBA 5GAN2 2LQKA 5FW9A 2DXBA 2YXYA 1PM3A 1QKWA 3EG9B 1VQ5A 1Q86R 5LJ5d 4IUQA 4X9DA 1ABOA 5CKDA 2QXFA 4J7IA 2CZ1B 2V8JA 3G1JA 5I22A 4C0FA 1O9SA 2NUZA 3EGDB 4F17A 4IIOA 4OP0A 4ZNXA 2DJZA 4BACA 1F1BB 1B34B 3F70A 3GNGA 2RHIA 4N4IA 1QVFA 1WHKA 1RAGB 3GIBA 4WF2A 3OS5A 3CC2Q 2GGRA 1HJDA 1Z9ZA 3CCSQ 5CIUA 4MZPA 1WX6A 2DRMA 5J39A 4M75E 4EMGA 4JJDA 1XQHA 1X6GA 2JW4A 3OYLA 1X6OA 2ZGWA 5GJWB 5LJ3j 2X4YA 2DD5A 2HEQA 5LJ3h 1RACB 4GBQA 4KH0B 2HD0A 1VQ6Q 2K9GA 3C12A 3H0HA 3EG1A 4ZGDB 2RK1A 3QPHA 1UHCA 4C0DC 2D8JA 1RADB 1PNJA 4M7DG 3OYJA 3UDCA 2R5AA 2KRSA 3VS0A 4VUBA 3PMTA 1KD1R 2DTHA 4J9IA 5DM7R 2FZGB 1VUBA 2K4YA 1SG5A 3HL8A 4OB1B 3TVTA 3M9QA 1MNDA 1K9MR 1BCMA 2M02A 5GANj 4KBMB 2MCNA 2JJ9A 5KYNA 1BB9A 1RABB 5GANh 3X25B 1VQ9Q 2A7YA 5CK9A 3EH2A 2FRWA 1SKUB 2CS7A 8ATCB 2DFUA 4UC4A 2HAXA 1RAEB 2MIOA 3CCMQ 3OS1A 5GAMg 3E19A 1J3TA 3OYEA 4M78G 4HCKA 5HK3A 4M7AD 1TWBA 3CCUT 3IQLA 2J05A 2YWWA 3MPUB 1HSQA 1UJ0A 9ATCB 3VRZA 2ZCFB 3OSVA 4R0KA 2RI2A 1NEGA 1RAIB 4M78F 2LQ8A 1KSWA 1GRIA 4FU6A 3CMAQ 4M7AE 2FPDA 1UB4A 1XJWB 2OX7A 4K11A 3JCMJ 3OYIA 1TXQA 2AIRB 1IO6A 2XI9A 2DTIA 5A0LA 2VYTA 5J3BA 4B9XA 1AWWA 4M7DE 4RUGA 2B8AA 3PE0A 4OMQA 1M1KR 3CC4A 3JB9J 1X2KA 4O6JA 2KRNA 1VQLA 5M9OA 3WVEB 3EG9A 1OPKA 4EPCA 2AHJB 1PRLC 4PFZA 3BDLA 2W0ZA 4KGZB 1YI2Q 2CP5A 2M51A 2W10A 3EGDA 4PFOA 5IHNA 4RTVA 4RCBA 4JPBW 3AT1B 1VQMT 3QIIA 3RUXA 2ED0A 1AEYA 1B34A 2AKKA 1N5ZA 1WFWA 2A0FB 1RLPC 3JB9H 1T0JA 1WHHA 3LYIA 3M4GA 4DOVA 3MCAB 1C0MA 4FW1A 4LNPA 2HQEA 1MHNA 3UA7A 3I35A 4X34A 4A4FA 1SRLA 3S3MA 3V8JA 2QGGA 1D0XA 1SSFA 2RM4A 4R56A 2HBWA 4HVWA 5GJVB 2QDLA 2I0NA 2DL5A 4AFQC 4JJNK 3M57A 4E7LA 3M53A 4QQDA 1VYTA 4J8OA 1I5LA 3CC7T 1O75A 5L23A 2E1HA 2COYA 2JMAA 1KQ1A 4DQ2A 3H0IA 1W2BS 1KK7A 2FHDA 3CCRT 3CD6T 1AT1B 4XU0A 4LUDA 4Y28E 1AOJA 3TSZA 2MWPA 3GOXA 4B9WA 2EW3A 2ESWA 4F7UG 2KAFA 4PLLA 4PJOB 3CCQT 5A0GA 5GANe 1X2QA 4J9FA 2DAQA 1YHQA 4KUIA 1K8AU 2VXFA 4O5VA 3MP6A 2JN0A 1Y71A 1M8MA 3MEWA 2OTJA 2AKLA 1H3ZA 1OU9A 4DEYA 3A8LB 3QZ9B 2A36A 2QTVA 3JB9D 4JLGA 3MKDA 1UGSB 3G71T 2KQWA 1HK9A 1NBEB 2IG0A 2HKNA 3TSWA 2M1HA 5CKHA 1VQPA 1KQSS 1ZLMA 4C8QG 2DTOA 3CMEQ 4JZ3A 2VC8A 4A54A 2PUKB 1YWOA 3P8HA 2RHZA 2ZZDA 3CCJA 1WA7A 1VQ4Q 5IXFA 2EPDA 1VIEA 3G6ET 2P84A 4XTYA 1G3SA 4E7KA 2GQVA 4J6XA 1QW1A 1SEMA 2YUPA 2LQNA 2F2VA 1KC8R 1UEBA 4GLKA 2EGAA 2CT4A 2EIFA 2LZ6B 1NJIU 3RESA 4RKUE 1RAFB 1VQOQ 2CYZB 2KE9A 2K3XA 2KRMA 2L2PA 3DLMA 4J9CA 4BUGA 1VQ5T 3CCUQ 2JNGA 3EG0A 3X24B 3WVDB 2O01E 1OZ3A 3QBYA 4DBRA 4N0AA 3OYBA 4HT8A 2H3EB 1M3BA 4D6WA 3RDVA 2QTXA 1TS9A 2JS0A 4E6RA 3U23A 3OYDA 5GAMj 3PTAA 5GAMh 4OGCA 4F7UE 4JJBA 1QVFP 2YRVA 3ZL7C 2P0QA 2RHUA 4C92C 1H92A 5LJ3f 1WHGA 2DLPA 1JRIA 3NFCA 4ORZA 2GBQA 2HMAA 1E6HA 5CO7A 1RL2A 2DMOA 4QKUA 2RF0A 2L3QA 2LMJA 4J6YA 3UPUA 2DEUA 1BI0A 4NOYA 2D9TA 1WNLA 4X1VA 1GBRA 1UTIA 4C8QE 2DRKA 1Q86U 1WLPB 2CP2A 5AYFA 1Q81C 3S6WA 6AT1B 4OMNA 5L8RE 1QMCA 2HL5C 2GTOA 2AK5A 1ZUKA 4XU1A 4CI0C 2HNIA 1MMGA 2KXCA 4M75C 5IAYA 5GANg 3CXCP 4V2SA 2OTLA 3M5AA 1VQMA 1Y0MA 4AFSC 2RQRA 2VVKA 1B7TA 2ENMA 2ZPBB 4M77B 1I0CA 3QXEB 1K73C 4OMPA 1G5VA 1M27C 3X28B 3MP8A 4PJOA 2EYQA 2KVQG 3OYMA 2F5TX 4C92G 2FB7A 4AG1C 2EJ9A 4Y92A 3N5BB 1AVZC 1OEBA 2DPPB 1UE9A 1VQNQ 2RH2A 3M0UA 4F04B 7AT1B 5HKCA 1KQ2A 3VS1A 2C0TA 1PKSA 3L2WA 1UHFA 2CZ7B 3RKWA 5GMKi 2FO0A 3EHQA 2SRCA 5FU7C 2DXUA 4C92F 1W6XA 1QQJA 4FCYA 3CD6A 3L42A 3JSCA 2L3PA 2J6OA 1KD1U 1SHGA 3OYGA 1OULA 1KHCA 3QO3A 2RA2A 2EKOA 2CREA 1PWTA 2CT3A 2ZAEA 3CCQA 1FX7A 1YP5A 3INZA 4KGXB 1YIJQ 1K9MU 5GAN7 3TCJA 2G3RA 2O2OA 2VWFA 3H8ZA 2KY9A 1VQKA 2VXEA 4M78B 2LP5A 2YLBA 2E5QA 3I56A 4JJCA 1N8RC 1ZQ1A 4C0ZA 2BZXA 1G2BA 1YITA 2JM9A 1Q82R 3CPWA 3VS7A 1M3AA 2A28A 2LQWA 4RTTA 1VQLT 2RQTA 3M0SA 3REAB 2KMTA 3ZEHA 1CKAA 4C0DB 2XU8A 2CH4W 4EIKA 4M75F 4JLIA 1YJ9A 2C0IA 4M7AC 4MZTA 1W4SA 1T3SA 3G6EA 4J9BA 4HKEA 2L89A 4RTXA 2F5KA 3ULRB 3OYCA 1KQSA 4FIBA 1ZSZC 2F69A 2VKNA 2XHCA 3SWNC 3QKJA 4FT2A 1BBZA 2MMPA 4M7DC 3L2QA 3VV0A 1GXIE 1SPKA 1M2VB 1NYFA 5LJ3d 1B07A 2VB6A 3T9NA 4QVZA 1D09B 3UA6A 2LNHB 3FC3A 3EGXB 4R55A 2E65A 3PIOA 3CQTA 2BTTA 3M54A 3UT1A 4BD3A 2DERA 1RAAB 4A63B 2FZKB 3OB9A 2CUDA 2QGFB 3UWNA 1S1NA 2LX7A 1M1KU 2DZCA 8AT1B 5C6SA 1LJOA 5FU6C 1UDLA 1AHJB 2HDAA 3VYHB 4Q5WA 4D8KA 1WQWA 4Y91A 3FEOA 3DLLA 4A4GA 1QWEA 2LX9A 3A8GB 2DK3A 2EFIA 2D8HA 4A4HA 2J6FA 4DBFA 1WHJA 2D1XA 4IKFA 1YHQT 2F2XA 5GAOr 1Q7YR 4M78C 1VQ7Q 2LVMA 5EG2A 1ARKA 4C5HA 1AWOA 3MEAA 5FWBA 1D1BA 2M16A 2RD1A 4M7AG 2OTJT 3LGFA 4EMKC 4PJMA 5GAN8 3JCMe 3RIRA 2KT8A 4M77A 2DD4A 2X3WD 2JTFA 1VQPT 2H8HA 1JXOA 1M90C 5AT1B 1UGPB 3OQ5A 2VV5A 1M9SA 3NPFA 3OW2S 3CC2A 4M7AF 3CCJT 2V26A 4DBQA 4J5YA 2L8DA 4AFZC 1TTHB 3MHXA 3CCSA 3CXCA 2JTEA 1WXUA 3H0FA 1NE8A 2QQRA 5GAN3 5C0MA 4KUDK 1Q95G 3OA6A 5KE3A 2ABLA 2DO3A 2EYYA 2FEIA 4OVAA 4M7DF 2JOYA 4AFUC 2EQUA 5KYUB 3PT9A 1R0BG 2GTJA 2X4XA 3VJPA 4HVUA 5FLXE 4HCCA 3TU4K 3PFSA 4OB2B 3G4SA 1YJNQ 5GAMf 1MUZA 2LCCA 5GMKm 4ZN1A 3VYGA 2HQXA 4XAXB 3VUZA 2MI6A 1K0XA 4JRIA 1AD5A 2QYZA 4PJLA 5DLQE 5KYWB 3KUFA 1N9RA 3CCLQ 4LD6A 1I5OB 1OYXA 2BUDA 4C5GA 3A8OB 5GAOl 3J81E 3QG1A 2QQ9A 5GAN4 1NPRA 2YRCA 3JCMc 4ME7A 2LDMA 3JCMQ 4QW2A 1IGUA 2KGTA 3I5RA 3CC4Q 1ZHIA 1R0CB 2ZPFB 4M77D 2K5FA 1KC8U 4DOWA 2CP3A 2B86A 1X01A 1X69A 1U1TA 2KYBA 5HK0A 3THKA 4LDYA 1WHLA 3EFRA 1WXTA 5D6XA 3VS2A 3CCVQ 3FB9A 2XDDA 1T0HA 2JS2A 1M2VA 2PU9B 1AWJA 4J6WA 2RJEA 2MOXA 2DYBA 1QKXA 1M4ZA 2DL7A 3CBPA 3EGXA 1PRMC 2QK0A 3FLGA 4J9EA 1V76A 5J26A 3RNJA 4MDXA 2RO0A 2BZ8A 2J06A 5CKFA 1BU1A 4ANJA 4NL3A 3CMAA 2OTLT 1GCPA 4CRIA 4JS5A 5GAOp 2GCXA 1BI2A 1S72T 1ABQA 3JAME 5A2QE 2COWA 3G7ZA 3R6NA 3MEUA 3JB9G 1AZGB 3QYGB 1M30A 1LPLA 3TQ7P 2HSEB 4KULA 3OMCA 3JCMg 1D3BB 1P92A 3JRZA 3A98A 4C8QC 1TUGB 4J9HA 1W70A 3C94A 2E4HA 1VQ8T 1I4K1 4OGEA 3HTRA 1TOVA 2K79A 4ZTJA 2V1RA 3JB9F 3NTIA 2QQAA 2RQVA 1QCNA 2LNVA 3E9FA 1BYMA 5LJ5e 2AZSA 4XU3A 1OPLA 3EHRA 1IHVA 3JCMW 5IHKA 2OTJQ 2JT4A 1BIBA 3NTHA 3M59A 3VU3C 1I07A 4C92B 1JO8A 4HXJA 1EIFA 1VIFA 2KSSA 2RB6A 2DZ9A 2ROLA 3ME9A 2RN8A 1NZ9A 1ZX6A 3SD4A 1K1ZA 1VQKT 1M2OA 4KT0E 1VQPQ 1BKBA 4B6MA 5IT9E 2K7AA 2QI2A 4L59A 3I56T 2KYMA 3CBMA 1YJWT 5KYUA 1YITT 2DA9A 3I55A 2A08A 2X3XD 4J7FA 4F7UF 2FL7A 1N9SA 1U8RA 3CPWP 2YUQA 2XICA 1OV3A 2RK2A 2X51A 4ATOA 1VA7A 3M0TA 5GAMd 4IUTA 2YHTA 2XMFA 1YJ9T 1IHWA 3ASKA 1GCQC 2EQMA 2OAWA 1JXMA 1JU5C 1ZUUA 2AZVA 3FJ5A 1LVKA 1X75C 5KYWA 2RJFA 4M75B 3GP8A 2XK0A 2LJ1A 1KQSP 3HPWA 1BCOA 1R8OB 5HY6A 1TG0A 3SDZA 1QVGS 3BY7A 5DLOA 4C8QF 3EGUA 1IXDA 1MV3A 1KJWA 2WACA 1LNXA 1MV0B 2V8IA 4QQ6A 1X43A 2PUOB 3OW2A 4RTUA 2LCSA 2CUBA 1PSFA 3X20B 2X4JA 1M5Q1 4PJJA 4C0GA 2LJ0A 2YSQA 5I21A 1VYVA 3M0PA 4FL6A 1WYXA 2RJDA 1N6AA 4KH1B 2CKKA 4J9DA 1Q82U 2P0PA 1K8AC 1FYNA 1UG1A 2CDTA 1CKBA 2YDLA 1TH7A 1QVFS 1MMDA 2MYSA 3VKIA 3S3OA 4OMFB 1IREB 4QVDA 2FZCB 2DBMA 2DYIA 1PG5B 1YN8A 3OMGA 5FU7B 2E64A 4RTYA 1VQOA 2ZPIB 1K76A 3GBQA 4FW2A 2DL4A 2CSQA 3LWIA 5LL6S 3VS5A 1A0NB 2LJ3A 4LUEA 3I5SA 4HCZA 2QQSA 3HFNA 3GNFB 1E6GA 3QDFA 5GAOm 2DL3A 2MF2A 3UF4A 2RQWA 2GNCA 1D3BA 1OU8A 1ZA2B 2OTLQ 3LLRA 4IUUA 5LJ5g 3JV3A 1KG1A 1NJIC 1VQMQ 3OY9A 2WSEE 3CC2T 4ZGEB 2LTOA 1SRMA 5KCHA 1B3QA 2QAZA 2GFUA 3A1PA 5GANf 1K4US 1IZ6A 2EKHA 2CSIA 3CCST 3DB3A 1D0ZA 1FMVA 2NWMA 2O4XB 1W1FA 3CCEA 1OZ2A 4BY6C 2M0YA 2HZYA 3ER0A 2QEXA 2JZ2A 4M7AB 1S72A 3NMZC 1Y96B 3HHTB 4XU2A 4MMKA 1WQ7A 2FPEA 4F16A 3C95A 1LCKA 4IIMA 5GMKj 2CP6A 4MMLA 3OYFA 1ZSZB 1XNIA 2BKDN 5GMKh 3SWNB 1G3WA 2X4WA 1Q7YU 3CC7Q 4M7DB 4AMCA 5IH2A 4OB3B 3G4ST 4C92A 2LC4A 1VQ8A 3LGLA 3CCRQ 3CD6Q 3JCMh 2F2WA 1YCYA 1BI3A 2O9SA 2CGHA 2RQUA 3GPLA 2CH4A 3OYHA 2FRYA 5CR2A 3CCQQ 2L3SA 3HRUA 3HP9A 1AWXA 5I2MA 2Y4XA 5FU6B 1VQKQ 4QQGA 4PFPA 1OI1A 1TUCA 1GL5A 2Y90A 3LH0A 1IB8A 1Q86C 2OJ2A 2V1QA 2VUBA 2I2LA 2ATCB 4E7ZA 3G71Q 2VGNA 1G83A 2OAUA 3CCMT 2MK5A 2RHYA 1W2BA 2EAYA 4A53A 4BI3A 5CQYA 3JCMV 4LE9A 4M75A 4CC2A 5CCAA 2DXTA 1Q81R 1VQNA 2KI7A 2JTMA 2QG9B 2YUNA 4EMKB 4XTWA 1RLQC 1YJWA 4L6V5 4E7SA 2HQHA 5ECAA 5HCKA 3FDRA 2XDBA 3QWXX 2A37A 1TSFA 3G6EQ 2EYWA 4QT7A 3M0QA 4PL6A 1FMKA 2HBPA 2VGMA 4HCBA 2LRQA 1OOTA 4ZTFA 3CMAT 2CZ0B 3QZ5B 2PVGB 1JJ2S 2L0AA 4KGVB 1H641 1QCFA 1MMNA 1NEBA 1K73R 2YT6A 1VQ5Q 1WJQA 1EZZB 1WPYA 2KXDA 4PJOD 4TVRA 4CC7A 1U06A 2M0OA 1JEGA 1M3CA 4LDVA 3MP1A 1V29B 4Z8AA 2C06A 4ELZC 1WHMA 1WJSA 2DF6A 4ESRA 2PQWA 1SHFA 1KD1C 4XQ3A 1YI2T 5FRNA 4PJOE 2DX1A 4HT9A 2IIMA 3ZFJA 5KH6A 1K9MC 2ECZA 1TUDA 3PMIA 4FT4A 3SEMA 4OMOA 1X27A 3S3NA 2QA4A 1QLYA 2HKQB 1HD3A 2J6KA 2WSCE 4P5NA 1JBMA 1PD0A 5I11A 3L2RA 4IUVA 4M75D 4NS5A 1BI1A 5GANd 5GMKe 4RMOA 1PSEA 2F1LA 2O4XA 1MGQA 3BDUA 3NTKA 3QUIA 5CVIA 1N8RR 2LT4A 5KCOA 4M7AA 1Y96A 4J83A 4CC3A 2MPXC 2JXBA 3I55T 3KBGA 2KBTA 2NLUA 2BZYA 3EH1A 1HXDA 3MEVA 1ZSZA 3OYYA 3M0RA 2IPOB 3SWNA 1YFNA 2EQIA 4M7DA 3I9QA 1NG2A 2ROTA 2FG0A 4F7UB 4RTWA 2RMOA 1VYUA 5LJ5j 2CZ6B 4QVCA 2DIQA 2RI5A 4M77G 2DEQA 3RR6A 5LJ5h 3HSBA 5IHIA 5CKEA 1EFNA 1V1CA 1SF9A 3C4SA 4OMLA 1C1AA 1VQ7A 3H9NA 3MO8A 2DVJA 1WJRA 3REBB 3LWHA 3G4SQ 2E10A 3SHWA 3OS2A 1WZOA 3JB9I 2EJGA 5KE2A 4BI4A 2E41A 3V8KA 2R57A 1WI7A 4Z02A 3OYKA 1D1CA 1M1KC 1M1FA 1PD1A 1VQ6A 5DY9A 3OW2P 5D6YA 3L2VA 2BIVA 4HA8A 4M77F 4JZ4A 1XOVA 4C8QB 4Z88A 1RUWA 3CMET 4II1A 3P8BB 3PGGA 1SSHA 2QQBA 4E7HA 4RG8A 2HSPA 4AT1B 3VS6A 2K2VA 1VQ4T 4M78A 1FXXA 1NLPC 1UUEA 3PIPA 3META 1H3HA 4EMKA 3BW1A 4EMHA 2EGCA 1IRXA 4DBHA 4M4ZA 4N4GA 2YLCA 2Y4YA 2MAMA 1VQOT 1UGQB 1GFCA 1JQQA 1LOJA 5KYYB 2J7IA 3GF5A 1VQ9A 2E6ZA 2EYZA 1QCOA 3CBOA 3EFSA 2EJFA 2K6DA 2FYKA 1AZEA 1YJNA 5KYXB 1Y07A 2XG8D 1VQLQ 2DETA 4E2FB 3CCMA 4BE2A 4E7JA 5EC7A 4OF1A 2EWNA 3PNWC 2AT1B 2V8KA 4M7DD 1ZUYA 2G6FX 2KK4A 1M90R 3V8LA 2DM1A 4L5GA 3TREA 4EDUA 3CCLA 2RI3A 1NLOC 1K0SA 2QASA 2JUFA 3V7SA 2VASA 2CP7A 4JRPA 3E2UA 4JRKA 1BK2A 4M77E 3VS3A 3JCMb 2DKGA 3O8VA 3L2ZA 4N4HA 3CCET 4OB0B 3J80E 2YUOA 1I8FA 3L1AA 2QEXT 4ZGJB 2DILA 3ZBDA 3UATA 4JUVA 2D0QB 2PVDB 3NGPA 4PJNA 3JCMf 1T3LA 4FSSA 4F14A 4LD9K 2DIGA 1I1JA 2QDYB 1BIAA 1WIEA 3E9GA 4C5IA 2K57A 4BE0A 4YTLA 3CCVA 1JJ2A 4M78D 2DJQA 2CP0A 2H3JA 2FVUA 4FYYB 4PLIA 2C0OA 1JB0E 4Z89A 2COZA 3GLXA 3V7RA 1YI2A 4XTXA 1GBQA 2A3LA 3URGA 2JM8A 1C6VX 5LJ3e 2X9HA 1PCXA 4RTZA 2L3RA 1KC8C 4D8DA 1I81A 1FMWA 3O5ZA 1YHQQ 3FJPA 4M78E 2EQKA 3C0CA 5D6WA 3PVQA 2EGEA 3OBWA 2NUPB 4F7UA 2KDSA 3I55Q 2IVWA 1ACMB 3RKYA 2DVEA 2NUTB 5GAN5 2PVOB 2SEMA 3P8DA 1W2BP 3BE3A 3OSSC 4BDZA 2BE7D 1VQNT 2KROA 4LXCA 1MNEA 3Q1JA 1CSKA 1M8VA 4FYXB 4WTOB 3CCJQ 3CPWS 4N0AC 1G8XA 2FPFA 3RMSA 1WDXA 4XK8E 4C8QA 1G3YA 2ED1A 3D7SB 2RJCA 2E12A 3QJYA 3VRYA 1OQKA 1PHTA 1YIJT 2WSFE 4BB7A 3RERA 1PC0A 2RNAA 2JMCA 3DB4A 4BE1A 2XD0A 4IUPA 4XTVA 1YWPA 3PVLA 4BDYA 4MDWA 1U1SA 4RG2A 3VUBA 4BY6B 5IN1A 1YCSB 3RMQA 2R58A 2JVVA 1Z9QA 4J9GA 4DA4A 2Z0WA 5KYYA 1D0YA 1DJ7B 2ZPGB 3FRNA
chains in the Genus database with same CATH topology
3JB9J 5GAOr 4O6JA 4M78C 3HRUA 3HP9A 2LVMA 5EG2A 3X26B 5GAN6 3OS0A 4C5HA 1VQLA 5M9OA 3MEAA 3WVEB 2M16A 2RD1A 4EPCA 2AHJB 5I2MA 2Y4XA 5FU6B 4M7AG 2OTJT 3LGFA 3CMEA 4EMKC 3BDLA 4QQGA 1Q81U 3FIFA 5FROA 1OI1A 5GAN8 3JCMe 2Y90A 3LH0A 3RIRA 1VQ4A 1Q86C 2GF7A 4M77A 2VUBA 2DD4A 3V7CA 2I2LA 3RKXA 4RCBA 2JTFA 1VQPT 2VGNA 2OAUA 1VQMT 3QIIA 3RUXA 3CCMT 2RHYA 2QA4T 1W2BA 2XKOC 1M90C 1B34A 2EAYA 4A53A 2ZPHB 1UGPB 4BI3A 4XTUA 5CQYA 3JCMV 2R5MA 2VV5A 3OQ5A 4M75A 1VQNA 1M9SA 2DXTA 5CCAA 3OW2S 3CC2A 3CCJT 3JB9H 4M7AF 3LYIA 4J5YA 2JTMA 2L8DA 3M4GA 1ZBXA 4DOVA 4E47A 4EMKB 4XTWA 3MCAB 3MHXA 1YJWA 4L6V5 3SFMA 3JCMX 3CCSA 2HQEA 1MHNA 3CXCA 1K73U 4X34A 3CCUA 4A4FA 2MWOA 3S3MA 3FDRA 2XDBA 1Y7XA 3V8JA 2DXCA 1NE8A 1SSFA 2RM4A 4R56A 2QQRA 3EAEA 5C0MA 4FSXA 5GAN3 4KUDK 3OA6A 4PJOC 5KE3A 2DO3A 4M7DF 4OVAA 4PNOA 2JOYA 3AHUA 2EQUA 4JJNK 3PT9A 3M57A 4PL6A 4E7LA 1M1KU 1XTDA 2X4XA 2HBPA 3R6OA 3M53A 2VGMA 3QYHB 3VJPA 4QQDA 5I2SA 4HCBA 5FLXE 4J8OA 1I5LA 3CC7T 4HCCA 3JCMd 2LRQA 2LCLA 4C8QD 4ZTFA 1O75A 2CZ0B 3TEEA 4JS4A 3QZ5B 2PVGB 3CMAT 3QSUA 2E1HA 1JJ2S 5LJ5f 5LJ3g 1H641 1KQ1A 4DQ2A 1W2BS 3TU4K 3PFSA 4OB2B 3SB2A 3G4SA 1WJQA 2FHDA 5GAMf 3CCRT 3CD6T 2LCCA 4XU0A 1WPYA 4LDUA 5GMKm 4ZN1A 3VYGA 4TVRA 4Y28E 4BI8B 4PJOD 2M0OA 4LDVA 1YHQT 3MP1A 2MWPA 2HQXA 3GOXA 1V29B 4B9WA 2C06A 4XAXB 1UGRB 3VUZA 4F7UG 1KHIA 2KAFA 4PLLA 2MI6A 4ELZC 4PJOB 3CCQT 4JRIA 3CXCS 5DLQE 5A0GA 1WJSA 2ZPEB 5GANe 1VQ7T 3KUFA 1N9RA 3DKMA 2K3YA 2DAQA 3LX7A 1YHQA 2PQWA 4LD6A 1QVPA 4KUIA 3OBYA 1G3TA 1KD1C 1K8AU 2E6NA 3M58A 4RCCA 1OYXA 2VXFA 4O5VA 4XQ3A 3M56A 2BUDA 3MP6A 1YI2T 3HKSA 2JN0A 1Y71A 3MEWA 2K5IA 4C5GA 5GAOn 3A8OB 3M4YA 2OTJA 5GAOl 5FRNA 4PJOE 2X35A 3LW5E 4HT9A 3J81E 3QG1A 2QQ9A 1Q82C 1VQ6T 1H3ZA 4C5EA 3A8LB 3J7AF 3QZ9B 2XDPA 3ZFJA 3JB9D 5KH6A 4X9CA 5GAN4 1NPRA 4JLGA 1K9MC 3JCMc 1UGSB 4ME7A 2LDMA 5CQXA 2KQWA 4NL2A 1HK9A 3JCMQ 3G71T 3BFMA 4QW2A 2EQJA 3PMIA 4FT4A 2IG0A 1N8RU 1ZHIA 5GMKl 1WGSA 4LDWA 2ZPFB 4M77D 2M1HA 2K5FA 5CKHA 3S3NA 4GY5A 2E70A 1VQPA 1KC8U 1KQSS 1RI0A 4DOWA 4C8QG 2QA4A 5FRMA 2DTOA 2WSCE 4IURA 4P5NA 2VC8A 1JBMA 1X01A 4A54A 2PUKB 1U1TA 3P8HA 5HK0A 3OYNA 2RHZA 2ZZDA 3OYAA 4ZN3A 3CCJA 4PKCC 4LDYA 3L2RA 4IUVA 4PJOG 4M75D 4NS5A 3EFRA 1BI1A 1VIEA 5D6XA 3A8HB 3FB9A 5GANd 3G6ET 4XTYA 1G3SA 5GMKe 2XDDA 4RMOA 4E7KA 1PSEA 2PU9B 2O4XA 1MGQA 2GQVA 2LT1A 2RJEA 4J6WA 1N27A 3BDUA 3M55A 3NTKA 3QUIA 4J6XA 5CVIA 2LT4A 1QW1A 1M4ZA 3QDRB 4LDXA 3A5ZB 3CBPA 3FLGA 5KCOA 3HRTA 4M7AA 5J26A 4MDXA 1UEBA 2RO0A 1Y96A 4GLKA 4J83A 2EIFA 1NJIU 5CKFA 1VQ9T 3RESA 4RKUE 3I55T 3KBGA 2CYZB 2K3XA 3DLMA 3CC7A 4NL3A 3CMAA 2OTLT 4BUGA 2NLUA 3KXTA 1VQ5T 1HXDA 4CRIA 1YJNT 4JS5A 3MEVA 2GCXA 3OYYA 1BI2A 4A4KA 5GAOp 2JNGA 1S72T 3SWNA 3X24B 3WVDB 2O01E 4PJOF 3JAME 3H6ZA 4M7DA 5A2QE 3G7ZA 1OZ3A 5GAOq 3CCRA 3MEUA 3JB9G 3QJ6A 3QYGB 3QBYA 4A4EA 4F7UB 4N0AA 2GFAA 3OYBA 4KULA 4HT8A 3CC4A 3OMCA 5LJ5j 2CZ6B 3JCMg 4QVCA 1D3BB 1P92A 4D6WA 2DIQA 2RI5A 3JRZA 4M77G 2QTXA 2DEQA 4C8QC 3CCLT 5LJ5h 3E1SA 3HSBA 3OYDA 5CKEA 5GAMj 3C4SA 3C94A 1VQ7A 1VQ8T 4MZMA 4XTZA 3MO8A 3PTAA 5GAMh 1I4K1 1WJRA 3LWHA 2L5QA 4OGEA 2E10A 4OGCA 4F7UE 3OS2A 1QP2A 4E7IA 4ZTJA 2P0KA 2YRVA 3JB9I 2EJGA 5KE2A 4BI4A 4M75G 2E41A 3V8KA 4C92C 2P0QA 2RHUA 2R57A 1YIJT 3JB9F 5CKBA 4Z02A 3OYKA 1M1KC 1M1FA 1Q7YC 3NTIA 5LJ3f 3QHSA 1VQ6A 1JRIA 2QQAA 5DY9A 5D6YA 1FWZA 3NFCA 2LNVA 3L2VA 3JCMP 3CC4T 3E9FA 2BIVA 1YIJA 3A8MB 4HA8A 5CO7A 1RL2A 3G71A 4M77F 1BYMA 5LJ5e 3CEYA 1XOVA 4C8QB 5CAIA 4ELYC 1QP3A 4XU3A 3CMET 4II1A 5GAMe 3WXMB 3P8BB 3PGGA 3UPUA 4J6YA 2QQBA 4C92D 4E7HA 4JDSA 4RG8A 1BI0A 4NOYA 2K2VA 3JCMW 4JRQA 1VQ4T 2D9TA 4M78A 2D6FA 1WNLA 1BIBA 1FXXA 1YBYA 3L2UA 3NTHA 3PIPA 3M59A 3VU3C 3CCVT 4C92B 3META 1EIFA 4C8QE 1VIFA 2KSSA 2RB6A 2DZ9A 3BW1A 3ME9A 4EMKA 4EMHA 1Q86U 1NZ9A 2M9UA 2RHXA 5AYFA 3SD4A 1Q81C 3HFOA 3S6WA 1VQKT 4M77C 2YLCA 2Y4YA 3CPFA 4KT0E 1BKBA 4N4GA 2K5LA 5IT9E 1M1GA 5L8RE 5A0DA 2MAMA 4FM4B 2XIDA 2P4TA 2QI2A 1M90U 4L59A 1VQOT 1UGQB 3I56T 3HRSA 1QVGA 1LOJA 1NPPA 4XU1A 3GF5A 3CBMA 4C92E 1YJWT 2E6ZA 4CI0C 1VQ9A 1YITT 2HNIA 5GAN2 3I55A 2LQKA 4J7FA 4F7UF 2FL7A 3CBOA 3EFSA 2DXBA 4M75C 2EJFA 1N9SA 5IAYA 5GANg 1U8RA 4V2SA 2OTLA 1VQ5A 2FYKA 1YJNA 2XICA 1Y07A 2RK2A 2XG8D 4IUQA 4X9DA 3M5AA 5LJ5d 1VQMA 5CKDA 3CCMA 4BE2A 4E7JA 4ATOA 2QXFA 4OF1A 4J7IA 2CZ1B 2EWNA 2V8JA 3PNWC 5GAMd 4IUTA 2V8KA 2YHTA 2ZPBB 4M7DD 4C0FA 1O9SA 4M77B 2KK4A 1YJ9T 3V8LA 3QXEB 1K73C 4L5GA 3ASKA 4OP0A 2DJZA 4BACA 1G5VA 2EQMA 3TREA 3X28B 3MP8A 4EDUA 4PJOA 3CCLA 2EYQA 2KVQG 2RI3A 3OYMA 1X75C 2F5TX 1B34B 3F70A 4C92G 2FB7A 2JUFA 3V7SA 3GNGA 2RHIA 2EJ9A 4N4IA 4JRPA 1QVFA 2RJFA 4JRKA 4M75B 3GP8A 2XK0A 3HPWA 1R8OB 3N5BB 4M77E 5HY6A 3SDZA 4WF2A 3JCMb 1QVGS 3BY7A 3GIBA 5DLOA 2DPPB 4C8QF 2DKGA 2RH2A 2WACA 3OS5A 1LNXA 2V8IA 3O8VA 3L2ZA 4QQ6A 2PUOB 3OW2A 4N4HA 3CCET 4OB0B 5HKCA 3J80E 1KQ2A 1I8FA 5CIUA 3L1AA 4MZPA 3L2WA 2CZ7B 2QEXT 3RKWA 5GMKi 4ZGJB 5J39A 1PSFA 4M75E 3X20B 3ZBDA 4EMGA 4JUVA 2D0QB 2PVDB 1XQHA 2X4JA 5FU7C 2DXUA 4C92F 3CD6A 3L42A 3JSCA 1M5Q1 3OYLA 1X6OA 2ZGWA 3JCMf 5LJ3j 1KD1U 2X4YA 3OYGA 1KHCA 2DD5A 3QO3A 4C0GA 4LD9K 2RA2A 2DIGA 5LJ3h 2EKOA 2QDYB 1BIAA 5I21A 3E9GA 2HD0A 4C5IA 4FL6A 2K57A 2RJDA 1N6AA 3CCQA 4BE0A 2CKKA 1Q82U 1FX7A 3C12A 4YTLA 4ZGDB 3CCVA 2P0PA 2RK1A 3INZA 3QPHA 4C0DC 1K8AC 1JJ2A 4M78D 1K9MU 5GAN7 3TCJA 2G3RA 1TH7A 1QVFS 4M7DG 2H3JA 2FVUA 3OYJA 3UDCA 3VKIA 4PLIA 3S3OA 4OMFB 1IREB 3H8ZA 2KY9A 4QVDA 1VQKA 1JB0E 2VXEA 4M78B 2R5AA 3GLXA 3V7RA 1YI2A 3OMGA 2YLBA 4VUBA 3PMTA 5FU7B 4XTXA 2E5QA 2E64A 1VQOA 3I56A 2DTHA 2ZPIB 2A3LA 3URGA 5DM7R 5LJ3e 1N8RC 1ZQ1A 1VUBA 4C0ZA 1YITA 2K4YA 3HL8A 4OB1B 3CPWA 2L3RA 1KC8C 3LWIA 1VQLT 1I81A 5LL6S 3M9QA 3FJPA 4M78E 2EQKA 2KMTA 3ZEHA 4C0DB 5D6WA 2XU8A 5GANj 4HCZA 4KBMB 2QQSA 3HFNA 3OBWA 3GNFB 5GANh 4F7UA 5GAOm 4M75F 3X25B 4JLIA 1YJ9A 2A7YA 5CK9A 2KDSA 4M7AC 4MZTA 1W4SA 2IVWA 2MF2A 2CS7A 3RKYA 1D3BA 2DVEA 5GAN5 2PVOB 3G6EA 3LLRA 4HKEA 4IUUA 4UC4A 2L89A 5LJ5g 2F5KA 1KG1A 2HAXA 3P8DA 3OYCA 1NJIC 1KQSA 3OSSC 4BDZA 4FIBA 3OS1A 3OY9A 2F69A 2WSEE 5GAMg 1VQNT 3CC2T 2XHCA 3SWNC 3E19A 3QKJA 4FT2A 4ZGEB 2LTOA 2MMPA 3OYEA 3Q1JA 4M78G 5KCHA 4M7DC 5HK3A 3L2QA 2GFUA 3VV0A 5GANf 1M8VA 1IZ6A 3CCST 4M7AD 3DB3A 1GXIE 3CPWS 3CCUT 2O4XB 4N0AC 5LJ3d 3CCEA 1OZ2A 3T9NA 4QVZA 4BY6C 3ER0A 3RMSA 3FC3A 2QEXA 4R55A 2JZ2A 4M7AB 1S72A 2E65A 1Y96B 3PIOA 4XK8E 3M54A 3HHTB 3UT1A 4BD3A 4C8QA 1G3YA 4XU2A 1WQ7A 2ZCFB 2RJCA 3OSVA 2E12A 3OB9A 4MMKA 3C95A 2RI2A 3QJYA 3UWNA 5GMKj 4MMLA 3OYFA 1XNIA 2BKDN 4M78F 2DZCA 1G3WA 2LQ8A 2WSFE 2X4WA 3SWNB 4BB7A 4FU6A 5GMKh 1Q7YU 3RERA 5C6SA 4M7DB 1LJOA 5FU6C 4OB3B 3G4ST 4M7AE 1AHJB 4C92A 2LC4A 1UB4A 3VYHB 3DB4A 4Q5WA 1VQ8A 3LGLA 4BE1A 2XD0A 4IUPA 4XTVA 1WQWA 4BDYA 4MDWA 1U1SA 4Y91A 4RG2A 3JCMh 3VUBA 4BY6B 3OYIA 5IN1A 3JCMJ 3FEOA 3DLLA 4A4GA 3RMQA 1YCYA 2R58A 2XI9A 1BI3A 2LX9A 2DTIA 2CGHA 2JVVA 3A8GB 2DK3A 5A0LA 3GPLA 2VYTA 5J3BA 4B9XA 2EFIA 4DA4A 4M7DE 3OYHA 4A4HA 2B8AA 5CR2A 4IKFA 1DJ7B 2ZPGB 3FRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KG1 A; 
#chains in the Genus database with same CATH topology
 3X26 B;  3OS0 A;  2O31 A;  5GAN 6;  3EFO B;  4CC4 B;  5KYX A;  4PK4 A;  3CME A;  1Q81 U;  3FIF A;  5FRO A;  4DEX A;  2DBK A;  1QVG P;  1VQ4 A;  3KFV A;  2GF7 A;  3V7C A;  1U5S A;  3MJX A;  3RKX A;  2HCK A;  2QA4 T;  2XKO C;  1YNZ A;  2ZPH B;  4XTU A;  1ZA1 B;  2R5M A;  2K3B A;  4LN2 A;  1ZBX A;  3LH5 A;  4E47 A;  1KIK A;  3SFM A;  3JCM X;  1IGQ A;  5D7U A;  1K73 U;  3CCU A;  2MWO A;  1Y7X A;  1X6B A;  2DXC A;  2KNB B;  1QWF A;  3EAE A;  4FSX A;  1GCQ A;  1UEC A;  4PJO C;  2DE0 X;  4PNO A;  3AHU A;  2NYS A;  1UGV A;  1XTD A;  2PTK A;  3R6O A;  3EG3 A;  3QYH B;  1Y57 A;  2D0N A;  1NM7 A;  2YRD A;  5I2S A;  3JCM d;  2LCL A;  4C8Q D;  3TEE A;  4JS4 A;  3QSU A;  2PNI A;  5LJ5 f;  5LJ3 g;  3CCE Q;  3SB2 A;  1GFD A;  2QEX Q;  1S72 Q;  4LDU A;  4BI8 B;  1RI9 A;  1UGR B;  1KHI A;  1NYG A;  3CXC S;  2ZPE B;  1VQ7 T;  2KR3 A;  1R77 A;  3DKM A;  2K3Y A;  3LX7 A;  2EBP A;  1QVP A;  3OBY A;  1KFZ A;  1G3T A;  2E6N A;  3M58 A;  4RCC A;  1VQ8 Q;  3M56 A;  3HKS A;  2O9V A;  5GAO n;  2K5I A;  3M4Y A;  2X35 A;  3LW5 E;  1VQ6 T;  1Q82 C;  4C5E A;  3J7A F;  2XDP A;  4X9C A;  5CQX A;  2E3I A;  4NL2 A;  2NUP A;  3BFM A;  1MMA A;  2EQJ A;  1U3O A;  1ZBJ A;  1N8R U;  5GMK l;  1WGS A;  4LDW A;  2NUT A;  4GY5 A;  2E70 A;  1OX9 A;  1RI0 A;  3H41 A;  1K8A R;  5FRM A;  4IUR A;  3OYN A;  3OYA A;  1E7O A;  4ZN3 A;  4PKC C;  1HYO A;  4PJO G;  1RAH B;  3A8H B;  2LT1 A;  4GLM A;  1N27 A;  3M55 A;  4KRT A;  3QDR B;  4LDX A;  3A5Z B;  3HRT A;  4AG2 C;  1VQ9 T;  2BE9 B;  3QWY A;  2E5K A;  2EYX A;  3I56 Q;  4FYW B;  3CC7 A;  2PZ1 A;  1YJW Q;  1YIT Q;  3KXT A;  1UJY A;  1VOM A;  1YJN T;  4A4K A;  5FWC A;  4PJO F;  2DL8 A;  3H6Z A;  3VS4 A;  2KT1 A;  2O88 A;  1ZSG A;  5GAO q;  3CCR A;  3QJ6 A;  2E3H A;  4A4E A;  2GFA A;  4HVV A;  2KEA A;  1NJI R;  1YJ9 Q;  3CCL T;  2RPN A;  3E1S A;  4WCI A;  3RBB B;  4MZM A;  4XTZ A;  2L5Q A;  1QP2 A;  1PKT A;  4E7I A;  2P0K A;  3EFO A;  1D1A A;  3EG2 A;  4M75 G;  5CKB A;  1Q7Y C;  3QHS A;  1FWZ A;  3JCM P;  3CC4 T;  1YIJ A;  3A8M B;  3G71 A;  4OMM A;  1UFF A;  2DNU A;  1H8K A;  3CEY A;  5CAI A;  4ELY C;  1K9A A;  1QP3 A;  2HL3 A;  4FYV B;  2GQI A;  2EVR A;  1EX4 A;  2OI3 A;  5GAM e;  3WXM B;  4C92 D;  4JDS A;  4JRQ A;  2D6F A;  3L2U A;  1OX8 A;  1YBY A;  2K2M A;  3CCV T;  1JJ2 P;  1TU0 B;  2M9U A;  2RHX A;  3HFO A;  4M77 C;  3CPF A;  2K5L A;  1M1G A;  5A0D A;  2QA4 Q;  4FM4 B;  2XID A;  2P4T A;  3NHN A;  1M90 U;  3HRS A;  1QVG A;  1NPP A;  1WXB A;  4C92 E;  2P4R A;  5IXB A;  5GAN 2;  2LQK A;  5FW9 A;  2DXB A;  2YXY A;  1PM3 A;  1QKW A;  3EG9 B;  1VQ5 A;  1Q86 R;  5LJ5 d;  4IUQ A;  4X9D A;  1ABO A;  5CKD A;  2QXF A;  4J7I A;  2CZ1 B;  2V8J A;  3G1J A;  5I22 A;  4C0F A;  1O9S A;  2NUZ A;  3EGD B;  4F17 A;  4IIO A;  4OP0 A;  4ZNX A;  2DJZ A;  4BAC A;  1F1B B;  1B34 B;  3F70 A;  3GNG A;  2RHI A;  4N4I A;  1QVF A;  1WHK A;  1RAG B;  3GIB A;  4WF2 A;  3OS5 A;  3CC2 Q;  2GGR A;  1HJD A;  1Z9Z A;  3CCS Q;  5CIU A;  4MZP A;  1WX6 A;  2DRM A;  5J39 A;  4M75 E;  4EMG A;  4JJD A;  1XQH A;  1X6G A;  2JW4 A;  3OYL A;  1X6O A;  2ZGW A;  5GJW B;  5LJ3 j;  2X4Y A;  2DD5 A;  2HEQ A;  5LJ3 h;  1RAC B;  4GBQ A;  4KH0 B;  2HD0 A;  1VQ6 Q;  2K9G A;  3C12 A;  3H0H A;  3EG1 A;  4ZGD B;  2RK1 A;  3QPH A;  1UHC A;  4C0D C;  2D8J A;  1RAD B;  1PNJ A;  4M7D G;  3OYJ A;  3UDC A;  2R5A A;  2KRS A;  3VS0 A;  4VUB A;  3PMT A;  1KD1 R;  2DTH A;  4J9I A;  5DM7 R;  2FZG B;  1VUB A;  2K4Y A;  1SG5 A;  3HL8 A;  4OB1 B;  3TVT A;  3M9Q A;  1MND A;  1K9M R;  1BCM A;  2M02 A;  5GAN j;  4KBM B;  2MCN A;  2JJ9 A;  5KYN A;  1BB9 A;  1RAB B;  5GAN h;  3X25 B;  1VQ9 Q;  2A7Y A;  5CK9 A;  3EH2 A;  2FRW A;  1SKU B;  2CS7 A;  8ATC B;  2DFU A;  4UC4 A;  2HAX A;  1RAE B;  2MIO A;  3CCM Q;  3OS1 A;  5GAM g;  3E19 A;  1J3T A;  3OYE A;  4M78 G;  4HCK A;  5HK3 A;  4M7A D;  1TWB A;  3CCU T;  3IQL A;  2J05 A;  2YWW A;  3MPU B;  1HSQ A;  1UJ0 A;  9ATC B;  3VRZ A;  2ZCF B;  3OSV A;  4R0K A;  2RI2 A;  1NEG A;  1RAI B;  4M78 F;  2LQ8 A;  1KSW A;  1GRI A;  4FU6 A;  3CMA Q;  4M7A E;  2FPD A;  1UB4 A;  1XJW B;  2OX7 A;  4K11 A;  3JCM J;  3OYI A;  1TXQ A;  2AIR B;  1IO6 A;  2XI9 A;  2DTI A;  5A0L A;  2VYT A;  5J3B A;  4B9X A;  1AWW A;  4M7D E;  4RUG A;  2B8A A;  3PE0 A;  4OMQ A;  1M1K R;  3CC4 A;  3JB9 J;  1X2K A;  4O6J A;  2KRN A;  1VQL A;  5M9O A;  3WVE B;  3EG9 A;  1OPK A;  4EPC A;  2AHJ B;  1PRL C;  4PFZ A;  3BDL A;  2W0Z A;  4KGZ B;  1YI2 Q;  2CP5 A;  2M51 A;  2W10 A;  3EGD A;  4PFO A;  5IHN A;  4RTV A;  4RCB A;  4JPB W;  3AT1 B;  1VQM T;  3QII A;  3RUX A;  2ED0 A;  1AEY A;  1B34 A;  2AKK A;  1N5Z A;  1WFW A;  2A0F B;  1RLP C;  3JB9 H;  1T0J A;  1WHH A;  3LYI A;  3M4G A;  4DOV A;  3MCA B;  1C0M A;  4FW1 A;  4LNP A;  2HQE A;  1MHN A;  3UA7 A;  3I35 A;  4X34 A;  4A4F A;  1SRL A;  3S3M A;  3V8J A;  2QGG A;  1D0X A;  1SSF A;  2RM4 A;  4R56 A;  2HBW A;  4HVW A;  5GJV B;  2QDL A;  2I0N A;  2DL5 A;  4AFQ C;  4JJN K;  3M57 A;  4E7L A;  3M53 A;  4QQD A;  1VYT A;  4J8O A;  1I5L A;  3CC7 T;  1O75 A;  5L23 A;  2E1H A;  2COY A;  2JMA A;  1KQ1 A;  4DQ2 A;  3H0I A;  1W2B S;  1KK7 A;  2FHD A;  3CCR T;  3CD6 T;  1AT1 B;  4XU0 A;  4LUD A;  4Y28 E;  1AOJ A;  3TSZ A;  2MWP A;  3GOX A;  4B9W A;  2EW3 A;  2ESW A;  4F7U G;  2KAF A;  4PLL A;  4PJO B;  3CCQ T;  5A0G A;  5GAN e;  1X2Q A;  4J9F A;  2DAQ A;  1YHQ A;  4KUI A;  1K8A U;  2VXF A;  4O5V A;  3MP6 A;  2JN0 A;  1Y71 A;  1M8M A;  3MEW A;  2OTJ A;  2AKL A;  1H3Z A;  1OU9 A;  4DEY A;  3A8L B;  3QZ9 B;  2A36 A;  2QTV A;  3JB9 D;  4JLG A;  3MKD A;  1UGS B;  3G71 T;  2KQW A;  1HK9 A;  1NBE B;  2IG0 A;  2HKN A;  3TSW A;  2M1H A;  5CKH A;  1VQP A;  1KQS S;  1ZLM A;  4C8Q G;  2DTO A;  3CME Q;  4JZ3 A;  2VC8 A;  4A54 A;  2PUK B;  1YWO A;  3P8H A;  2RHZ A;  2ZZD A;  3CCJ A;  1WA7 A;  1VQ4 Q;  5IXF A;  2EPD A;  1VIE A;  3G6E T;  2P84 A;  4XTY A;  1G3S A;  4E7K A;  2GQV A;  4J6X A;  1QW1 A;  1SEM A;  2YUP A;  2LQN A;  2F2V A;  1KC8 R;  1UEB A;  4GLK A;  2EGA A;  2CT4 A;  2EIF A;  2LZ6 B;  1NJI U;  3RES A;  4RKU E;  1RAF B;  1VQO Q;  2CYZ B;  2KE9 A;  2K3X A;  2KRM A;  2L2P A;  3DLM A;  4J9C A;  4BUG A;  1VQ5 T;  3CCU Q;  2JNG A;  3EG0 A;  3X24 B;  3WVD B;  2O01 E;  1OZ3 A;  3QBY A;  4DBR A;  4N0A A;  3OYB A;  4HT8 A;  2H3E B;  1M3B A;  4D6W A;  3RDV A;  2QTX A;  1TS9 A;  2JS0 A;  4E6R A;  3U23 A;  3OYD A;  5GAM j;  3PTA A;  5GAM h;  4OGC A;  4F7U E;  4JJB A;  1QVF P;  2YRV A;  3ZL7 C;  2P0Q A;  2RHU A;  4C92 C;  1H92 A;  5LJ3 f;  1WHG A;  2DLP A;  1JRI A;  3NFC A;  4ORZ A;  2GBQ A;  2HMA A;  1E6H A;  5CO7 A;  1RL2 A;  2DMO A;  4QKU A;  2RF0 A;  2L3Q A;  2LMJ A;  4J6Y A;  3UPU A;  2DEU A;  1BI0 A;  4NOY A;  2D9T A;  1WNL A;  4X1V A;  1GBR A;  1UTI A;  4C8Q E;  2DRK A;  1Q86 U;  1WLP B;  2CP2 A;  5AYF A;  1Q81 C;  3S6W A;  6AT1 B;  4OMN A;  5L8R E;  1QMC A;  2HL5 C;  2GTO A;  2AK5 A;  1ZUK A;  4XU1 A;  4CI0 C;  2HNI A;  1MMG A;  2KXC A;  4M75 C;  5IAY A;  5GAN g;  3CXC P;  4V2S A;  2OTL A;  3M5A A;  1VQM A;  1Y0M A;  4AFS C;  2RQR A;  2VVK A;  1B7T A;  2ENM A;  2ZPB B;  4M77 B;  1I0C A;  3QXE B;  1K73 C;  4OMP A;  1G5V A;  1M27 C;  3X28 B;  3MP8 A;  4PJO A;  2EYQ A;  2KVQ G;  3OYM A;  2F5T X;  4C92 G;  2FB7 A;  4AG1 C;  2EJ9 A;  4Y92 A;  3N5B B;  1AVZ C;  1OEB A;  2DPP B;  1UE9 A;  1VQN Q;  2RH2 A;  3M0U A;  4F04 B;  7AT1 B;  5HKC A;  1KQ2 A;  3VS1 A;  2C0T A;  1PKS A;  3L2W A;  1UHF A;  2CZ7 B;  3RKW A;  5GMK i;  2FO0 A;  3EHQ A;  2SRC A;  5FU7 C;  2DXU A;  4C92 F;  1W6X A;  1QQJ A;  4FCY A;  3CD6 A;  3L42 A;  3JSC A;  2L3P A;  2J6O A;  1KD1 U;  1SHG A;  3OYG A;  1OUL A;  1KHC A;  3QO3 A;  2RA2 A;  2EKO A;  2CRE A;  1PWT A;  2CT3 A;  2ZAE A;  3CCQ A;  1FX7 A;  1YP5 A;  3INZ A;  4KGX B;  1YIJ Q;  1K9M U;  5GAN 7;  3TCJ A;  2G3R A;  2O2O A;  2VWF A;  3H8Z A;  2KY9 A;  1VQK A;  2VXE A;  4M78 B;  2LP5 A;  2YLB A;  2E5Q A;  3I56 A;  4JJC A;  1N8R C;  1ZQ1 A;  4C0Z A;  2BZX A;  1G2B A;  1YIT A;  2JM9 A;  1Q82 R;  3CPW A;  3VS7 A;  1M3A A;  2A28 A;  2LQW A;  4RTT A;  1VQL T;  2RQT A;  3M0S A;  3REA B;  2KMT A;  3ZEH A;  1CKA A;  4C0D B;  2XU8 A;  2CH4 W;  4EIK A;  4M75 F;  4JLI A;  1YJ9 A;  2C0I A;  4M7A C;  4MZT A;  1W4S A;  1T3S A;  3G6E A;  4J9B A;  4HKE A;  2L89 A;  4RTX A;  2F5K A;  3ULR B;  3OYC A;  1KQS A;  4FIB A;  1ZSZ C;  2F69 A;  2VKN A;  2XHC A;  3SWN C;  3QKJ A;  4FT2 A;  1BBZ A;  2MMP A;  4M7D C;  3L2Q A;  3VV0 A;  1GXI E;  1SPK A;  1M2V B;  1NYF A;  5LJ3 d;  1B07 A;  2VB6 A;  3T9N A;  4QVZ A;  1D09 B;  3UA6 A;  2LNH B;  3FC3 A;  3EGX B;  4R55 A;  2E65 A;  3PIO A;  3CQT A;  2BTT A;  3M54 A;  3UT1 A;  4BD3 A;  2DER A;  1RAA B;  4A63 B;  2FZK B;  3OB9 A;  2CUD A;  2QGF B;  3UWN A;  1S1N A;  2LX7 A;  1M1K U;  2DZC A;  8AT1 B;  5C6S A;  1LJO A;  5FU6 C;  1UDL A;  1AHJ B;  2HDA A;  3VYH B;  4Q5W A;  4D8K A;  1WQW A;  4Y91 A;  3FEO A;  3DLL A;  4A4G A;  1QWE A;  2LX9 A;  3A8G B;  2DK3 A;  2EFI A;  2D8H A;  4A4H A;  2J6F A;  4DBF A;  1WHJ A;  2D1X A;  4IKF A;  1YHQ T;  2F2X A;  5GAO r;  1Q7Y R;  4M78 C;  1VQ7 Q;  2LVM A;  5EG2 A;  1ARK A;  4C5H A;  1AWO A;  3MEA A;  5FWB A;  1D1B A;  2M16 A;  2RD1 A;  4M7A G;  2OTJ T;  3LGF A;  4EMK C;  4PJM A;  5GAN 8;  3JCM e;  3RIR A;  2KT8 A;  4M77 A;  2DD4 A;  2X3W D;  2JTF A;  1VQP T;  2H8H A;  1JXO A;  1M90 C;  5AT1 B;  1UGP B;  3OQ5 A;  2VV5 A;  1M9S A;  3NPF A;  3OW2 S;  3CC2 A;  4M7A F;  3CCJ T;  2V26 A;  4DBQ A;  4J5Y A;  2L8D A;  4AFZ C;  1TTH B;  3MHX A;  3CCS A;  3CXC A;  2JTE A;  1WXU A;  3H0F A;  1NE8 A;  2QQR A;  5GAN 3;  5C0M A;  4KUD K;  1Q95 G;  3OA6 A;  5KE3 A;  2ABL A;  2DO3 A;  2EYY A;  2FEI A;  4OVA A;  4M7D F;  2JOY A;  4AFU C;  2EQU A;  5KYU B;  3PT9 A;  1R0B G;  2GTJ A;  2X4X A;  3VJP A;  4HVU A;  5FLX E;  4HCC A;  3TU4 K;  3PFS A;  4OB2 B;  3G4S A;  1YJN Q;  5GAM f;  1MUZ A;  2LCC A;  5GMK m;  4ZN1 A;  3VYG A;  2HQX A;  4XAX B;  3VUZ A;  2MI6 A;  1K0X A;  4JRI A;  1AD5 A;  2QYZ A;  4PJL A;  5DLQ E;  5KYW B;  3KUF A;  1N9R A;  3CCL Q;  4LD6 A;  1I5O B;  1OYX A;  2BUD A;  4C5G A;  3A8O B;  5GAO l;  3J81 E;  3QG1 A;  2QQ9 A;  5GAN 4;  1NPR A;  2YRC A;  3JCM c;  4ME7 A;  2LDM A;  3JCM Q;  4QW2 A;  1IGU A;  2KGT A;  3I5R A;  3CC4 Q;  1ZHI A;  1R0C B;  2ZPF B;  4M77 D;  2K5F A;  1KC8 U;  4DOW A;  2CP3 A;  2B86 A;  1X01 A;  1X69 A;  1U1T A;  2KYB A;  5HK0 A;  3THK A;  4LDY A;  1WHL A;  3EFR A;  1WXT A;  5D6X A;  3VS2 A;  3CCV Q;  3FB9 A;  2XDD A;  1T0H A;  2JS2 A;  1M2V A;  2PU9 B;  1AWJ A;  4J6W A;  2RJE A;  2MOX A;  2DYB A;  1QKX A;  1M4Z A;  2DL7 A;  3CBP A;  3EGX A;  1PRM C;  2QK0 A;  3FLG A;  4J9E A;  1V76 A;  5J26 A;  3RNJ A;  4MDX A;  2RO0 A;  2BZ8 A;  2J06 A;  5CKF A;  1BU1 A;  4ANJ A;  4NL3 A;  3CMA A;  2OTL T;  1GCP A;  4CRI A;  4JS5 A;  5GAO p;  2GCX A;  1BI2 A;  1S72 T;  1ABQ A;  3JAM E;  5A2Q E;  2COW A;  3G7Z A;  3R6N A;  3MEU A;  3JB9 G;  1AZG B;  3QYG B;  1M30 A;  1LPL A;  3TQ7 P;  2HSE B;  4KUL A;  3OMC A;  3JCM g;  1D3B B;  1P92 A;  3JRZ A;  3A98 A;  4C8Q C;  1TUG B;  4J9H A;  1W70 A;  3C94 A;  2E4H A;  1VQ8 T;  1I4K 1;  4OGE A;  3HTR A;  1TOV A;  2K79 A;  4ZTJ A;  2V1R A;  3JB9 F;  3NTI A;  2QQA A;  2RQV A;  1QCN A;  2LNV A;  3E9F A;  1BYM A;  5LJ5 e;  2AZS A;  4XU3 A;  1OPL A;  3EHR A;  1IHV A;  3JCM W;  5IHK A;  2OTJ Q;  2JT4 A;  1BIB A;  3NTH A;  3M59 A;  3VU3 C;  1I07 A;  4C92 B;  1JO8 A;  4HXJ A;  1EIF A;  1VIF A;  2KSS A;  2RB6 A;  2DZ9 A;  2ROL A;  3ME9 A;  2RN8 A;  1NZ9 A;  1ZX6 A;  3SD4 A;  1K1Z A;  1VQK T;  1M2O A;  4KT0 E;  1VQP Q;  1BKB A;  4B6M A;  5IT9 E;  2K7A A;  2QI2 A;  4L59 A;  3I56 T;  2KYM A;  3CBM A;  1YJW T;  5KYU A;  1YIT T;  2DA9 A;  3I55 A;  2A08 A;  2X3X D;  4J7F A;  4F7U F;  2FL7 A;  1N9S A;  1U8R A;  3CPW P;  2YUQ A;  2XIC A;  1OV3 A;  2RK2 A;  2X51 A;  4ATO A;  1VA7 A;  3M0T A;  5GAM d;  4IUT A;  2YHT A;  2XMF A;  1YJ9 T;  1IHW A;  3ASK A;  1GCQ C;  2EQM A;  2OAW A;  1JXM A;  1JU5 C;  1ZUU A;  2AZV A;  3FJ5 A;  1LVK A;  1X75 C;  5KYW A;  2RJF A;  4M75 B;  3GP8 A;  2XK0 A;  2LJ1 A;  1KQS P;  3HPW A;  1BCO A;  1R8O B;  5HY6 A;  1TG0 A;  3SDZ A;  1QVG S;  3BY7 A;  5DLO A;  4C8Q F;  3EGU A;  1IXD A;  1MV3 A;  1KJW A;  2WAC A;  1LNX A;  1MV0 B;  2V8I A;  4QQ6 A;  1X43 A;  2PUO B;  3OW2 A;  4RTU A;  2LCS A;  2CUB A;  1PSF A;  3X20 B;  2X4J A;  1M5Q 1;  4PJJ A;  4C0G A;  2LJ0 A;  2YSQ A;  5I21 A;  1VYV A;  3M0P A;  4FL6 A;  1WYX A;  2RJD A;  1N6A A;  4KH1 B;  2CKK A;  4J9D A;  1Q82 U;  2P0P A;  1K8A C;  1FYN A;  1UG1 A;  2CDT A;  1CKB A;  2YDL A;  1TH7 A;  1QVF S;  1MMD A;  2MYS A;  3VKI A;  3S3O A;  4OMF B;  1IRE B;  4QVD A;  2FZC B;  2DBM A;  2DYI A;  1PG5 B;  1YN8 A;  3OMG A;  5FU7 B;  2E64 A;  4RTY A;  1VQO A;  2ZPI B;  1K76 A;  3GBQ A;  4FW2 A;  2DL4 A;  2CSQ A;  3LWI A;  5LL6 S;  3VS5 A;  1A0N B;  2LJ3 A;  4LUE A;  3I5S A;  4HCZ A;  2QQS A;  3HFN A;  3GNF B;  1E6G A;  3QDF A;  5GAO m;  2DL3 A;  2MF2 A;  3UF4 A;  2RQW A;  2GNC A;  1D3B A;  1OU8 A;  1ZA2 B;  2OTL Q;  3LLR A;  4IUU A;  5LJ5 g;  3JV3 A;  1KG1 A;  1NJI C;  1VQM Q;  3OY9 A;  2WSE E;  3CC2 T;  4ZGE B;  2LTO A;  1SRM A;  5KCH A;  1B3Q A;  2QAZ A;  2GFU A;  3A1P A;  5GAN f;  1K4U S;  1IZ6 A;  2EKH A;  2CSI A;  3CCS T;  3DB3 A;  1D0Z A;  1FMV A;  2NWM A;  2O4X B;  1W1F A;  3CCE A;  1OZ2 A;  4BY6 C;  2M0Y A;  2HZY A;  3ER0 A;  2QEX A;  2JZ2 A;  4M7A B;  1S72 A;  3NMZ C;  1Y96 B;  3HHT B;  4XU2 A;  4MMK A;  1WQ7 A;  2FPE A;  4F16 A;  3C95 A;  1LCK A;  4IIM A;  5GMK j;  2CP6 A;  4MML A;  3OYF A;  1ZSZ B;  1XNI A;  2BKD N;  5GMK h;  3SWN B;  1G3W A;  2X4W A;  1Q7Y U;  3CC7 Q;  4M7D B;  4AMC A;  5IH2 A;  4OB3 B;  3G4S T;  4C92 A;  2LC4 A;  1VQ8 A;  3LGL A;  3CCR Q;  3CD6 Q;  3JCM h;  2F2W A;  1YCY A;  1BI3 A;  2O9S A;  2CGH A;  2RQU A;  3GPL A;  2CH4 A;  3OYH A;  2FRY A;  5CR2 A;  3CCQ Q;  2L3S A;  3HRU A;  3HP9 A;  1AWX A;  5I2M A;  2Y4X A;  5FU6 B;  1VQK Q;  4QQG A;  4PFP A;  1OI1 A;  1TUC A;  1GL5 A;  2Y90 A;  3LH0 A;  1IB8 A;  1Q86 C;  2OJ2 A;  2V1Q A;  2VUB A;  2I2L A;  2ATC B;  4E7Z A;  3G71 Q;  2VGN A;  1G83 A;  2OAU A;  3CCM T;  2MK5 A;  2RHY A;  1W2B A;  2EAY A;  4A53 A;  4BI3 A;  5CQY A;  3JCM V;  4LE9 A;  4M75 A;  4CC2 A;  5CCA A;  2DXT A;  1Q81 R;  1VQN A;  2KI7 A;  2JTM A;  2QG9 B;  2YUN A;  4EMK B;  4XTW A;  1RLQ C;  1YJW A;  4L6V 5;  4E7S A;  2HQH A;  5ECA A;  5HCK A;  3FDR A;  2XDB A;  3QWX X;  2A37 A;  1TSF A;  3G6E Q;  2EYW A;  4QT7 A;  3M0Q A;  4PL6 A;  1FMK A;  2HBP A;  2VGM A;  4HCB A;  2LRQ A;  1OOT A;  4ZTF A;  3CMA T;  2CZ0 B;  3QZ5 B;  2PVG B;  1JJ2 S;  2L0A A;  4KGV B;  1H64 1;  1QCF A;  1MMN A;  1NEB A;  1K73 R;  2YT6 A;  1VQ5 Q;  1WJQ A;  1EZZ B;  1WPY A;  2KXD A;  4PJO D;  4TVR A;  4CC7 A;  1U06 A;  2M0O A;  1JEG A;  1M3C A;  4LDV A;  3MP1 A;  1V29 B;  4Z8A A;  2C06 A;  4ELZ C;  1WHM A;  1WJS A;  2DF6 A;  4ESR A;  2PQW A;  1SHF A;  1KD1 C;  4XQ3 A;  1YI2 T;  5FRN A;  4PJO E;  2DX1 A;  4HT9 A;  2IIM A;  3ZFJ A;  5KH6 A;  1K9M C;  2ECZ A;  1TUD A;  3PMI A;  4FT4 A;  3SEM A;  4OMO A;  1X27 A;  3S3N A;  2QA4 A;  1QLY A;  2HKQ B;  1HD3 A;  2J6K A;  2WSC E;  4P5N A;  1JBM A;  1PD0 A;  5I11 A;  3L2R A;  4IUV A;  4M75 D;  4NS5 A;  1BI1 A;  5GAN d;  5GMK e;  4RMO A;  1PSE A;  2F1L A;  2O4X A;  1MGQ A;  3BDU A;  3NTK A;  3QUI A;  5CVI A;  1N8R R;  2LT4 A;  5KCO A;  4M7A A;  1Y96 A;  4J83 A;  4CC3 A;  2MPX C;  2JXB A;  3I55 T;  3KBG A;  2KBT A;  2NLU A;  2BZY A;  3EH1 A;  1HXD A;  3MEV A;  1ZSZ A;  3OYY A;  3M0R A;  2IPO B;  3SWN A;  1YFN A;  2EQI A;  4M7D A;  3I9Q A;  1NG2 A;  2ROT A;  2FG0 A;  4F7U B;  4RTW A;  2RMO A;  1VYU A;  5LJ5 j;  2CZ6 B;  4QVC A;  2DIQ A;  2RI5 A;  4M77 G;  2DEQ A;  3RR6 A;  5LJ5 h;  3HSB A;  5IHI A;  5CKE A;  1EFN A;  1V1C A;  1SF9 A;  3C4S A;  4OML A;  1C1A A;  1VQ7 A;  3H9N A;  3MO8 A;  2DVJ A;  1WJR A;  3REB B;  3LWH A;  3G4S Q;  2E10 A;  3SHW A;  3OS2 A;  1WZO A;  3JB9 I;  2EJG A;  5KE2 A;  4BI4 A;  2E41 A;  3V8K A;  2R57 A;  1WI7 A;  4Z02 A;  3OYK A;  1D1C A;  1M1K C;  1M1F A;  1PD1 A;  1VQ6 A;  5DY9 A;  3OW2 P;  5D6Y A;  3L2V A;  2BIV A;  4HA8 A;  4M77 F;  4JZ4 A;  1XOV A;  4C8Q B;  4Z88 A;  1RUW A;  3CME T;  4II1 A;  3P8B B;  3PGG A;  1SSH A;  2QQB A;  4E7H A;  4RG8 A;  2HSP A;  4AT1 B;  3VS6 A;  2K2V A;  1VQ4 T;  4M78 A;  1FXX A;  1NLP C;  1UUE A;  3PIP A;  3MET A;  1H3H A;  4EMK A;  3BW1 A;  4EMH A;  2EGC A;  1IRX A;  4DBH A;  4M4Z A;  4N4G A;  2YLC A;  2Y4Y A;  2MAM A;  1VQO T;  1UGQ B;  1GFC A;  1JQQ A;  1LOJ A;  5KYY B;  2J7I A;  3GF5 A;  1VQ9 A;  2E6Z A;  2EYZ A;  1QCO A;  3CBO A;  3EFS A;  2EJF A;  2K6D A;  2FYK A;  1AZE A;  1YJN A;  5KYX B;  1Y07 A;  2XG8 D;  1VQL Q;  2DET A;  4E2F B;  3CCM A;  4BE2 A;  4E7J A;  5EC7 A;  4OF1 A;  2EWN A;  3PNW C;  2AT1 B;  2V8K A;  4M7D D;  1ZUY A;  2G6F X;  2KK4 A;  1M90 R;  3V8L A;  2DM1 A;  4L5G A;  3TRE A;  4EDU A;  3CCL A;  2RI3 A;  1NLO C;  1K0S A;  2QAS A;  2JUF A;  3V7S A;  2VAS A;  2CP7 A;  4JRP A;  3E2U A;  4JRK A;  1BK2 A;  4M77 E;  3VS3 A;  3JCM b;  2DKG A;  3O8V A;  3L2Z A;  4N4H A;  3CCE T;  4OB0 B;  3J80 E;  2YUO A;  1I8F A;  3L1A A;  2QEX T;  4ZGJ B;  2DIL A;  3ZBD A;  3UAT A;  4JUV A;  2D0Q B;  2PVD B;  3NGP A;  4PJN A;  3JCM f;  1T3L A;  4FSS A;  4F14 A;  4LD9 K;  2DIG A;  1I1J A;  2QDY B;  1BIA A;  1WIE A;  3E9G A;  4C5I A;  2K57 A;  4BE0 A;  4YTL A;  3CCV A;  1JJ2 A;  4M78 D;  2DJQ A;  2CP0 A;  2H3J A;  2FVU A;  4FYY B;  4PLI A;  2C0O A;  1JB0 E;  4Z89 A;  2COZ A;  3GLX A;  3V7R A;  1YI2 A;  4XTX A;  1GBQ A;  2A3L A;  3URG A;  2JM8 A;  1C6V X;  5LJ3 e;  2X9H A;  1PCX A;  4RTZ A;  2L3R A;  1KC8 C;  4D8D A;  1I81 A;  1FMW A;  3O5Z A;  1YHQ Q;  3FJP A;  4M78 E;  2EQK A;  3C0C A;  5D6W A;  3PVQ A;  2EGE A;  3OBW A;  2NUP B;  4F7U A;  2KDS A;  3I55 Q;  2IVW A;  1ACM B;  3RKY A;  2DVE A;  2NUT B;  5GAN 5;  2PVO B;  2SEM A;  3P8D A;  1W2B P;  3BE3 A;  3OSS C;  4BDZ A;  2BE7 D;  1VQN T;  2KRO A;  4LXC A;  1MNE A;  3Q1J A;  1CSK A;  1M8V A;  4FYX B;  4WTO B;  3CCJ Q;  3CPW S;  4N0A C;  1G8X A;  2FPF A;  3RMS A;  1WDX A;  4XK8 E;  4C8Q A;  1G3Y A;  2ED1 A;  3D7S B;  2RJC A;  2E12 A;  3QJY A;  3VRY A;  1OQK A;  1PHT A;  1YIJ T;  2WSF E;  4BB7 A;  3RER A;  1PC0 A;  2RNA A;  2JMC A;  3DB4 A;  4BE1 A;  2XD0 A;  4IUP A;  4XTV A;  1YWP A;  3PVL A;  4BDY A;  4MDW A;  1U1S A;  4RG2 A;  3VUB A;  4BY6 B;  5IN1 A;  1YCS B;  3RMQ A;  2R58 A;  2JVV A;  1Z9Q A;  4J9G A;  4DA4 A;  2Z0W A;  5KYY A;  1D0Y A;  1DJ7 B;  2ZPG B;  3FRN A; 
#chains in the Genus database with same CATH homology
 3JB9 J;  5GAO r;  4O6J A;  4M78 C;  3HRU A;  3HP9 A;  2LVM A;  5EG2 A;  3X26 B;  5GAN 6;  3OS0 A;  4C5H A;  1VQL A;  5M9O A;  3MEA A;  3WVE B;  2M16 A;  2RD1 A;  4EPC A;  2AHJ B;  5I2M A;  2Y4X A;  5FU6 B;  4M7A G;  2OTJ T;  3LGF A;  3CME A;  4EMK C;  3BDL A;  4QQG A;  1Q81 U;  3FIF A;  5FRO A;  1OI1 A;  5GAN 8;  3JCM e;  2Y90 A;  3LH0 A;  3RIR A;  1VQ4 A;  1Q86 C;  2GF7 A;  4M77 A;  2VUB A;  2DD4 A;  3V7C A;  2I2L A;  3RKX A;  4RCB A;  2JTF A;  1VQP T;  2VGN A;  2OAU A;  1VQM T;  3QII A;  3RUX A;  3CCM T;  2RHY A;  2QA4 T;  1W2B A;  2XKO C;  1M90 C;  1B34 A;  2EAY A;  4A53 A;  2ZPH B;  1UGP B;  4BI3 A;  4XTU A;  5CQY A;  3JCM V;  2R5M A;  2VV5 A;  3OQ5 A;  4M75 A;  1VQN A;  1M9S A;  2DXT A;  5CCA A;  3OW2 S;  3CC2 A;  3CCJ T;  3JB9 H;  4M7A F;  3LYI A;  4J5Y A;  2JTM A;  2L8D A;  3M4G A;  1ZBX A;  4DOV A;  4E47 A;  4EMK B;  4XTW A;  3MCA B;  3MHX A;  1YJW A;  4L6V 5;  3SFM A;  3JCM X;  3CCS A;  2HQE A;  1MHN A;  3CXC A;  1K73 U;  4X34 A;  3CCU A;  4A4F A;  2MWO A;  3S3M A;  3FDR A;  2XDB A;  1Y7X A;  3V8J A;  2DXC A;  1NE8 A;  1SSF A;  2RM4 A;  4R56 A;  2QQR A;  3EAE A;  5C0M A;  4FSX A;  5GAN 3;  4KUD K;  3OA6 A;  4PJO C;  5KE3 A;  2DO3 A;  4M7D F;  4OVA A;  4PNO A;  2JOY A;  3AHU A;  2EQU A;  4JJN K;  3PT9 A;  3M57 A;  4PL6 A;  4E7L A;  1M1K U;  1XTD A;  2X4X A;  2HBP A;  3R6O A;  3M53 A;  2VGM A;  3QYH B;  3VJP A;  4QQD A;  5I2S A;  4HCB A;  5FLX E;  4J8O A;  1I5L A;  3CC7 T;  4HCC A;  3JCM d;  2LRQ A;  2LCL A;  4C8Q D;  4ZTF A;  1O75 A;  2CZ0 B;  3TEE A;  4JS4 A;  3QZ5 B;  2PVG B;  3CMA T;  3QSU A;  2E1H A;  1JJ2 S;  5LJ5 f;  5LJ3 g;  1H64 1;  1KQ1 A;  4DQ2 A;  1W2B S;  3TU4 K;  3PFS A;  4OB2 B;  3SB2 A;  3G4S A;  1WJQ A;  2FHD A;  5GAM f;  3CCR T;  3CD6 T;  2LCC A;  4XU0 A;  1WPY A;  4LDU A;  5GMK m;  4ZN1 A;  3VYG A;  4TVR A;  4Y28 E;  4BI8 B;  4PJO D;  2M0O A;  4LDV A;  1YHQ T;  3MP1 A;  2MWP A;  2HQX A;  3GOX A;  1V29 B;  4B9W A;  2C06 A;  4XAX B;  1UGR B;  3VUZ A;  4F7U G;  1KHI A;  2KAF A;  4PLL A;  2MI6 A;  4ELZ C;  4PJO B;  3CCQ T;  4JRI A;  3CXC S;  5DLQ E;  5A0G A;  1WJS A;  2ZPE B;  5GAN e;  1VQ7 T;  3KUF A;  1N9R A;  3DKM A;  2K3Y A;  2DAQ A;  3LX7 A;  1YHQ A;  2PQW A;  4LD6 A;  1QVP A;  4KUI A;  3OBY A;  1G3T A;  1KD1 C;  1K8A U;  2E6N A;  3M58 A;  4RCC A;  1OYX A;  2VXF A;  4O5V A;  4XQ3 A;  3M56 A;  2BUD A;  3MP6 A;  1YI2 T;  3HKS A;  2JN0 A;  1Y71 A;  3MEW A;  2K5I A;  4C5G A;  5GAO n;  3A8O B;  3M4Y A;  2OTJ A;  5GAO l;  5FRN A;  4PJO E;  2X35 A;  3LW5 E;  4HT9 A;  3J81 E;  3QG1 A;  2QQ9 A;  1Q82 C;  1VQ6 T;  1H3Z A;  4C5E A;  3A8L B;  3J7A F;  3QZ9 B;  2XDP A;  3ZFJ A;  3JB9 D;  5KH6 A;  4X9C A;  5GAN 4;  1NPR A;  4JLG A;  1K9M C;  3JCM c;  1UGS B;  4ME7 A;  2LDM A;  5CQX A;  2KQW A;  4NL2 A;  1HK9 A;  3JCM Q;  3G71 T;  3BFM A;  4QW2 A;  2EQJ A;  3PMI A;  4FT4 A;  2IG0 A;  1N8R U;  1ZHI A;  5GMK l;  1WGS A;  4LDW A;  2ZPF B;  4M77 D;  2M1H A;  2K5F A;  5CKH A;  3S3N A;  4GY5 A;  2E70 A;  1VQP A;  1KC8 U;  1KQS S;  1RI0 A;  4DOW A;  4C8Q G;  2QA4 A;  5FRM A;  2DTO A;  2WSC E;  4IUR A;  4P5N A;  2VC8 A;  1JBM A;  1X01 A;  4A54 A;  2PUK B;  1U1T A;  3P8H A;  5HK0 A;  3OYN A;  2RHZ A;  2ZZD A;  3OYA A;  4ZN3 A;  3CCJ A;  4PKC C;  4LDY A;  3L2R A;  4IUV A;  4PJO G;  4M75 D;  4NS5 A;  3EFR A;  1BI1 A;  1VIE A;  5D6X A;  3A8H B;  3FB9 A;  5GAN d;  3G6E T;  4XTY A;  1G3S A;  5GMK e;  2XDD A;  4RMO A;  4E7K A;  1PSE A;  2PU9 B;  2O4X A;  1MGQ A;  2GQV A;  2LT1 A;  2RJE A;  4J6W A;  1N27 A;  3BDU A;  3M55 A;  3NTK A;  3QUI A;  4J6X A;  5CVI A;  2LT4 A;  1QW1 A;  1M4Z A;  3QDR B;  4LDX A;  3A5Z B;  3CBP A;  3FLG A;  5KCO A;  3HRT A;  4M7A A;  5J26 A;  4MDX A;  1UEB A;  2RO0 A;  1Y96 A;  4GLK A;  4J83 A;  2EIF A;  1NJI U;  5CKF A;  1VQ9 T;  3RES A;  4RKU E;  3I55 T;  3KBG A;  2CYZ B;  2K3X A;  3DLM A;  3CC7 A;  4NL3 A;  3CMA A;  2OTL T;  4BUG A;  2NLU A;  3KXT A;  1VQ5 T;  1HXD A;  4CRI A;  1YJN T;  4JS5 A;  3MEV A;  2GCX A;  3OYY A;  1BI2 A;  4A4K A;  5GAO p;  2JNG A;  1S72 T;  3SWN A;  3X24 B;  3WVD B;  2O01 E;  4PJO F;  3JAM E;  3H6Z A;  4M7D A;  5A2Q E;  3G7Z A;  1OZ3 A;  5GAO q;  3CCR A;  3MEU A;  3JB9 G;  3QJ6 A;  3QYG B;  3QBY A;  4A4E A;  4F7U B;  4N0A A;  2GFA A;  3OYB A;  4KUL A;  4HT8 A;  3CC4 A;  3OMC A;  5LJ5 j;  2CZ6 B;  3JCM g;  4QVC A;  1D3B B;  1P92 A;  4D6W A;  2DIQ A;  2RI5 A;  3JRZ A;  4M77 G;  2QTX A;  2DEQ A;  4C8Q C;  3CCL T;  5LJ5 h;  3E1S A;  3HSB A;  3OYD A;  5CKE A;  5GAM j;  3C4S A;  3C94 A;  1VQ7 A;  1VQ8 T;  4MZM A;  4XTZ A;  3MO8 A;  3PTA A;  5GAM h;  1I4K 1;  1WJR A;  3LWH A;  2L5Q A;  4OGE A;  2E10 A;  4OGC A;  4F7U E;  3OS2 A;  1QP2 A;  4E7I A;  4ZTJ A;  2P0K A;  2YRV A;  3JB9 I;  2EJG A;  5KE2 A;  4BI4 A;  4M75 G;  2E41 A;  3V8K A;  4C92 C;  2P0Q A;  2RHU A;  2R57 A;  1YIJ T;  3JB9 F;  5CKB A;  4Z02 A;  3OYK A;  1M1K C;  1M1F A;  1Q7Y C;  3NTI A;  5LJ3 f;  3QHS A;  1VQ6 A;  1JRI A;  2QQA A;  5DY9 A;  5D6Y A;  1FWZ A;  3NFC A;  2LNV A;  3L2V A;  3JCM P;  3CC4 T;  3E9F A;  2BIV A;  1YIJ A;  3A8M B;  4HA8 A;  5CO7 A;  1RL2 A;  3G71 A;  4M77 F;  1BYM A;  5LJ5 e;  3CEY A;  1XOV A;  4C8Q B;  5CAI A;  4ELY C;  1QP3 A;  4XU3 A;  3CME T;  4II1 A;  5GAM e;  3WXM B;  3P8B B;  3PGG A;  3UPU A;  4J6Y A;  2QQB A;  4C92 D;  4E7H A;  4JDS A;  4RG8 A;  1BI0 A;  4NOY A;  2K2V A;  3JCM W;  4JRQ A;  1VQ4 T;  2D9T A;  4M78 A;  2D6F A;  1WNL A;  1BIB A;  1FXX A;  1YBY A;  3L2U A;  3NTH A;  3PIP A;  3M59 A;  3VU3 C;  3CCV T;  4C92 B;  3MET A;  1EIF A;  4C8Q E;  1VIF A;  2KSS A;  2RB6 A;  2DZ9 A;  3BW1 A;  3ME9 A;  4EMK A;  4EMH A;  1Q86 U;  1NZ9 A;  2M9U A;  2RHX A;  5AYF A;  3SD4 A;  1Q81 C;  3HFO A;  3S6W A;  1VQK T;  4M77 C;  2YLC A;  2Y4Y A;  3CPF A;  4KT0 E;  1BKB A;  4N4G A;  2K5L A;  5IT9 E;  1M1G A;  5L8R E;  5A0D A;  2MAM A;  4FM4 B;  2XID A;  2P4T A;  2QI2 A;  1M90 U;  4L59 A;  1VQO T;  1UGQ B;  3I56 T;  3HRS A;  1QVG A;  1LOJ A;  1NPP A;  4XU1 A;  3GF5 A;  3CBM A;  4C92 E;  1YJW T;  2E6Z A;  4CI0 C;  1VQ9 A;  1YIT T;  2HNI A;  5GAN 2;  3I55 A;  2LQK A;  4J7F A;  4F7U F;  2FL7 A;  3CBO A;  3EFS A;  2DXB A;  4M75 C;  2EJF A;  1N9S A;  5IAY A;  5GAN g;  1U8R A;  4V2S A;  2OTL A;  1VQ5 A;  2FYK A;  1YJN A;  2XIC A;  1Y07 A;  2RK2 A;  2XG8 D;  4IUQ A;  4X9D A;  3M5A A;  5LJ5 d;  1VQM A;  5CKD A;  3CCM A;  4BE2 A;  4E7J A;  4ATO A;  2QXF A;  4OF1 A;  4J7I A;  2CZ1 B;  2EWN A;  2V8J A;  3PNW C;  5GAM d;  4IUT A;  2V8K A;  2YHT A;  2ZPB B;  4M7D D;  4C0F A;  1O9S A;  4M77 B;  2KK4 A;  1YJ9 T;  3V8L A;  3QXE B;  1K73 C;  4L5G A;  3ASK A;  4OP0 A;  2DJZ A;  4BAC A;  1G5V A;  2EQM A;  3TRE A;  3X28 B;  3MP8 A;  4EDU A;  4PJO A;  3CCL A;  2EYQ A;  2KVQ G;  2RI3 A;  3OYM A;  1X75 C;  2F5T X;  1B34 B;  3F70 A;  4C92 G;  2FB7 A;  2JUF A;  3V7S A;  3GNG A;  2RHI A;  2EJ9 A;  4N4I A;  4JRP A;  1QVF A;  2RJF A;  4JRK A;  4M75 B;  3GP8 A;  2XK0 A;  3HPW A;  1R8O B;  3N5B B;  4M77 E;  5HY6 A;  3SDZ A;  4WF2 A;  3JCM b;  1QVG S;  3BY7 A;  3GIB A;  5DLO A;  2DPP B;  4C8Q F;  2DKG A;  2RH2 A;  2WAC A;  3OS5 A;  1LNX A;  2V8I A;  3O8V A;  3L2Z A;  4QQ6 A;  2PUO B;  3OW2 A;  4N4H A;  3CCE T;  4OB0 B;  5HKC A;  3J80 E;  1KQ2 A;  1I8F A;  5CIU A;  3L1A A;  4MZP A;  3L2W A;  2CZ7 B;  2QEX T;  3RKW A;  5GMK i;  4ZGJ B;  5J39 A;  1PSF A;  4M75 E;  3X20 B;  3ZBD A;  4EMG A;  4JUV A;  2D0Q B;  2PVD B;  1XQH A;  2X4J A;  5FU7 C;  2DXU A;  4C92 F;  3CD6 A;  3L42 A;  3JSC A;  1M5Q 1;  3OYL A;  1X6O A;  2ZGW A;  3JCM f;  5LJ3 j;  1KD1 U;  2X4Y A;  3OYG A;  1KHC A;  2DD5 A;  3QO3 A;  4C0G A;  4LD9 K;  2RA2 A;  2DIG A;  5LJ3 h;  2EKO A;  2QDY B;  1BIA A;  5I21 A;  3E9G A;  2HD0 A;  4C5I A;  4FL6 A;  2K57 A;  2RJD A;  1N6A A;  3CCQ A;  4BE0 A;  2CKK A;  1Q82 U;  1FX7 A;  3C12 A;  4YTL A;  4ZGD B;  3CCV A;  2P0P A;  2RK1 A;  3INZ A;  3QPH A;  4C0D C;  1K8A C;  1JJ2 A;  4M78 D;  1K9M U;  5GAN 7;  3TCJ A;  2G3R A;  1TH7 A;  1QVF S;  4M7D G;  2H3J A;  2FVU A;  3OYJ A;  3UDC A;  3VKI A;  4PLI A;  3S3O A;  4OMF B;  1IRE B;  3H8Z A;  2KY9 A;  4QVD A;  1VQK A;  1JB0 E;  2VXE A;  4M78 B;  2R5A A;  3GLX A;  3V7R A;  1YI2 A;  3OMG A;  2YLB A;  4VUB A;  3PMT A;  5FU7 B;  4XTX A;  2E5Q A;  2E64 A;  1VQO A;  3I56 A;  2DTH A;  2ZPI B;  2A3L A;  3URG A;  5DM7 R;  5LJ3 e;  1N8R C;  1ZQ1 A;  1VUB A;  4C0Z A;  1YIT A;  2K4Y A;  3HL8 A;  4OB1 B;  3CPW A;  2L3R A;  1KC8 C;  3LWI A;  1VQL T;  1I81 A;  5LL6 S;  3M9Q A;  3FJP A;  4M78 E;  2EQK A;  2KMT A;  3ZEH A;  4C0D B;  5D6W A;  2XU8 A;  5GAN j;  4HCZ A;  4KBM B;  2QQS A;  3HFN A;  3OBW A;  3GNF B;  5GAN h;  4F7U A;  5GAO m;  4M75 F;  3X25 B;  4JLI A;  1YJ9 A;  2A7Y A;  5CK9 A;  2KDS A;  4M7A C;  4MZT A;  1W4S A;  2IVW A;  2MF2 A;  2CS7 A;  3RKY A;  1D3B A;  2DVE A;  5GAN 5;  2PVO B;  3G6E A;  3LLR A;  4HKE A;  4IUU A;  4UC4 A;  2L89 A;  5LJ5 g;  2F5K A;  1KG1 A;  2HAX A;  3P8D A;  3OYC A;  1NJI C;  1KQS A;  3OSS C;  4BDZ A;  4FIB A;  3OS1 A;  3OY9 A;  2F69 A;  2WSE E;  5GAM g;  1VQN T;  3CC2 T;  2XHC A;  3SWN C;  3E19 A;  3QKJ A;  4FT2 A;  4ZGE B;  2LTO A;  2MMP A;  3OYE A;  3Q1J A;  4M78 G;  5KCH A;  4M7D C;  5HK3 A;  3L2Q A;  2GFU A;  3VV0 A;  5GAN f;  1M8V A;  1IZ6 A;  3CCS T;  4M7A D;  3DB3 A;  1GXI E;  3CPW S;  3CCU T;  2O4X B;  4N0A C;  5LJ3 d;  3CCE A;  1OZ2 A;  3T9N A;  4QVZ A;  4BY6 C;  3ER0 A;  3RMS A;  3FC3 A;  2QEX A;  4R55 A;  2JZ2 A;  4M7A B;  1S72 A;  2E65 A;  1Y96 B;  3PIO A;  4XK8 E;  3M54 A;  3HHT B;  3UT1 A;  4BD3 A;  4C8Q A;  1G3Y A;  4XU2 A;  1WQ7 A;  2ZCF B;  2RJC A;  3OSV A;  2E12 A;  3OB9 A;  4MMK A;  3C95 A;  2RI2 A;  3QJY A;  3UWN A;  5GMK j;  4MML A;  3OYF A;  1XNI A;  2BKD N;  4M78 F;  2DZC A;  1G3W A;  2LQ8 A;  2WSF E;  2X4W A;  3SWN B;  4BB7 A;  4FU6 A;  5GMK h;  1Q7Y U;  3RER A;  5C6S A;  4M7D B;  1LJO A;  5FU6 C;  4OB3 B;  3G4S T;  4M7A E;  1AHJ B;  4C92 A;  2LC4 A;  1UB4 A;  3VYH B;  3DB4 A;  4Q5W A;  1VQ8 A;  3LGL A;  4BE1 A;  2XD0 A;  4IUP A;  4XTV A;  1WQW A;  4BDY A;  4MDW A;  1U1S A;  4Y91 A;  4RG2 A;  3JCM h;  3VUB A;  4BY6 B;  3OYI A;  5IN1 A;  3JCM J;  3FEO A;  3DLL A;  4A4G A;  3RMQ A;  1YCY A;  2R58 A;  2XI9 A;  1BI3 A;  2LX9 A;  2DTI A;  2CGH A;  2JVV A;  3A8G B;  2DK3 A;  5A0L A;  3GPL A;  2VYT A;  5J3B A;  4B9X A;  2EFI A;  4DA4 A;  4M7D E;  3OYH A;  4A4H A;  2B8A A;  5CR2 A;  4IKF A;  1DJ7 B;  2ZPG B;  3FRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...