1KGDA

Crystal structure of the guanylate kinase-like domain of human cask
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
178
structure length
175
Chain Sequence
HMRKTLVLLGAHGVGRRHIKNTLITKHPDRFAYPIPHTTRPPEENGKNYYFVSHDQMMQDISNNEYLEYGSHEDAMYGTKLETIRKIHEQGLIAILDVEPQALKVLRTAEFAPFVVFIAAPTITPGLNEDESLQRLQKESDILQRTYAHYFDLTIINNEIDETIRHLEEAVELVC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for nucleotide-dependent regulation of membrane-associated guanylate kinase-like domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords PERIPHERAL PLASMA MEMBRANE CASK
total genus 56
structure length 175
sequence length 178
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2001-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.63.10 Alpha Beta 2-Layer Sandwich Guanylate Kinase phosphate binding domain Guanylate Kinase phosphate binding domain 1kgdA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kgdA01
4Q1FA 1EFUA 3KQLA 2GJKA 4Q9LA 1CJMA 2ZSFA 1Q12A 2FFAA 4A15A 1E1QD 4FWIB 5J4KA 1D2EA 5TVKA 1GG2A 4GL2A 4PO8A 3WNBA 3PEYA 1KJZA 1YR7A 3MRSA 1KI3A 4YMWA 2VO1A 4AI6A 3IEUA 1MO3A 1T5LA 4A82A 2PH1A 2XOKA 1N5KA 5KDOA 1QHIA 4IDNA 3GJ6A 2YWHA 1W47A 2DY1A 2QMEA 4FCTA 4FMDF 5B30A 2VA8A 5J5CA 821PA 5JS7A 1ZINA 3LXXA 1II8A 4QHYA 4U02A 2RHDA 3TAHA 3NIBA 3R20A 3RABA 5JI2E 1KHTA 2NO7A 1J8YF 2GRJA 4OK6A 2AXNA 3NH9A 3CH4B 3CZQA 1R2QA 3B82A 4PHTA 5F9FA 4TQAA 1T3SA 1XFAA 4P4UA 2HLDD 2OUKA 1IN6A 1N25A 5JRZA 2RGGA 2OSBA 3UIEA 3VKWA 1XTQA 2GCOB 4QHSA 1XCGB 2JIZD 1VG8A 1IJEA 1E9DA 2GK6A 2CHVA 2WMOB 3LX8A 3SQWA 1E2LA 3TUIC 4JMPA 3TVTA 5CLLA 2IS4A 3CLVA 2QUZA 4F93B 3AP3A 2P67A 3CX7A 1E2PA 3LFUA 4IVQA 5CYOA 1P75A 3SU8A 3U3MA 1NNEA 2O8BB 1XEXA 2F6RA 4QJ5A 1R0XA 3OEED 1P62B 4FXPA 1OXUA 4Q5IA 4BE7B 3AP2A 5AJXA 2WKQA 3C4JA 2J0SA 3FB4A 2IBMA 2QBYA 1QHNA 3EIHA 4Q4HB 1CR4A 2OLJA 4V0ME 1Q3TA 2QM8A 5DE3A 1ELOA 4LC1A 3VKHA 5EXPA 1P73A 3AF2A 2I1QA 4D4KA 4DUGA 1Q21A 4WVFA 2IWRA 4P4SA 3SQXA 1BKDR 3QVVA 4B44A 2QNRA 4QJ3A 2R65A 1F6BA 3TBKA 2ZRDA 2WMNB 2QL6A 3V4FA 2DWOA 2EFEB 3CH5A 1GZSA 1TQ6A 1G3RA 4UXIA 4BLRA 4C9BA 3B2EA 4R7ZA 1IXSB 4KI0A 4CEHB 4NCKA 1ZAKA 3K70C 1T5IA 1N0VC 2OO7A 4GOKA 3P4XA 3FKQA 1UKEA 1C4OA 2ZJ5A 4KSCA 4S2EA 1MKYA 2F43B 2EFDB 2C96A 1KTVA 3CRW1 3B78A 3RVBA 2DFLA 3EA5A 4KLNA 1UPTA 3QXXA 2VP0A 4JLPA 2A5FA 3LBHA 3X1DA 5G53C 2MSCB 4C0BA 5KSYA 2KI5A 2GCPA 1KAOA 4BZXA 1MRSA 5TARA 2IF0A 1AKEA 4NKRA 1I4LD 1SKYE 3DZ8A 2FSFA 2GF9A 2IS2A 1EFRD 2ODEA 2L0XA 3PUZA 1T8TA 2ZUBA 2X2FA 1KI2A 3CWQA 4KYIB 3U60B 3CUEF 1YZKA 3PUYA 5BN5A 3E1SA 3QOFA 3MLEA 1OE0A 2A9KA 4GRAA 2V6JA 1Z6AA 3L8YA 1BMFD 2GJ9A 2ZRBA 4Q1BA 3EWSA 3T1OA 1TMKA 1F2TB 1RJ9B 3U6KA 1ZNWA 4RSGA 3QXHA 4HLDA 1GILA 2RGAA 3RWOA 4MUBA 2WZQA 3PUXA 4DSTA 521PA 3HJNA 4DIDA 1YJ5A 4M22A 1JR3A 4KV9A 721PA 4PHGA 3ZD7A 3BE4A 1N0UA 1OV4A 3LW7A 3RS2A 4MGKR 3L2OB 3FHTA 4EPYA 3UG7A 1BIFA 2IYLD 5E4FA 2ZJOA 2CNWD 3WNCA 3QG1A 3U4QA 1H65A 2PCLA 1R0YA 1ZD8A 4UNNA 1W0JD 2Z4SA 2D74A 3FVQA 4UJ3A 3K0EA 2JLZA 1XMJA 2CBZA 5J40A 4B3CA 3IILA 2J0QA 2W6IA 2YOHA 1E2IA 3GJ8A 2QQEA 5FTLA 4X8OA 1IN8A 1PV4A 3CM0A 2NG1A 3F3YA 4LBWA 1PLJA 1ZJ6A 3RC8A 3BWDD 3EZ7A 1TUIA 2OZEA 3WP1B 5BN3A 4TMKA 1XNJA 1F2UB 2V1UA 1OF1A 3W6OA 4DSNA 2YWFA 4I1VA 3VHXA 3QBTA 5HR5A 1I2DA 1KSFX 3O47A 2D62A 4RD6A 2RGNA 1LNZA 3Q5DA 4OK5A 3X2SA 1X3SA 3AEZA 4B47A 2R44A 3QSYA 4JBYA 1K6MA 2XJ9A 3QXSA 1EX7A 2FWRA 3N5CA 3OIUA 4EFNA 5FBVB 2WOJA 3D7MA 1XZQA 1DELA 3U3JA 2AL7A 1P9RA 2ZVQX 1PUJA 4EPWA 4NU0A 2KJQA 2CE7A 3RYTC 3A4NA 2C9CA 2ZI9A 4O2LA 1OXVA 4PAMA 1UEJA 5KOYA 1M34E 2JAQA 4G3XA 4JVMA 4TLEA 3TE6A 3QVUA 1KNXA 3B8HA 1YZNA 3ICQB 3VR2A 4EFLA 2XSZD 4JLVA 4NDZA 4M1SA 1OYWA 1GRQA 1KSGA 4B3GA 4CVNA 3EARA 3OEHA 1GFIA 4HB4A 1WCV1 4BFWA 5FI0B 5IF9A 4JVLA 5FOSA 4MRPA 2QU8A 5EZ5A 1ZU5A 1G4UR 3VTKA 4YQFA 1E0JA 1TU4A 5FBQB 1TTTA 4Y0AA 1AN0A 2A30A 1X1RA 2J87A 5CIWA 4OI4A 2CK3A 3DOFA 5H70A 4MYUA 2JJ8A 1I4DD 3BORA 1IN5A 3ZVRA 1K5DA 1BYUA 3QKSB 4XSGA 1G6HA 3DMDA 4PXAA 1E0SA 1J8MF 1Q0UA 4YXWD 1KK1A 4PC7A 4L8GA 2NQ2C 3QBVA 4DLTA 4OI2A 5KSPA 1XXHE 4B3DA 3UATA 1ZU4A 1P60A 2ZI5A 2CVFA 1S1CA 4MKGA 3KB1A 3CRMA 3K70D 4MDFA 1CP2A 3E70C 5DN6D 1D2NA 2IUTA 4KBFA 4Q9HA 5DLQC 1SKYB 3MD0A 5FUVA 2H8KA 2BIFA 4NE2A 3TUZC 4AKGA 4GZMA 5JHGB 1U0LA 2FFHA 1XJQA 3V4RA 1ZVQA 3EWAA 3PUWA 5EZ6B 2QORA 3BB3A 5D3MA 2CK3D 1GL9B 3KJEA 3EASA 1DVRA 4TYWA 4HDOB 3MAAC 3QF4B 3J81k 1M7GA 2QMHA 2ZEJA 3DOEA 2FF7A 3AVUA 2WWIA 3HR8A 5FI1B 5KO2A 4N1AA 3QG5A 5AR1A 4JKIA 4ZIRB 1DADA 1VIAA 4GP7A 5JEEA 3IPYA 2AXPA 3HR7A 5KSOA 5ELXA 4NYMQ 2AD1A 3MSXA 5DO9A 1FL9A 3PVSA 4P33A 4AWXA 4UNQA 3A6PC 2X1VA 1N6KA 2AWOA 5L3SA 1S2MA 1H8HA 3FFBA 3AVXA 1OIWA 1ZM3A 4KITB 4U7DA 4IDOA 2ZJBA 3VAAA 1GNPA 1T3LA 2FA9A 1TQDA 3TQCA 3UKDA 5HTKA 1FTNA 1E2NA 4BWYA 4A0HA 3THXB 1G41A 1MR3F 2V7QA 4C0SA 3DDCA 1SZPA 1M7BA 3U2QA 1LB1B 1GKYA 3IKJA 5IDVA 3PR1A 5P21A 5F98A 1NN5A 2Z6VA 3NH6A 2QP9X 4LBYA 3I1FA 2A2ZA 2VQSA 3HU1A 3IIJA 1SXJB 1R10A 1ZCAA 1XMIA 1D9XA 5DSZA 1T0HB 3TIFA 3A1VA 3F8TA 1OB2A 1XEWX 5EXTA 3ZQJA 3GJ0A 3NC1C 4XD7A 1DPFA 3OE7A 1PJRA 1ONBA 1Z0KA 5EUMA 3LH5A 3OFNA 4KFUA 3B1VA 1W4RA 3GQBA 4MKHA 1XF9A 3AH8A 3U7FB 4A0FA 5K8IA 3I72A 2I1VB 4TYPA 3CBQA 4QJ4A 4UNSA 2CL0X 4XIGS 2FSGA 2G1KA 1U99A 4URYR 1E9EA 3EIEA 3ECCA 1NN1A 1R4AA 3RANA 4ZCIA 4B34A 3N2IA 4EUNA 1DG1G 4G0NA 2J0UA 1KK0A 1OFTA 2FZ4A 1IM2A 2JLYA 3UMFA 5JJLA 2F3TA 2RGCA 3O8DA 4P31A 3RWMB 2OCBA 3KQNA 5FL7A 1JJ7A 1HTWA 1MO5A 1KSHA 3B7GA 1JR3D 4JKYA 4HUQA 4DDWA 2YOFA 2FMXA 2HCJB 2IEZA 2XJ4A 2KE5A 4W7SA 5BYKA 5AJYA 2D2EA 4JIMA 2IW3A 1BOFA 2NGRA 5JBQA 1KGDA 1QZXA 5C4MA 1X6VA 2Q9CA 1RPZA 2ZI7A 5DH9A 4K81B 2XNSA 3U3RA 1XCMA 2BMEA 1VCNA 2B8WA 2DFKB 2WWXA 4FD2A 3KKMA 4HLQB 3ZIAD 4A1FA 4DLSA 3R8FA 2FGJA 4LBZA 1WBBA 1YR9A 1KYIA 5DHFA 1XBTA 1KI4A 2VP2A 3KTAA 3O8BA 4QFMA 4KODA 2NTYC 1G291 1TNDA 5K8UA 2H92A 3KJIA 4II7A 3SYKA 2I3BA 3KKQA 3B13B 3WYGA 3I8XA 4DCTA 2W00A 1GNQA 4UKDA 4KAXA 1KNQA 2WVJA 3LY5A 3BBPA 4LUCA 2JA1A 3AGQA 1SULA 4LSGA 2OE2A 3M6AA 5J4HA 2QENA 4FI3C 1J99A 4ON9A 3KQUA 4KO8A 4DB4A 2HEIA 4G5OA 1NVWQ 1DE0A 2GETA 1Z0IA 5GVSA 4JLKA 2CL6X 2IYVA 4AKEA 4ZI2A 1G3UA 1M7HA 1GAJA 3Q8XB 2EYUA 4MUAA 3CZPA 4D4LA 1S96A 4OL0A 4QBFA 1UM8A 3IHWA 2G0NA 4JJKA 1DEKA 2NO1A 2A7QA 1Z3IX 2WJGA 4G5GA 2WWYA 3ZD6A 3A1SA 2GJ8A 3AF3A 3OEEA 1G7TA 4FCVA 4JL5A 621PA 2RB4A 3C7KA 4IOJA 4D80A 2IL1A 4DEYA 2A5YB 4M0LA 1BYIA 4Q1EA 1HQCA 2VYFA 1EG7A 4HZUA 2ZR7A 1K5GA 3TSOA 5L3QB 5LB2A 4BLPA 3SHWA 1W4AA 2ZRFA 4OHZA 2CJWA 3DO6A 4PC6A 1AS0A 3WYAA 4DLRA 1T9HA 2JIZA 4QNMA 4RD1A 5AJZA 2QRZA 4XWOA 4AKHA 4GOJA 2P5TB 2IXGA 2PZFA 3EZ9A 4OHVA 4P32A 5E7IA 3UMSA 5L3SB 2BBSA 4QOSA 5DNYB 4OQNA 4I99A 1YHNA 3GJ7A 1ZUNB 5C4GB 1C9KA 3LQQA 3L43A 4QL3A 2GF0A 4AK9A 1XU4A 3ADKA 4XWAA 2ANBA 2ODBA 3L0IB 5M04A 1BO6A 1J7KA 2WAXA 3HYTA 5LB4A 3R9XA 2E87A 3LA6A 4CRWB 2Q3MA 3OESA 2P0EA 5FTKA 1QVRA 3B1WA 5CLQA 2JJ2D 2YKGA 1G6OA 4TZ0A 2J0VA 1KIMA 4R2IA 4BEBA 2OFWA 3AVOA 4HDQB 1E32A 1RRGA 2W2XA 1DARA 3B1XA 4NZYA 5KDDA 4B3FX 4OHYA 4NCIA 4RFSA 1Z6TA 3BK7A 4G5RA 3RRMA 1JNYA 3T1VA 1HE1C 4ZCLA 1DG3A 3IEVA 5E95A 1EK0A 2V3CC 3QKUA 1KI6B 3I3SR 1KY3A 2VTKA 3CWZA 5FBWB 1ODFA 4DIEA 4U00A 1XP8A 4WAUA 4DDTA 1SVWA 1E3MA 4US1R 1D8TA 2FZLA 3K8YA 3NDBB 2Q9BA 1G17A 3RC3A 4ARZB 2FPLA 2WHXA 2XOKD 3AGPA 5B57C 3D3QA 2PT5A 3E2IA 2MSEB 1X8LA 2QA5A 3Q85A 5EE1A 4QRHA 1QF9A 2V54A 4QGHA 5FOXA 3UK6A 2AD5A 1Z0JA 1DAEA 1NN0A 3QKRB 4YMSA 3QPWA 1L7VC 4OHXA 5AJVB 3GP8A 2FEMA 1UBCA 2QT0A 5TMPA 1T0JB 3MUFA 2SHKA 2PT7A 4X8HA 2GZAA 4FMBB 4G1UC 3EPHA 2FV8A 4E07A 3TR0A 2VSXA 5HZHA 3E5HA 5FPKA 4Q66C 4ZI3A 4ESHA 2WV9A 1KDOA 1NIPA 4UNPA 4Q4AA 2HCBA 5IHPA 3HWSA 2IYZA 4TMXA 3RS7A 4Q01A 3KTAB 5F2EA 2QRNA 3FPAA 1CBUA 2OILA 4WBSA 2PLRA 2XEXA 2X77A 3KXKA 2GAAA 2MMGA 4MITA 1YKSA 4BQSA 3K0SA 4G5SA 5C18A 5KYKA 1N0WA 4Q4AB 1U98A 4FINA 3OIVA 3X1WA 5JRJA 4W9MC 3K0CA 3K0FA 1NLYA 1NY5A 4TYYA 1IBRA 3R9IA 1M2OB 4GMDA 1U90A 2OXCA 2RH5A 1FFHA 3HU3A 4ZCMA 1SXJD 5JCPA 4MGZR 3B60A 3GLGA 1Z28A 4V0OA 2W2TA 4ASUA 1HYQA 4B6FA 1EWRA 2QP4A 2YHSA 3KXIA 2ORIA 1IN4A 4YDHB 3TMKA 3PITA 1A4RA 1E69A 2UKDA 2WWFA 2ZE6A 2ZRMA 5J4LA 4LZZA 1NIJA 3CF0A 2PJRA 1XTKA 2JATA 1JPNA 4F4IA 1OH7A 2CNWA 3FHOA 5JHHB 1XTIA 3IO3A 4O2RA 1G8GA 1YE8A 2FEOA 1XMSA 2RGDA 1NKTA 1II0A 1SVIA 2JJ1D 1WE2A 1DOAA 1SVSA 3RHFA 2CE2X 2ZREA 3Q7QA 1OXTA 3VX3A 2EU8A 2JCSA 3DM9B 5TY0A 5DHAA 4M1TA 1ZM4A 1Q1QA 1E2EA 3A36A 1OHHA 1OT3A 2ZE7A 2R2AA 3LW8A 5B58C 1COWA 1JQJC 1NBMD 1RW4A 2G0TA 1XXHA 2PLFA 2IHYA 1LF5A 2JJ1A 2OCPA 4LV5B 4D82A 2VP6A 2OBMA 3LLMA 3MCAA 4Q47A 1IY0A 1NP6A 3ZGXA 2WAYA 1AS2A 1G3QA 1XZPA 2J45A 4KFTA 2O0KA 1QHXA 1W44A 2R6DA 3IGFA 3MJHA 3IHLA 1XXHB 4PO1A 4XSHA 2DR3A 4B43A 2IWHA 4HAVA 1ZBDA 5CK5A 4NHOA 3RS5A 2PL3A 6Q21A 1EXMA 5FPHA 4B3XA 3RLFA 1FZQA 2PZGA 1G5PA 2PCJA 2IXFA 2O52A 4QBIA 3CR7A 2RGNC 3V9PA 4Z54A 2XGJA 4P0TA 5LBIA 1G20E 2AKYA 2G88A 1CU1A 3GLIE 1LS1A 3NG1A 1J90A 4D26A 1CR0A 4FIDA 4IXMA 4KFRA 2W0MA 2YWGA 2ZYTX 1A7JA 2BJWA 3FDIA 1CJTC 3CPHA 1WXQA 4JBWA 3TQFA 4Z8XA 1Q20A 4PPNA 3TGPA 4A0RA 2FPKA 2FSIA 4ERNA 3VFDA 1KI6A 1T4GA 2WBLC 2WJYA 4AYXA 4TYQA 3LVRE 1VHLA 4HAUA 3C14C 5IRCD 3VR5A 1B0UA 2N46A 2C95A 2R6CA 3QQ5A 2O8DB 4BGDA 2GK7A 1JECA 4OKSA 5KNDA 5H8WA 4D6PA 1ZD1A 3MWLA 1NG9A 1VHTA 4LJYA 1R6BX 2ZRNA 5FTJA 2O8CB 5AK0A 1D6JA 2GNOA 1LS6A 3U3KA 3AVPA 4WA7A 1W2HA 4YC7A 4MGYR 1CS4C 2EQBA 1II8B 5CJPA 3SJZA 4NL4H 2XB4A 4E03A 3L8ZA 3KQHA 4LK2A 1Z08A 2QMOA 2RKOA 4G01B 4AURA 4C0HA 2HUPA 5B64A 2WICA 1R7RA 1TAGA 1NJGA 3RDPA 1TQ2A 3PQCA 5DISB 1GTVA 5CYPA 1LW7A 3F5FA 2PMKA 3R7WA 3WHKA 5FOUA 5EE0A 2I4IA 2VHCA 4LWZA 4LHVA 1TF7A 2V8OA 2ZUCA 4ITRC 2J7PD 4YLGA 2IS6A 3VNVA 3T5GA 2BEKA 4LI0A 4MDEA 3S1AB 1A5TA 4A2QA 2B21A 1N5JA 2HDNB 4OQFA 4BFYA 1KI8A 4BPBA 2CCKA 4MA4A 4XJXA 5LPNA 1R8QA 4Y0VA 3EX7C 3A1UA 2PX0A 4C0JA 3KFXA 5FOWA 1Z07A 2FGKA 1NMXA 3Q9LA 4N0DA 4GSYA 4JT4A 2IYRA 1ZD9A 2JJ2A 3ADCA 2X2EA 5K8LA 3AVTA 1RE0A 4DVGA 1LV7A 1E99A 1Q22A 2O8BA 1IONA 4BECA 3CRRA 2ZR0A 2XTNA 4PPFA 4QHTA 1FTSA 2FX3A 5KSZA 4PSVA 3AVVA 4GPTA 2R9VA 3VU9B 4ZV4A 1WMSA 5A5GA 2VSFA 2G1JA 4DCSA 1SVMA 3SNHA 2JLVA 3FMIA 1CXZA 4LRWA 4Q7KA 1XEFA 2GXQA 2CLDX 2QN6A 2OAP1 5BQ5A 3P27A 1HT1E 3CX8A 4R71A 5JWOA 4M1KA 1FX0B 2GTPA 3VU9A 4KLZA 4JSYA 3B1YA 1G64A 3SR0A 4EFMA 4K8OA 2IYYA 4TSFA 3NC0C 3CPEA 1E1RD 5JMTA 4LC0A 4LJ9A 1DTSA 1G8HA 2GJAA 2PBRA 1D9ZA 5IT5A 5FPSA 3AV0B 2EYQA 1XMVA 5JCZA 2C9OA 5EE5B 3MWYW 3TJZA 3K70B 3K53A 1NRJB 2GKSA 3FMPB 4RJLA 4TLCA 1ZW6A 4P3YA 4JT2A 3OZXA 4AIIA 4WZAE 5JS8A 2C9YA 221PA 5GADl 1AQYA 2ZVPX 1VPLA 4ACAA 1KDRA 4L9WA 2BCJQ 2GEVA 1CJKC 3QI2A 5K8TA 2ZRPA 1AIPA 1P2UA 2WPDA 1VECA 4MRRA 3WMGA 3VX4A 3TR5A 2H1LA 4IHQA 5KPJA 4CEJA 2DYKA 2W2VA 1G21E 3B1ZA 4DLVA 3VKGA 3EPLA 3HDTA 2C99A 5SZHB 3FHCB 4WW0A 1XPOA 1N6PA 1IHUA 3CIOA 5FOVA 2WKRA 1R8SA 2HJVA 1S0UA 1U9IA 2ZSAA 2GA8A 2ZE8A 5FR1A 3TK1A 1ZP6A 3K09C 3IPXA 2HXYA 3LVQE 1UF9A 4RZ3A 4L5BA 1TU3A 2XTZA 1ZMXA 2ATXA 3RS4A 3CRVA 3C16C 2WWWA 4LV6A 5SZIA 1P2VA 2AX4A 4PQYA 3AM1A 3QPUA 1NBME 3PV0A 2XNDD 1CKEA 4WOPA 3ZIAA 5LD2C 4PR0A 1G3IA 2VSOA 1GWNA 2C2HA 5HKKA 1HURA 4Z1MD 2IYXA 3Q5EA 2OV2A 5HKKD 1YRBA 2OBLA 1UBGA 1M6NA 2JDIA 1U0HC 1UADA 3SDZA 1HQYE 1WDTA 2AKAB 3I32A 2IYUA 2XTMA 4Q7LA 4RVCA 3KJHA 1RC8A 4ABYA 4C7OA 4WZBE 3LLUA 2ZTSA 4EQ6B 3Q72A 4XVQA 2C8VA 1Z0FA 2O8CA 2J9RA 1P3JA 2FOLA 2ECKA 2H5EA 2WJJA 2CMKA 4V0NA 4PSKA 1FMLA 4KXFB 4MKFA 4TN1A 3CONA 1OH6A 4LPSA 3PG5A 1OJLA 2VP9A 1EFHA 2NO0A 4JLMA 4DCVA 2V4ZA 5E7MA 4NTZA 4EQ6A 1TX4B 2BKEA 2BCGY 3T1QA 4TMTA 3VR6A 1P6XA 4X8LA 1GRNA 1IOZA 1Z2CA 2V1XA 5C2JB 1KDTA 1IXRC 3G82C 3R7WB 2C78A 2AN9A 1NSTA 3A4MA 3OAAD 5C46F 2VP5A 3N2EA 2D3WA 4DDVA 3OFND 1GNRA 3QEJA 1VCOA 5FR2A 2GZHA 2V7QD 4LYJA 4XD7D 3S1AA 1F60A 5FOTA 2QPTA 4B2LA 3DHWC 1WF3A 3THWB 4LJ7A 3QY0A 1XTJA 3R9WA 1KO1A 3WRXC 4CIDA 1SKQA 4C0LA 4LPKA 2FNAA 1UKZA 2DB3A 3GJXC 1WB9A 2UZ3A 5CJ2A 4L16A 2G83A 3C15C 1RFLA 3DM5A 2GCOA 2O5VA 1OB5A 3T5DA 4DLUA 2GILA 4JVNA 4Q1DA 3WNDA 5KU1A 1TPZA 1F3OA 3ASYA 3BXZA 5J4VA 3SBEA 4TQ9A 2QTVB 1ETUA 2ODNA 4JL6A 4FWTA 3GJ5A 4DB2A 3VR3A 4PHHA 1EGAA 2IYTA 1T6NA 2ZSEA 4TZ6A 3T1TA 4KYUA 1OH5A 1AK2A 1DAMA 2ZRHA 1NI3A 2JASA 1E98A 1H8HD 4TL9A 4W5JA 2QAJA 4B3BA 4HUTA 4ZDIA 2TMKA 1U8YA 2CEAA 4LCBA 3EC2A 1W49A 2ZUDA 3GFTA 4M2LA 4W5WA 2AK3A 4Q4LA 3ZQ6A 1FX0A 4N0EA 1ZNYA 3DEFA 3PCRB 4TT3A 4A92A 4JYBA 4EKDA 4B32A 3L0PA 4Q4HA 3CPJB 1NLZA 3TVDA 2REXB 1AA9A 1G7SA 4M21A 4EJSB 3K0AB 3THOA 4JLDA 1RRCA 4LJ5A 1YZUA 5KPDA 1US8B 3A1WA 3HYRA 4BASA 4DT1B 5DI9A 2P6RA 1NG1A 1E0KA 2F7SA 3BH0A 3BS4A 4KJZA 2ERXA 2ZRLA 3VR1A 1M1YE 2XZPA 2ZI4A 5KNCA 3EC1A 1KDPA 4NH0A 4YXWA 3KKPA 2PMDA 1JB1A 2QZ4A 2YV5A 4ZPXA 4IEIA 2R6GA 4DT1A 3ND9A 2PEZA 3P20A 3I62A 3K9HA 1VG1A 3TRFA 4C2UA 5A0FA 1GL6A 4TWZA 1EFCA 1G18A 4HYYA 4GZLA 4V0KA 2ONJA 1P61B 5AUOB 4OI0A 3KL4A 3LD9A 3REGA 3QF4A 4UXHA 4CZ2A 4BLOA 1G9XA 2G9NA 1XDBA 2GXAA 4AG6A 3I92A 1UDWA 4DLYA 2ZU6A 1IQPA 2E9SA 3Q7PA 4YMVA 4ZIRA 2GCNA 3PUVA 3FMOB 2P6UA 1AGPA 1CJVC 2FU5C 4B75A 2IT1A 2JEOA 2ZJYA 1ZC3A 4LJ8A 2RMKA 1E79A 5EJEA 1YVDA 1NVVR 4DRZA 1X1SA 1F2TA 4GFDA 1XJ0A 2J5XA 3ZS9A 2ZIAA 3R8CA 4BFSA 1IXZA 3HPRA 4CT4B 2PJZA 2FPMA 3SN6A 5HE8A 3H1TA 2CL7X 2J3EA 4OJQA 1O3YA 3MWKA 4A8JA 3JVVA 1TQ4A 2PZEA 1SQ5A 4PZZA 3GLHB 2GHIA 1KK2A 1ZYUA 4Q9JA 3U4QB 1BH2A 4TMWA 5AUQA 4RD2A 2C03A 4RD0A 1HV8A 5BWMA 2QM7A 3K0CC 4H1VA 1QHHB 3OAAA 4DKXA 3U61B 3W9YA 2PX3A 1Z47A 1S8FA 2RCNA 1P9NA 1L4YA 5G41A 3BFXA 3RSLA 1Z2AA 4LYFA 1VG0B 3KFVA 3GJ4A 1M74A 1G5RA 1SVOA 3BOSA 2ZYWX 2UVQA 2ZQ5A 4HLUA 3ADDA 4D81A 3THWA 2HF8A 1ZC4A 2WJVA 5TV2A 4ZDKA 1OIVA 1CEEA 5DI3B 1HEIA 1XX6A 2NOAA 4XOIA 4Z51A 2J0UB 3EZ2A 4IRUB 4L9SA 4JLBA 1NKSA 2C5LA 2W6ID 3NBZC 1DAHA 1S9HA 3KZ1E 2HT1A 4W5HA 3BH6A 1XEXB 1OKKD 1W0JA 3C5CA 1Y63A 3IUYA 5DI3A 4B35A 4IKEA 1GM5A 2Q9AA 1UEIA 2W58A 3ZZ0A 5HZKA 3GMTA 2ZETA 4DHEA 4ACBA 3AF1A 5J4YA 1XPRA 2FH5B 3P4YA 3FKSD 3QXCA 1I2MA 1BS1A 2IYWA 2WSSA 1AGRA 2W0SA 2LWIA 3CNNA 1N6IA 4C3ZA 4D4MA 2O8FA 1Q57A 1NF3A 5G3YA 1Z83A 3MJRA 2H7VA 3QNUA 4P4SB 4F92B 1MABB 4PAOA 2QPOA 4CYMA 4O3MA 4Z1MA 1W36C 2KBFA 2Q21A 1SXJE 4EJSA 1KO5A 3KUDA 5EP4A 1MT0A 1CTQA 2OBNA 4H9GA 4HI0E 5FH9A 3SFZA 1OPXA 1VYTA 5GJWC 1Z6XA 1W48A 2O0JA 1MABA 4F4CA 4KSBA 3RS3A 1EFRA 2VRWA 2LKDA 1U0JA 3I8SA 4OK3A 3RS0A 3U3OA 3VMFA 2IXEA 3CW2A 2F43A 4BLSA 2NZ8A 2QGNA 5CIQA 2V55B 2BM0A 4OBEA 2CCJA 1AZSC 3ZLJA 5BN4A 2CLSA 1Z6YA 3FYHA 4I1OA 5AUPB 1L8QA 1ZM2A 3A58B 4YMUA 4PC3A 1JPJA 3QF7A 2NPFA 4B76A 4IOLA 2JLSA 2IYQA 1CF4A 4O0MA 4Z8YA 4Q21A 3OF5A 3UWKA 3EPKA 1VYVA 3P1JA 1ESMA 1S3SA 4GI7A 4DLWA 4MRSA 1PUIA 1T3HA 3ASZA 3KDSE 2AR7A 1E1RA 1CLUA 3H86A 2W6JA 2XAUA 2JGNA 1GKUB 1YZQA 1ZUHA 1YZLA 1FMJA 4RD4A 1GVNB 2IUSA 2ASEA 3IQWA 3CX6A 4C0KA 3AF4A 1E4YA 3OIWA 1XEWY 3AUYA 1RJ9A 3PFIA 2PEYA 4DUGD 1KO8A 3DKPA 2QMUA 4GT1A 4M4SA 2ORVA 5FUWA 4ZKEA 3B85A 1KO4A 1HY3A 2Z4RA 1ZCBA 2QE7D 4DDUA 2ATVA 2D06A 2QGZA 1ZIOA 4PSAA 3KKOA 2ZSBA 2IUUA 2VF8A 3TKLA 4POAA 5JZVA 1DAFA 1N5LA 4NMMA 4DSOA 2QY9A 2FFQA 4GDFA 3NHBA 4MGIR 2JLUA 1KY2A 4ZO4A 5EE3A 3ZDQA 2XB2A 4A8JB 2DCUA 2HLDA 4I4LA 2IA5A 1OXXK 1ZRHA 4PC2A 3NBYC 1AS3A 3ZH9B 2GEDA 5SZKB 3BFVA 1QRAA 2HF9A 3SFVA 4DZZA 1U2RA 5DIFA 3AKEA 3H0KA 3I5YA 1JBKA 2EVWX 1WBDA 1YZTA 5BW8A 2OLKA 4JVSB 5JECA 3NTUA 3ZZTA 3A4LA 5FUYA 1TEVA 4N3NA 3BH7A 1S3GA 2IX3A 3NXSA 2P2LA 1QHHA 2J7KA 2QAGB 3DMNA 3SJCA 4C2TA 3TAUA 5JFGA 4LX0A 4X8MA 1E9SA 4Q00A 5BYJA 1W7AA 3VHLB 3B9QA 2CLCX 1NVXQ 1CRQA 3SYLA 1XPUA 5H68A 5EP2A 3LWNA 4NP6A 4FCWA 1S4QA 2ZAOA 4XTCS 2BDTA 2WWHA 3GLHE 3L0SA 2QAGC 4M53A 1QHYA 1UDXA 1J2JA 4QXAA 2QEQA 4LYAA 4TMVA 1JJVA 1QG2A 2G6BA 3AKCA 2J7PA 4KFSA 2J46A 1E1QA 2HYDA 1EX6A 3BAFA 3LXRA 1W4BA 1E0AA 1L2TA 2NO6A 1UKYA 1KMQA 2QE7A 2J1LA 3AF0A 3QE0A 3G0HA 4JBXA 1G4AE 2HYIC 1N6HA 2WJHA 2BBWA 2Z5FA 4IFEA 4RFVA 2A5GA 3I73A 4Q19A 4QKQA 1EFTA 4PX9A 2VPPA 1QDEA 4PZLA 4FMCF 4IFBA 4G5QA 3RSOA 2YZ2A 4Q18A 4JLNA 4DLZA 1A2KC 2ZPTX 1E6CA 1NMZA 4B73A 1E9AA 3B5JA 4HB0A 3ZYCA 1TL7C 3O8CA 4HLCA 4E22A 4IVPA 4BLQA 2ONKA 4LY6A 4Q9KA 3U7GA 3LDAA 2O8FB 4PANA 3ZJYA 4BRWA 4JLOA 4QNRA 3BD9A 3SJAA 1XTRA 2GVDC 4D25A 4LHXA 2Z83A 2QBYB 1IJFA 4PQRA 5JEDA 3IBGA 2HXSA 4Q48A 1T91A 3QKSA 3UMRA 2GBLA 3AKDA 4NONA 3EZ6A 3QXJA 5SZJA 1DO2A 4KCGA 3C41J 1XJCA 2KSQA 5JWHA 4HAXA 1NLFA 3IIMA 2QP3A 2V6IA 4US2R 4MQBA 1HA3A 5FTMA 3T35A 2XX3A 5DYGA 3SYNA 4GOXA 1ZM7A 3GLGE 1N6LA 2OHFA 4WXRA 1E2FA 2RGBA 2MMCA 2ZS9A 1E2HA 3F0TA 2BM1A 2LCFA 4JYCA 1FNMA 1R5BA 2FDCA 3U7EB 3AVWA 2YC4C 4IDQA 1RYFA 1SGWA 1W0KA 3AUXA 3PEUA 1NBMA 1NN3A 1Q3HA 4DCUA 1UFQA 2F1IA 1AM4D 1KOFA 2WTUA 2NO9A 2AFIE 2JLQA 3UWOA 2JLRA 2WSSD 4LHYA 3T61A 4Q4JA 3BRWD 4NYIQ 2ZJAA 2HV8A 3T06B 3PEWA 2CVHA 2ZRGA 4YDSA 4XTRA 3FMFA 2ZE5A 1B23P 1ZNZA 2F9MA 5FBLB 1GSIA 4TTPA 3T34A 2VP4A 3NVAA 1OHHD 4L4UA 1P2SA 4LJAA 4HB2A 1G3MA 3W3AA 4ASUD 2EWWA 2WIAA 3FKSA 4CW7A 3BB4A 2CJWB 1SVKA 2BBTA 3BIFA 1MO4A 4KVGA 3NBXX 4C0QC 3EPJA 2Z0MA 2H18A 3U6BA 2YJTD 2P6NA 2NZJA 3THXA 5CM8B 1LF0A 2UZIR 5FL3A 2BVNA 1CJUC 3KUCA 4S35A 3EG5A 3W34A 1WQ1R 2AFHE 4FW9A 1VYUA 2IS1A 2GXUA 4A0GA 2WM9B 1SXJA 4PZYA 2WSMA 1VCIA 3W8NA 2ZROA 2ZANA 5KTYA 4MYHA 1P2TA 1OIXA 2WOOA 1GITA 4PPGA 1KZGB 1WRBA 5JSZA 1OYYA 2QAGA 1SXJC 3BERA 1VIYA 2WIBA 1G5TA 3TLXA 3RRZA 2GVZC 2FFBA 4TLDA 4TYNA 1P7CA 4JJZA 2D7CA 1XTSA 2E1RA 1FP6A 2F1HA 4A6PA 2WJIA 3I61A 1PZNA 4JLAA 4EPXA 4F91B 3SI7A 1F2UA 1TF5A 3LRPA 1KI1A 2VIIA 4I1SA 4M9ZA 4GP6A 421PA 1SVLA 1NVUQ 4V02A 3SZRA 3WY9A 3TW4A 3VNUA 5JWRA 2R62A 1DAGA 1GDDA 2OG2A 2XZOA 4QBHA 1Q1BA 1SHKA 2EFCB 1FP7A 1TUEA 3C8UA 4C30A 2A5DA 2Z43A 1LFDB 5CDFE 1U9IC 5D3QA 1KI7A 2A3RA 2W83A 4GNKA 3Q3JB 5JI3E 1KZ7B 4HSEA 3I5XA 2FN4A 1AQUA 2BOVA 3EIQA 2GJSA 3RRYA 4QGFA 1XD8A 4XH9B 4E5UA 1HUQA 5CB6A 2RGEA 1C1YA 4BUJA 4QC2A 1Z22A 4NCHA 1W5SA 4P4TA 2JLWA 4V0LA 4A4DA 1ZNXA 2OCYC 1E79D 1XD9A 3DVLA 4RY2A 4E09A 4OQXA 3KX2A 2QTFA 1KAGA 4QGGA 2BBOA 2Y8EA 3KXLA 4LV8B 4DSUA 4EPVA 4FMCB 4CGZA 5F3WB 3JVUA 2R6AA 2V9PA 4DEXA 1VTKA 4CF7A 5EP3A 2OEPA 4LDJA 1I4TD 3QENA 2LKCA 5KNBA 1JEDA 1QHSA 2B7CA 5L3RA 1M8PA 1FPMA 4IXNA 1KJWA 4PTLA 4YONB 2GBLC 4RZXA 3CNOA 3HPQA 3IDQA 5KUTA 2GAOA 1CR2A 1E2JA 1VG9B 2F55A 2J59A 4LYHA 4MYCA 3GLFE 4AYTA 3CO5A 1MV5A 1S1MA 1Z29A 4JS0A 4PPQA 1A1VA 5IK2A 1J70A 2ZITA 1TF2A 3WMEA 3GLFB 1R0WA 3H2YA 4BZPA 4QM7A 3P26A 1GOTA 3C5HA 4RCZA 1VMAA 1AKYA 3A37A 4TT3D 4Q9IA 3K1JA 3MWJA 4LOAA 1RYHA 2BKUA 4A8JC 3THYB 4MKIA 1KK3A 3IO5A 2EW1A 1CIPA 4URWR 4EDHA 2BMJA 4A6XA 4Q7MB 1E9FA 2F1JA 4Q4JB 5B2ZA 1TEXA 2CHQA 4CEIB 3M1IA 2BHRA 2H17A 4TTRA 3NBFA 3NEYA 3LX5A 1QG4A 5HE9A 4HB3A 5D3MB 5AWFC 5JJKA 4TL8A 4LJ4A 2Q6TA 2NIPA 1G8YA 3VQTA 4URUR 1CR1A 3P32A 4NYMR 3CF2A 3DZDA 4EPTA 4AKIA 4CEIA 2QROA 3T12A 2H57A 1A82A 3TSZA 1O87A 2ZJ8A 1PVOA 3V00A 1P5ZB 5BXQC 1WP9A 2QSYA 3ETLA 3LV8A 4HLUC 2AHOA 1RRFA 1ZM9A 2F1RA 1GP2A 2Q0HA 1NSFA 1OSNA 1E2KA 5ANRB 3KKNA 1UBFA 2RHMA 1IY1A 1Z5ZA 1WA5A 2OFXA 2JLXA 5EP1A 2QPAA 2W6JD 2CDNA 1QVAA 4GMXA 5L3VA 2GZDA 2BMFA 1OXSC 2Q3HA 4I81A 3BJIC 1XRJA 1YRAA 4BFUA 2O8EA 1N6NA 4AY2A 4TLAA 5UKDA 1DBSA 1W4CA 3PIRA 1OFIA 3ZZUA 2X8AA 4TL6A 4M1MA 3GPLA 2QTHA 3EAQA 1FUUA 1NJFA 2YC2C 3TSWA 3AB3A 3LBIA 1W36D 3WBJA 4QM6A 5FUXA 5JSZB 2RAPA 2O8EB 4US0R 2GWHA 3K09A 1Q1ZA 2P3SA 1XWIA 4MYTA 1E96A 2VHUA 4IEEA 4NYJR 4QBGB 2REBA 4MRNA 4U5XA 5HCNA 3UG6A 2ZI3A 3T15A 4BRUA 2K5UA 1N6RA 1RZ3A 2ZJ2A 5AJWA 3WYFA 1YQTA 4HAYA 3KB2A 4ILEA 4PO9A 3QIAA 4OI1A 4ARZA 3REFA 3EW9A 5CDFA 3GEEA 4NYIR 1P4SA 5FL7D 2HJGA 1XD2A 3GFOA 3HU2A 1MH1A 2JDID 2HT6A 2F3RA 3CF6R 1BMFA 3NWJA 2FSHA 1AJEA 4J0QA 2O8DA 2XZLA 2EFHB 4Q03A 2DPXA 1U8AA 3QKRA 1P9WA 5HCIA 4R2HA 4FMDB 4AD8A 3WHLA 4DC9A 4EPRA 2OT3B 3JZMA 4QGAA 1UBEA 1KJYA 3SHFA 2IYSA 3U5ZB 1HE8B 3CR8A 4R98A 2ZYUX 1JR3E 2OFOA 3GCGA 3FE2A 1DAKA 2ZRJA 4RZUA 1OFUX 2ZSDA 3M0EA 2FE4A 3OE7D 4M1YA 1UKVY 1YR8A 2R6FA 3IQXA 4RD3A 4HUQB 4WIAA 3AVYA 4D0NA 4PHFA 5FFMA 5LD2B 3ZVNA 1OKKA 2YNMA 2P65A 2ZM5A 4B74A 2KBEA 1IAQA 2BC9A 1CULC 3GEHA 4NCJA 4M9QA 1W36B 2ZRKA 2WPDD 2ZS8A 1F5NA 2ZR9A 3W8RA 2ZI6A 4EAQA 4V0MA 3W6NA 1FNNA 2WKPA 1E9BA 2EWVA 3PENA 1JXOA 3LNCA 1N2CE 3D31A 3IBYA 3JZAA 5AUNB 1YU9A 3D6TB 3GLIA 1KMHB 2DFTA 3UPUA 3U7HB 5JJIA 1QHGA 2ZU0C 3IIKA 4HAWA 4ZKDA 3EZFA 3CKLA 2VF7A 2XITA 4BFTA 4QG7A 5JLJA 3AQ4A 4TMZA 3B6EA 3GLFA 2NMVA 1TADA 2KWIA 1CRPA 4A2WA 2ZRIA 1UJ2A 3GLIB 1II9A 5LDDC 3H84A 3NKVA 4TSFD 3PXGA 2YINC 4D0GA 2H16A 3W6PA 4OYHA 1G7CA 5CK4A 1EESA 3THYA 2QSZA 3LQRA 3BGWA 3X1ZA 1LY1A 4EIWA 4RCYA 4ESVA 4KBGA 1KKLA 3OHMA 1LTQA 4BLTA 5KHOC 1E2QA 1D5CA 4PFSA 4AC9A 4B48A 1V43A 2VLIA 1JALA 1LVGA 2DFNA 4UJ5A 3X1XA 3LAWA 2DWPA 1Q44A 3MMPA 3OIYA 4IJMA 4B2IA 4C4PA 4DWJA 3PEVA 4O25A 3AVQA 1G16A 1FUKA 1X8KA 2Q3FA 1US8A 2VH5R 1JR6A 2AWNA 4KVAA 2C04A 4HEJA 3GFPA 3HP1A 3QKTA 3BB1A 1PLLA 1N5IA 3ONWA 4HZUB 5L3QA 1IY2A 1F48A 1N3BA 4DJTA 5GJVC 5TDHA 1N6OA 4MRVA 1K8RA 3QJYA 2B7BA 2QG6A 2OAQ1 3N70A 2GESA 4IDHA 1MRNA 2YVUA 5CITA 1Y3AA 1GIAA 2P5SA 2YYZA 4C0AC 3GD7A 2IF2A 3FGNA 2DHRA 4PAQA 4PC1A 4DLXA 1FW6A 1E9CA 5GJCA 1RVDA 2VEDA 4TL7A 4B6EA 2N1BA 1Z8FA 2VHQA 5IK2D 1E2DA 3BC1A 3QEOA 5KDLA 4A36A 1OFHA 3QPVA 3B9PA 4KU4A 4M1OA 5DN6A 4TLBA 1RRPA 2ZXUA 2BMDA 4NBSA 3A8TA 4LGMA 3CNLA 4EJSC 4XVRA 5F9HA 2B8TA 3CRQA 4XWKA 2ZS7A 2N42A 3UXMA 4D2IA 2B6HA 1RKBA 4RKFA 1S9DA 4DCNA 5GJBA 4AYWA 2OESA 4L15A 3WBKA 2QI9C 2R8RA 3OEHD 1W5TA 4IVRA 4RFSB 3WRYC 4BFZA 2XSZA 3TNFA 4K46A 3O8RA 3AKYA 1DO0A 1VKJA 4M9XA 3RAPR 1H8EA 2RGXA 1XD2B 2ODWA 3QUSA 4LBVA 2EFGA 1Z6GA 4BZQA 4M1WA 3RNLA 4F4JA 1ANKA 2FJUA 1R5NA 4LHZA 2IHBA 1XB2A 3RRNA 4Q1CA 4LHWA 1NVVQ 5FTNA 5GVRA 4NPHA 2MSDB 1ZUIA 2ZAMA 4B71A 3GLHA 2GDJA 4I1UA 121PA 3NEJA 4M8NE 4UNRA 4C7OB 3ND8A 1VCMA 4OQMA 1E94E 5C1BA 1UAAA 4IOKA 2VHTA 2D7DA 3ICEA 2DWQA 4DBLC 3U44A 4R9UC 4F7WA 4OHWA 1QBKC 3X1YA 2GXSA 5EUQB 1U81A 4IDPA 2REOA 2QT1A 1U8ZA 2DBYA 3DPUA 2CXXA 3D8BA 3BFKA 3KJGA 3W3ZB 5CB8A 2OXRA 1KI9A 2FG5A 5FPTA 3EA0A 3TW8B 5EE9A 1Z63A 5TXGA 4A2PA 1OLOA 4JLJA 3ZS8A 5FPYA 3SC3A 3U44B 1GRRA 1VDZA 4OJKA 1G8FA 4CT5A 1W46A 1OH8A 3MG9A 4ZDJA 2D2FA 5DGXA 4B33A 2YWEA 1OW3B 3ZVLA 4H1UA 4XVUA 1FQKA 4F38A 1ESNA 1G1MA 1D2MA 1W2GA 1KKMA 1X8JA 1YR6A 4HDCA 1KMHA 4NYJQ 3VR4A 2XXAA 5FBRB 3W5IA 1RIFA 2J41A 1G8PA 4IOMA 2OM2A 5EQTA 2IC5A 1L4UA 1JQLB 1XCPA 2C98A 1Z0DA 5G3ZA 4DXAA 4B2PA 1IN7A 1PLKA 3W5JA 1GKIA 4JL8A 2VBCA 1MO6A 2O0HA 4URZR 3K0FB 3NHAA 3LO5A 1E4VA 3A1TA 4AG5A 3FOZA 2A5JA 2VL7A 1U94A 3WP0A 2XXAB 2CHGA 4D4JA 4BEJA 3FFAA 2ERYA 1GL7A 5CM9C 2ANCA 1NL3A 3CB4A 4GBMA 4TQUS 3KQKA 1G7RA 5EXXA 3GLGB 4RKEA 2A78A 5EXSA 3SE0A 1FOEB 1R0ZA 3MGCA 1HH4A 1COWD 1FQJA 3FTQA 3LBNA 2KB0A 3TUJC 2BV3A 1V5WA 2YOGA 1KSJA 3NDPA 4YMTA 1DAIA 1E2MA 1JI0A 4KHZA 4M9SA 3SS8A 5J47A 2G77B 5L8VA 4PQFA 1YZGA 3L0OA 1G19A 4RZ2A 4D0LB 2QQ0A 4MH0R 2C77A 8OHMA 5H1YA 5DYIA 3SOPA 2NPIA 1W0KD 2ORWA 1KO7A 2BEJA 2X19A 1NMYA 2OCAA 3DKVA 4URVR 3M4YA 4HATA 1MOZA 2BJVA 5E7JA 1ZIPA 2XNDA 2VHJA 1W1WA 3DL0A 3K0AA 4A9AA 4CEHA 3K9LA 3MFYA 3W90A 4CDGA 1GUAA 4BFXA 2IEYA 4OQLA 5E3HA 1AZTA 4Q1AA 5TB5A 1JEEA 3PJRA 3ZVMA 2BWJA 1JXMA 1NY6A 4ZDWA 5HPYB 4CEJB 4Q02A 3GEIA 1EWQA 1X86B 1Z0AA 2AK2A 4URXR 1HT2E 4TTQA 3FWYA 1JAIA 2G3YA 3K9NA 3L82B 3UANA 3ADBA 1A2BA 3K9GA 4FN5A 2IK8A 2ZJZA 1JAHA 3H4MA 1T8UA 3I4LA 4JSTA 3SEAA 3GJ3A 1E9RA 2ZRAA 4BFVA 4LJ6A 5G40A 4HAZA 3TH5A 3SBDA 4Q7JB 3G5UA 4V03A 1E2GA 1P72A 2CCGA 3AP1A 3WXMA 2GEUA 4IW3B 1R5OA 1DS6A 2F9LA 2ZYVX 1SHZA 3SJBA 4NCNA 5A4JA 2B92A 1Z06A 2WWGA 1H8ED 1Q1EA 4UXJA 4WXPA 4HZIA 2ZRCA 4UQOA 3EXAA 4JZKA 3WMFA 2D4HA 4WZ6A
chains in the Genus database with same CATH superfamily
1RD4A 1RQPA 3VVCA 1M8JA 4K03A 2C20A 3OM8A 2GJKA 5ITVA 1DT3A 5TMEA 3U4GA 3FRIA 2QIPA 2ZSFA 3DYBA 4OYLA 1EP1B 2ERCA 3NLLA 3TOXA 5H4GA 1E1QD 3P71T 4NF2A 4JJEA 2O2GA 5J4KA 3ECAA 1EVLA 4XLZA 2ACKA 3EXIB 4LKOA 4LDRA 1CDEA 5DOVA 5JVDB 3SF8A 3URKA 4MWDA 3PNLA 1ZQ9A 1SC9A 3BGOS 5AJUA 3A9SA 4AMZA 2OTCA 3A6DA 3CINA 3LFHA 4A82A 2GZMA 1N5KA 1QHIA 3IE1A 2X0RA 2HA6A 1VE7A 3GJ6A 4IDNA 2QMEA 4TVKA 1C8VB 5B30A 2YMQA 4PXSA 2VA8A 2C2ZA 3NALA 3ENKA 5J5CA 4MP8A 3F7OA 1KP2A 3OY7A 4LRUA 1BMQA 3PXUA 1M6VA 3G9ZA 4TUYA 3ZKWA 5IYZB 1AKVA 3G0IA 1GLNA 3D81A 3NIBA 3RJZA 2NO7A 3C6YA 1USKA 1KGSA 2GRJA 3ONVA 4XCVA 3O8OB 2AXNA 3WQRA 4LDAA 1VE6A 3KELA 3QQPA 3CH4B 1BGXT 2Z9DA 2LV8A 4FBMA 1Y33E 4H7IA 4WCDA 1N0IA 3O4JA 5E7QA 2JD1A 4BQQA 2A0XA 4U9HS 2RGGA 3Q10A 4DNOA 3FUTA 1RXEA 2FQXA 1T5TA 2V7UA 2JIZD 3EEFA 2RG7A 1IJEA 4WSOA 2JJYA 4G85A 1E9DA 2GK6A 2CHVA 2C8KA 2D5BA 1A5SB 3CLRC 2YFQA 3LX8A 3LX6A 2W6NA 5IVDA 3TVTA 5LOVB 1J6UA 3DFIA 1K75A 5LMNB 3NHYA 3CLVA 2QUZA 1BFDA 2NM0A 3HI4A 4GKAA 2OQIA 3TLGB 2JFPA 5LU8A 3WA7A 3QBJA 1NNEA 3TGWA 4FDLA 1DKOA 3KPWA 4G89A 2ZTLA 4PG8A 3RT9A 2F6RA 4RDXA 1Z2PX 3RD5A 4ZQHA 1TA4A 3H0CA 4L02A 3VO8A 3OEED 3NV9A 4Y1RB 4Q5IA 4K6GA 1PVDA 3BA1A 3UAWA 3NZEA 2J0SA 1SHUX 3T7DA 1QH8A 2A4MA 1X7GA 1DUIA 1PDOA 1A5ZA 1GGJA 4MLCA 4XIFA 1Q3TA 2QM8A 4U2FA 3RG2A 2Z5LA 4LMPA 4HS4A 4RVDA 5DE3A 4JYAB 1JEAA 1ELOA 3OE5A 4IV5A 4MAFA 3BRSA 3EJ6A 4PRKA 5DDIP 3FTEA 2CDAA 5EMNA 5IH3A 4EG8A 1N2JA 4CNBA 3RJ5A 2E85A 4WVFA 4P4SA 2BUAA 3VI4B 1JFFB 4B44A 1ZH4A 3GCZA 2R65A 1W34A 3JRNA 1PFGA 1TJNA 1HF3A 4I50B 3JAKB 4WK4B 3TBKA 2DWOA 2HWKA 1GZSA 1V8OA 4PVDA 4NCBA 2YMPA 4CEHB 3KALA 1SH7A 1ZAKA 4BJ1A 4J07A 4ZHQB 5BW6B 3K70C 2HJSA 2UXBB 2ZM6B 5EKXA 2FLKA 2LD4A 3ORYA 4GOKA 1H4TA 1HL3A 1M3SA 3AX6A 1C4OA 3T41A 1ZIDA 3IKLA 3AF6A 4S2EA 2XDAA 3WE7A 1MKYA 1GCGA 1EVZA 1H69A 2F43B 2OB2A 2HXGA 4F2DA 5AW8A 2YWJA 1KTVA 3B78A 3RVBA 5IM4F 1GXSA 5ES3A 4PR0A 3QU7A 1LQTA 3EA5A 3GW8A 4WRRA 5EA2A 1UPTA 3QXXA 4KR3A 4UVDA 5KSYA 4R3WA 4Z86A 3OQIB 4C0BA 2KI5A 2VJMA 3F9RA 1NWHA 2EP8A 1DO8A 4NKRA 5CJJA 3A9VA 3MZ0A 4Q3EA 1SKYE 3QVLA 2JHCA 2ZT7A 3LPAA 1RWOA 1KERA 1T34A 3C6BA 2OD9A 4NI5A 2IS2A 1QMPA 2WF7A 3D2AA 4MSUA 3BULA 1T2NA 2IU6A 3F4BA 1Y7TA 3WO0A 4JWKA 1VKRA 3U60B 1CQPA 1YZKA 3WIDA 3TFOA 1SUBA 2ZDQA 4YUYA 1UMDB 4MCJA 4WE3A 2IZOA 5JXWA 1ZR4A 2O3RA 1URPA 2DBVO 2V6JA 4MDHA 2KM1A 1W9MA 5H9VA 1FU8A 5AW4A 3AHHA 4CT0A 2CY0A 2ZRBA 2YVLA 5JW6A 1G6KA 5U1PA 1HDGO 3T1OA 1F2TB 3U6KA 4RK4A 2EV9A 2FR1A 4Q3KA 4RSGA 4D8WA 4HLDA 2RGAA 3LSYA 4BIIA 1MB9A 3HJNA 3BGDA 4BO5A 4HPXB 4KXYA 5K9ZA 1YJ5A 1T5SA 2QRLA 5F51A 4GXRA 3R3UA 1SUDA 5IFLA 5TE9A 1TJ4A 4PHGA 4JY7A 3LWZA 4RK6A 3B70A 1CJSA 1OV4A 3KHSA 3WB0A 1VIVA 4MGKR 1MA0A 1Y6ZA 3MA0A 4RA6B 4Y1FA 4AZ3B 4UFOA 2AMYA 1QP8A 1VB3A 4MCAA 1WXXA 1PG2A 4IIUA 3U9SA 2FPOA 4HT3B 1L5OA 3SZ3A 4CDNA 4ES6A 1ZD8A 4FDTA 2ZYRA 4GLBA 4FNAA 2D74A 1KFEB 3FVQA 2YY6A 1UK6A 1XMJA 1Y9DA 2CBZA 3IT0A 3IILA 4Y2UA 2TMYA 1XCBA 5D86A 1FDUA 2YOHA 1W73A 2ZWIA 4Z9AA 3GJ8A 4W7IA 3WYEA 1GGEA 4EYQA 1Z39A 3HYNA 1IN8A 4HQLA 4YGYA 1EBFA 3QPDA 3LKBA 4FLMA 4MX8A 4QICA 4QASA 1UMCA 1C3OA 3O92A 3ZIUA 1YDGA 4TMKA 1ZJZA 3ANTA 4UTXA 2WILA 5BN3A 3QE9Y 3GGJA 4KRXA 2V1UA 2XXBA 2Q2OA 3L05A 3O8OA 1X7HA 4I1VA 1WU7A 4K86A 4YMIA 1KSFX 3ILHA 1ZGHA 3NETA 4DSZA 2JVIA 1GYRA 5FNVF 3HJAA 1NAHA 3X2SA 3C7CB 4FEGA 2ECPA 1TB4A 3N58A 3OZUA 5FNVB 4B47A 4EGQA 4YMLA 3QMVA 1K6MA 4IX1A 5KVQA 3P2OA 1U3CA 4R1LA 4DM3A 2FWRA 1GPJA 2WG0A 3AEQB 3N5CA 4EFNA 1QO9A 2N1MA 5GZ3A 4JBNA 5ECWA 1KYXA 4NBNA 4U8GA 3CVVA 3UJ7A 3X1JA 4NFYA 3P97A 2CE7A 1A5BB 2HZ7A 3RYTC 4FR0A 2VQEB 3LBAA 3RTCA 4MEBA 2G8NA 3FNIA 5IARA 4GKJB 1N4AA 5JTUA 1AHIA 1UEJA 1EVQA 1M34E 2JAQA 3I64A 4JVMA 4BGEA 5LA6B 3QVUA 4FFNA 1N1GA 2OUIA 2ZT6A 4BQPA 5J63A 3DP9A 1L4HA 5JAZA 2X0EA 3O94A 1DIOB 4A5OA 2XSZD 2GYVA 1R00A 4B0PA 3PC4A 4BNGA 1KSGA 4JDPA 5ES4B 3NGMA 2IOFK 4PZCA 1X9GA 3EXHC 2Z8YA 3TJRA 1GFIA 4YJFA 5TQ0A 1HETA 2QS9A 5FI0B 1QIIA 1BHJA 3TDMA 2YJZA 3UVEA 1GZ6A 4JVLA 5AW0A 1GPH1 3C87A 2D2IA 1UJMA 2ZTHA 2QQFA 3ELDA 1ZU5A 3Q7SA 4PV7A 3M6UA 4MJ7A 3U4IA 5F3DA 4NMWA 4X6YA 4Y0AA 5FLKA 4B3SB 2BGGA 2FHPA 1Y3CE 2A30A 4I4TA 4OHKA 1ODSA 4OI4A 1XZBA 4I14A 3MTJA 2CK3A 4MKXA 3LCUA 1QF7A 2ID4A 1KE2A 5IWCA 4KO2S 2O5EA 3D8SA 1PK8A 2PBLA 1BYUA 3IJRA 3JATB 4KN8A 3ZVRA 1GQSA 3MBOA 4D3FA 4ZZ1A 9LDTA 3O2JA 2XXJA 1J8MF 1Q0UA 4MVJG 4PC7A 4YXWD 4L8GA 3IB3A 5KI6A 4OP1A 2PA0A 4B8WA 4I4TB 4D3XA 1Q7GA 3BM5A 1VL2A 4HGOA 5KSPA 2Q5EA 1W1IA 4WK2B 3H8WA 4B3DA 4X6LA 2P11A 4BE9A 2A0WA 2BY4A 3T5PA 2QT9A 2AKEA 3DZKA 2KPOA 3A0UA 3HO6A 3K70D 5EN4A 2XE8A 1CP2A 3UCFA 4EFKA 5DN6D 2VJLA 1D2NA 2IUTA 3DV0B 2R8BA 2Y4OA 4FFVA 4O2AB 5DLQC 3FUWA 5FPQA 5JTTA 1FDVA 3STTA 1H1LB 3MD0A 2BIFA 2X86A 4OY3A 2YIVX 2DP4E 3G1UA 3OQIA 1FBNA 2JI4A 3P9NA 4CFYA 2UYQA 3IQEA 5EJ2A 3VM6A 1U0LA 1IRXA 2FP4A 2D7JA 3P9ZA 1M10A 3IKMB 3P9KA 1ZVQA 3V4RA 3EWAA 1QUFA 2PTGA 1FFXA 3GF4A 3PUWA 1G8MA 2PMFA 1CZNA 3R5JA 2QORA 5ADWA 1H3NA 5D3MA 1O58A 3EVTA 3C8DA 3KJEA 2QVGA 5ALZA 2G4LA 5HRCA 1E5LA 1O89A 2LBPA 4F3KA 5H3HA 1ODCA 4C7XA 5HFJA 4HDMB 5KVAA 1UMDA 2DMRA 2P5YA 2QMHA 3EFHA 3U4DA 1XAHA 4Z4HA 3VA7A 4IMIB 2CXTA 3HUFA 2PBFA 2PS0A 3UY4A 2ACVA 2AJTA 2ES4A 4X97A 1VIAA 5GPBA 3V34A 4DREA 3JV7A 5ELXA 2BGMA 3ZGOA 4NYMQ 5CDSA 4ZO6A 5DO9A 3X1MA 2EP7A 4PLZA 1JG2A 3ECSA 4GC5A 4DR4B 2IPMA 4CODB 3PFWO 4OIFA 5AJTA 3SEFA 4B17A 4FT4A 2AWOA 5E2BA 1H8HA 1NQTA 3RYCB 4XEHA 1TQ8A 1KQOA 1ZM3A 3ZW9A 1C1DA 2ZJBA 3BIXA 3HBFA 1T3LA 2WHYA 4BJ6A 4DY4A 3LL4A 2R86A 4Q3BA 3WOVA 3UKDA 1M34A 1U8EA 1K7CA 2IVZA 1T8PA 3IURA 3S28A 3UJ6A 3W2EA 5GGYA 1XI2A 5A6SA 4C0SA 1WAMA 3DDCA 2JGAA 4BXOB 4UE6A 1OAOC 1X7YA 1UXKA 5F98A 1NN5A 1AGYA 2QP9X 5IZCA 3I1FA 3LY8A 3KKEA 4EMSA 3IIJA 4QQ8A 1ESDA 1Y9EA 4JASB 4REQB 1R10A 1YSCA 4WKBA 1CUVA 2WNIA 2NO5A 3EPPA 1AMUA 2PO5A 3KLOA 4RO0A 4UFNA 3RNOA 4GP9A 1QQAA 3WO1A 1S8OA 1C0IA 3OC0A 3PGA1 1JNXX 1WY5A 2QXUA 3AFNA 4L8YA 3I0ZA 1PJ8A 1E1LA 3CZMA 3QUAA 1DPFA 3S0JA 2E5LB 3V7NA 3LH5A 4KFUA 1W4RA 2H9AA 3JQQA 1XL1A 3L07A 2W6OA 3U7QB 4X7PA 4A0FA 2R47A 3U7FB 1XRNA 4U39A 2ONYA 4IJVA 3BHMA 4F3CA 1R6AA 5LXTB 4GGPA 2G1KA 2X0NA 4JJ7A 4MJ3A 5B4UA 3LC1O 3MJCA 5FLXA 3IAEA 4KXQA 1GT6A 1LNSA 3D4PA 4QU5A 4RXMA 4OQYA 5K0NA 3ZOKA 3DBRB 2VJDA 5ICFA 1A71A 2YYSA 3ESQA 2XKAA 1KK0A 1LX7A 1VGVA 2B1IA 3ZU5A 3H2ZA 1DC3A 2A1UB 3KQNA 3O8DA 3RWMB 2OCBA 1P1JA 1JJ7A 1KSHA 3B7GA 1IG3A 5T6MA 3AI2A 4DABA 1ADJA 1HTTA 2FMXA 2YOFA 3CZ5A 3JD1A 2KE5A 4RMGA 2FJPA 5G4KA 1DKMA 4JIMA 4TTAA 1BOFA 4R8LA 2XGMA 2QM0A 5KYWB 1FTWA 1I2CA 1CWUA 3CUTA 4N03A 5C4MA 1LD3A 1RPZA 4TLLB 2DC1A 3WZMA 5DH9A 4EHBA 3H13A 3MS4A 4IXWA 4K81B 1X0VA 4N6NA 1JLLA 3FF4A 1J5EB 1AKNA 4MK4A 4YYZA 4X7BA 4TXHA 1YDMA 2PKYX 3RS8A 5CCXA 3SS7X 4DLSA 4F8JA 4CE6A 3DTVA 3FCEA 1M2WA 1WBBA 5BR4A 5A5VA 1RJDA 3GA0A 1ATIA 2ZJFA 2XCRB 1FVFA 3KEMA 1TJPB 3R4CA 4UPEA 4ZXFA 1KXJA 3TVYA 4II7A 3SYKA 4S0ZA 4JXZA 1RQ7A 1ZDMA 1O96A 3KKQA 4DFDA 4DCTA 3GNSA 4EZEA 2H1OA 4UKDA 4JR1A 1V7CA 2RDMA 3BBPA 4LUCA 1TKRA 3CLHA 5IXYA 1IU9A 1P1RA 2P62A 3AGQA 3DWGA 3BDIA 4R8RA 4LSGA 5I3CA 3M6AA 4M0MA 9GPBA 5L40A 5C7LO 4HX2A 3KQUA 4AVYA 4MUYA 5DM2A 2B9EA 2QVLA 4IH4A 5CPBA 4DB4A 2CSXA 5DGIA 3OU2A 4X84A 1VA4A 1XDUA 2JCGA 2GETA 4CKBA 2CL6X 3RU7A 1A9TA 4KUHA 5IBQA 4J2OA 3JX9A 3HJFA 4LGCA 2QZJA 3OJLA 1E3QA 4FPXA 4AKEA 2JRCA 4FCCA 1G3UA 4OHPA 5IW8A 3SXUA 4EP1A 2O19A 4P84A 4JXJA 2XMQA 3D0QA 5JV5A 2UZ1B 1B76A 3W8FA 1K7YA 4U2KA 4IIBA 4K9MA 1UM8A 2DTXA 2HOQA 2R00A 3QPBA 4QBFA 1WABA 3ZZNA 3FFTA 3GNTA 3OX3A 3PXDA 4JJKA 4K9OA 4EITA 5C8DA 2JGEA 3AF3A 4UEOA 3OT5A 1G7TA 2MTBA 621PA 2MSLA 2R1UA 4MR8A 4D80A 5JH7B 4FR5A 2AZMA 2BUBA 3KBBA 2RKBA 5ERXA 3ZY2A 3WLMA 5M29A 2D1QA 1HQCA 3KV1A 3EVGA 4I55A 4OHCA 2VYFA 1EG7A 4HZUA 3T0IA 4G8BA 4IDGA 3UK7A 2DHQA 5KQMA 5LQCA 3VJRA 4XJTA 4XR4A 5LB2A 2WD8A 3RRBA 1DRJA 2H59A 5TC4A 1UPXA 2QNBA 3MIIA 4QTUB 4C43A 1RPNA 4BS9A 5AI0A 5H80A 1QTRA 1T9HA 2OXFA 1XWWA 5AHXA 4RD1A 1TZJA 3A2NA 4WV3A 1MW8X 1P81A 3O0DA 3D3WB 4GOJA 4IQ0A 4BV8A 1XV5A 3VPDA 1SC1A 1A69A 1PYGA 4ND6A 4P32A 5DNYB 3UMSA 5L3SB 4IIFA 4QOSA 5FLEX 1K2VN 4PNPA 4FZ5A 3BGVA 3ZGVA 3UYKA 3BL5A 4K40A 3OZCA 3FCSB 2UYGA 5C4GB 3N8DA 1TT7A 2F3SA 4UHCA 3WLEA 5KNLA 5J2TF 2EKDA 3ZE8A 5M04A 2XMBA 3H2HA 2GLTA 3HYTA 4EEXA 3GIWA 2ZIUB 2Q3MA 3OESA 3P2IA 2PX2A 5CH5A 1ZH6A 1JKFA 3IJPA 3B1WA 2TMDA 3M6MD 2JJ2D 4RMHA 4DA4A 1XVVA 2BGUA 1TIPA 3VYTB 2K2WA 4R2IA 1GU1A 3INGA 2OFWA 2H1CA 2XVZA 3UAOA 2HU2A 2RAUA 2UZ4A 4PTYA 3TRDA 4BUZA 2FWBA 4M36A 1DJMA 3AOEA 1BVUA 2R68A 1PO7A 3O8NA 1Y9AA 2X6QA 2FFJA 3R7DA 3QKUA 4Y9TA 2BRUA 1TQHA 3ZW7A 3EGWA 2VTKA 3CWZA 4DV0B 2X3YA 1ODFA 1YF3A 4DIEA 1WR8A 1H22A 1DQSA 1EJ0A 1PIWA 2MR5A 2OQRA 2B2CA 4O08A 1SVWA 4WUVA 4ZC1A 1L4FA 4CM8A 5REQA 5ICCA 5BMVB 2FZLA 3OQHA 1HDCA 4HWSA 2WHXA 2XOKD 2ZIZA 2RC5A 3OY2A 5EGSA 5B57C 1QQBA 2FRXA 2VPIA 3TCXB 4ZYWA 2J09A 3ZYZA 5C3MA 4DLLA 3WWYA 7REQB 1X8LA 4GS5A 4LF4B 2WFLA 2ZXEA 5CFNA 3CF4G 2NUPB 3MT8A 1RT9A 2RONA 2AD5A 1VL0A 4CUZA 1Z0JA 1DAEA 1NN0A 2AE1A 3RH0A 3RHZA 1EKXA 5AXCA 4UM9D 4GWGA 2CNOA 2AF3C 5HKAA 3SKVA 4FHCA 1NQOA 4MWGA 5IWAB 1QORA 3AEXA 2WFLB 3WGYA 1TECE 2DULA 3KVYA 3D7LA 4AY6A 4QREA 1T0JB 2NUPA 2VRCA 2GZAA 4KWCA 2FV8A 1YHYA 2Y0DA 3H6KA 4F4DA 4YRZA 3TR0A 5KYVA 2VZLA 3GGDA 3JARB 4PZAA 5AO9A 4Q66C 5KWEA 1JT9A 2QD5A 3Q3VA 5IT9A 3D6MA 1XQVA 1KDOA 4Q4AA 5IHPA 2IYZA 4TMXA 5CB4F 5FWYB 2C29D 1TVCA 1Z6PA 2UZ0A 4WBSA 5DM1A 5T67A 4FFSA 4Q37A 1M0SA 2GAAA 5JROA 4FLFA 1CF2O 3HY6A 4MITA 1YKSA 4WCFA 4R1OA 3ROTA 3HCWA 4ZMRA 5AFSA 3K0SA 1TRKA 1SFRA 3WNQA 3R5KA 1V1RB 4FHFA 1I0ZA 2WWTA 4W9MC 1RZUA 3OIVA 1R4NA 3PWSA 4EELA 4CQMB 3K0CA 4WH0A 1NLYA 1SD1A 3I5MA 4RU1A 3ER8A 1M2OB 4K3VA 2WG1A 3DKIA 1QPBA 3ZI4A 3HU3A 3PF9A 4ZCMA 4BWGA 3NYRA 5CMLA 3WGKA 4HYEA 1DRKA 1U7HA 4ASUA 4B6FA 4HFNA 4AJLA 3RQSA 4DBZA 2ORIA 1VJ0A 3V9AA 4NQZA 2DXIA 1QIKA 3TMKA 1TYDE 2SCUA 5K4HA 1E69A 3EEQA 5J4LA 2ZE6A 1TUBB 1AUQA 1WSAA 4LXXA 1PT9A 4AFNA 1OH7A 1U7TA 4FC6A 4YAGA 3IO3A 2F67A 4WD3A 1C1XA 3B1FA 2FEOA 3GDFA 1XMSA 5LIPA 1F12A 1FS6A 3UAYA 1MOSA 1DOAA 1SVSA 1WE2A 4FMPA 2ZREA 2ZW9A 4NBVA 4RM2A 2JCSA 3DM9B 3S8YA 4ILKA 5EXDA 1H5NA 3GUVA 4D56A 5F52A 2BELA 4UD2A 1EBUA 1R27A 5K6AA 3NWBA 3DD5A 5EYPA 5IKOA 3A36A 5EIHA 2VR1A 2IKSA 3HZOA 4GKVA 2R2AA 3ZKAA 1N2ZA 1COWA 1NBMD 1RW4A 2A9OA 1DC4A 3IH5A 2PLFA 3QP9A 4YQYA 1T3TA 1QFZA 2OCPA 4NZOA 4D82A 4L7QA 2OBMA 4A0SA 1XIVA 2I4TA 1NP6A 1X94A 1AS2A 1G3QA 4ZYXA 4XA8A 1Z5NA 4AQYB 2J45A 2O0KA 2AFVA 4OVKA 1BMDA 5JSUA 2VTEA 3O1IC 3E22A 4R4JA 1W44A 3IE2A 2IH5A 2Z2YA 5TIIA 2AYXA 5FD8A 2PMWB 2B4TO 1V8BA 1XXHB 2NU6A 4RELA 4LFCB 1GZUA 2CLIB 2DR3A 4EY6A 5LSAA 3VZPA 3PT9A 4MJXA 3TZLA 5NULA 4EA6A 2XF8A 5CB4B 3MN1A 5LXTF 2KX7A 3WL7A 5JISA 1CE8B 3RLFA 1FZQA 1P6UA 1QLJA 1RXCA 2BMVA 2PZGA 2QYTA 4ER0A 2PUFA 4X94A 3JS5A 2RGNC 3W77A 4Z54A 4BO3A 3TTSA 2VAMA 4MLPA 3U7RA 4C04A 4ER3A 2JH9A 3F97A 5LU9A 4MHTA 1WNTA 1HG1A 1I1OA 3NG1A 1F51E 1C4WA 1QB7A 2PSJA 3C3XA 3CZCA 1J90A 1PR2A 3KCNA 2DQKA 2HMTA 1KAMA 4FIDA 4J9UE 1QCCA 4QOFA 4FB4A 1Q2XA 2W0MA 3AY3A 2PT9A 3EXHB 3PDCA 4OHRA 3G6WA 4KEAA 3T3HA 4A1OA 5EJ7A 1BQEA 1PF7E 2BJWA 2IE8A 3ABIA 3L5KA 4Z8XA 3N0RA 3TGPA 1CHNA 1P3Y1 1NONA 1ND5A 1DZ3A 1VDMA 2WF5A 1LDNA 1T4GA 4OFWA 3ZE6A 6GPBA 4ENTA 1H9AA 1O1YA 1WB5A 4L4ZA 1YIAA 4UM9B 3KEOA 3C14C 5J5AA 2WT9A 1B0UA 2APJA 2F3UA 2C95A 4QYSA 2QZ9A 3OO1A 4UBOA 4BGDA 1XROA 1O9GA 1JECA 2JW5A 4O8ZA 1ISFA 1NI5A 3A9TA 5H8WA 3R7BA 3O0TA 5ULLA 3G23A 3L8CA 3MWLA 4GRIA 1VHTA 3INYA 3TRKA 3A10A 5IBCA 1B93A 1HLDA 3OIFA 4C78A 1YS7A 1AUVA 1D6JA 1WXDA 2GNOA 2OO5C 5AK0A 4UVIA 3QH4A 3NV7A 4ND5A 2O3UA 5JQGF 1A8IA 2ZCJA 1QAOA 2FSSA 1CS4C 2NZXA 3RVMA 4J6FA 1FRFS 4YACA 2OV8A 2XUJA 4H77A 5CJPA 3RJTA 4J4BA 4IAOA 4LIPD 4E03A 2R0QC 2XQGA 4AUEA 4F84A 4M54A 3ZPXA 3L0ZA 2VZEA 5CYPA 1XLVA 1ZNQO 5SY4A 2HJ9A 2YMMA 4LXQA 2VDWB 3R7WA 1GDHA 3F8WA 1ZN2A 1C9YA 3ESRA 4MWCA 4O4HF 4WLFA 1ZK2A 2I4IA 5EE0A 3OPNA 5FA8A 1UBMS 1P0PA 2J7PD 3F4LA 4KTVE 1YIOA 1B8OA 1DRWA 4IIGA 4TX1A 1KVQA 5F23A 3WV5A 1NKVA 2OENG 2O8NA 2H2FA 4J8PA 4J1TC 1JDNA 5A4AA 2E48A 1KI8A 4KLRA 2YY7A 2YFHA 4X1IB 1PEYA 4BPBA 2HADA 2JPDA 3SLKA 3DOOA 2PAAA 2J3IA 4L0MA 1K8ZB 1Z07A 4N0DA 1QK4A 2W37A 4GSYA 4MV1A 1RVV1 4Y8VA 2JJ2A 3RU2A 3ZC3A 2WHQA 3JVDA 4CM1A 3TLGA 5K8LA 2IUFA 1T2VA 4L50A 1RE0A 3AVTA 2D0DA 1E99A 3FPSA 5C31A 3C6XA 1IONA 1HWYA 2ZR0A 4QHTA 4OFXA 4PN3A 3RUHA 2HU5A 2QTVA 4W1QA 1FSSA 1O6ZA 2AH5A 4GPTA 2ZATA 2AS0A 4J2HA 3SZLA 4OX9Y 5EEHA 3ZXYA 3B6IA 3QLTA 2VSFA 3KSZO 4K0RA 5A5GA 1NUHA 4ZI7A 1QU2A 4OOFA 4MIEA 1K5PA 3WYNA 5JQWA 4Q7KA 2GXQA 2QN6A 3GZNA 4R68A 5D84A 3B36A 2X8JA 3HVIA 3WB1A 3X3HA 2FWAA 4JU8A 1YE5A 4JQOA 5G0SA 1D2GA 3UV7A 3SR0A 4CMAA 2Q29A 3ORFA 4K8OA 5KYYB 3H2GA 3NHMA 1RZVA 3NC0C 3CPEA 2P75A 2MJLA 4KXLA 4Y6SA 4HGNA 3W7VA 2WJ4A 4LJ9A 5K7SA 1F7UA 2BI7A 1NTOA 4LYDA 2ID7A 4UE2A 5CLIA 2BE9A 4FHZA 3RVPA 4OHBA 2FMIA 5T8KC 1U0RA 2YXDA 4OQZA 4YRBA 5CBPB 1XMVA 2C9OA 3MWYW 3R3ZA 2JFVA 2REQA 4LQ4A 3TJZA 2OB1A 3JAWB 3M6IA 4I08A 5FYDA 1WD5A 4J7XA 4TLCA 1Q0TA 1ABEA 4P3YA 3P52A 4LRQA 1VPEA 2DSNA 2OC4A 1L5YA 4FGLA 2HR1A 2GN0A 2FHSA 2Q2VA 4OU5A 3ETDA 2PIDA 5KMGB 4AW9A 4C76A 1E7RA 1FLDA 4PLFA 4ACAA 5K51A 1GYPA 4KGVA 1CUYA 2RGUA 2OXIA 3O84A 1CJKC 3LHDA 3QI2A 2B4KA 1OPRA 1C9MA 3WKBA 2OCLA 3ETCA 2BTQA 2Q8PA 1S4MA 3AINA 3ETHA 3JD4A 3OF2A 3HDTA 4OXYA 4XASA 3T8YA 3EPLA 1E1YA 5K4AA 3RIXA 2RI1A 3RI3A 3KKLA 4BVAA 4EVIA 2HJVA 4QUEA 1S0UA 1YUNA 2P41A 2IOQA 1BXGB 2VHVA 1R6UA 4UREA 4HJRA 4FFWA 3LVQE 1UF9A 3TG8A 1K8XB 5CX1A 4ZAWA 3SS9X 3BT7A 3H3XA 2R60A 2K4MA 2Q2WA 3FUXA 3RS4A 3SM9A 1F38A 3V4VB 4LV6A 5IFKA 1TYCA 1P2VA 2AX4A 3QYAA 5K5EA 1WCIA 3U09A 1BXGA 3IBCA 3QPUA 3WBBA 3E1GA 5K0LA 5FOQA 4NG5A 4WOPA 4NATA 3ZIAA 4YRAA 3U16A 1JMYA 1E6KA 1YKGA 3HJGA 3UH0A 3WQQA 4QYWA 5HKKA 2P4HX 5LOVF 4KGXA 4TUYF 2OV2A 2XUHA 2R87A 3JQ8B 1YRBA 4I4CA 3DP7A 2Q1TA 4LZOA 2ZZKA 4O8CA 1UADA 1ZOOA 2ZT5A 4MYDA 2HU7A 5LYJA 1P2DA 4DA7A 4MWOA 1RAGA 1RC8A 3KJHA 4KE7A 3PDIB 2PWYA 4C7OA 4OJMX 5I9IA 3M4NA 3TE7A 1ZLYA 2ZTSA 3I2YX 1B3RA 1YTLA 3Q72A 4IF4A 4JSRA 4CL0A 5CFLA 2C8VA 3FCXA 4LXGA 4F72A 3A2KA 2V9CA 4C6SA 2Y1XA 2VUUA 5EESA 2B9VA 2CMKA 4V0NA 3IPLA 3HCNA 4M0KA 1HT0A 4F12A 4RK5A 1A8UA 1SA0A 2X6TA 2AJLI 3MVEA 4XM2A 1BE6A 3EEOA 1NC1A 5HJ2A 3LA8A 1EFHA 1X1EA 1UMKA 2NO0A 4DQKA 5E7MA 4JB0A 2P69A 2BEWB 4HMOA 4B7UA 4X8LA 1GRNA 1AX9A 1EE2A 3OTIA 5A02A 1EINA 4YRCA 3RQIA 1PS0A 5C2JB 3WRYA 1NJ2A 3LXMA 5BOSA 3TOVA 3G82C 1PW7A 1TM3E 2AN9A 1XQXA 1YRQA 3A4MA 5IJWA 2CEKA 3N2EA 2D3WA 4YRRA 2AQKA 3OFND 3D3JA 3HL0A 4P98A 5FNVA 2QJOA 5BQFA 2RHJA 1RI4A 1U6IA 2JGIA 1H1TA 3BMNA 4HEA1 4R0VA 4XD7D 1QRTA 1P19A 1Q7RA 1QV6A 1UQTA 5FOTA 4DDKA 1S2DA 2MINB 2ZKIA 3HV0A 1RLMA 3RYIB 2WTMA 3ZN2A 2NTEA 4EG7A 4G6ZA 4CIDA 4LPKA 3S7ZA 4WFJA 3WFIA 1UKZA 2QRMA 4OIMA 2HD4A 4RKWA 4EX7A 1XCJA 1YRLA 4U2BA 5CJ2A 2G83A 1T8RA 5DX0A 4PZUA 5F2OA 2CNDA 2OCKA 4KAAA 1Y8CA 4CM3A 2WJPA 2GILA 4DLUA 4FE4A 4JVNA 3ZHTA 4WBNB 1F3OA 3O26A 3ASYA 3BXZA 5J4VA 1MGOA 3HVKA 4J1NA 4IUBS 4TQ9A 1FSGA 4JL6A 1OI3A 4JUIA 3GJ5A 5CBPA 4E15A 3VR3A 3R7SA 1EGAA 1T6NA 2N75A 3HBAA 4I55F 5BSHA 1MZPA 4KYUA 1MJ5A 1J5PA 1QQ6A 5TQ0B 1MFZA 1WVGA 3AFIA 1KPIA 1H8HD 2C5EA 3C70A 4XAQA 4B3BA 1U0NA 2CEAA 2AFHB 3IL2A 4R51A 1W49A 2ZSIA 3GFTA 1HOTA 3JTEA 2X8JB 5I8WA 3IIEA 4XQGA 2J9XB 1FX0A 3BXOA 3A7DA 3CRZA 3E4DA 3PQ6A 4FHEA 4KQ2A 4N0EA 3S8MA 3JQFC 4P7JA 5K0CA 4BN5A 3OLCX 4Y9UA 1DT5A 5BVHB 2H8GA 3ZV7A 2QB5A 4B32A 1ISIA 3R3XA 4LHSA 3IJ5A 1JEQA 1ISGA 5LZ9A 3L0PA 3DLTA 5D85A 4DCJA 4YASA 4K8RB 4EJSB 4GDMA 4DDHA 3PDUA 4PZ0A 1J2YA 1WDLA 1E5VA 2PL9A 2H5JA 1I9CA 4JLDA 4MINA 4O4IF 4EG3A 1YZUA 1KVRA 2P1RA 3NHSA 4MWZA 2ZUSA 3T94A 3MUOA 3OIGA 3JAWA 1PDWA 1QYCA 3KS9A 3QOXA 3GCWA 4C3UA 4O1HA 1QR2A 3MMXA 3BH0A 4WZBB 3UMCA 3VC1A 1WU8A 3KOMA 2QUIA 2ZI4A 3DDUA 3EC1A 4NH0A 4EAAA 3HMQA 3W9UA 1NDQA 2A5LA 1JB1A 2PMDA 2QZ4A 3ESBA 3HJHA 3QA3E 2NSLA 4UPVA 4ZPXA 4KXVA 2H1SA 5IC5A 4DT1A 1LTKA 2NT4A 3MNFA 3FOEC 5HQTA 2HQSA 2QLBA 3DLAA 1IN1A 1OFUA 1JE0A 2X9QA 2PJUA 1CVRA 5CA0F 1USGA 1VG1A 4G86A 2VJCA 5JSFA 1BOOA 1C7IA 1SC6A 1GL6A 5BQPA 2CLHB 1ICEA 1XDZA 4TWZA 4HYYA 1G18A 2I9KA 4ZP1A 1V6AA 5A7HA 1P61B 3DS8A 3RTGA 3ZHCA 1GKLA 3U3ZA 3AYZB 4HVTA 4PLHA 3KQWA 4YAFA 5CIYA 2VF4X 3QF4A 4V0QA 3OE1A 4BLUA 4CZ2A 5JAUA 2CVPA 5CX1B 1CSEE 3R3VA 3OQOA 5DYYA 5EJ6A 1G9XA 3G8AA 1U28A 2G9NA 1XDBA 4FZVA 3Q8WA 4AG6A 4AZTA 4F71A 1NF2A 5IANA 5J1TB 2ZU6A 3L18A 4RIHA 4YAJA 2E9SA 5IT0A 2GCNA 3O1HB 1J9ZA 4UULA 3PUVA 2VDVE 2PHZA 5L7TA 1V2HE 3TBFA 1FJXA 4AX4A 3SDBA 1AGPA 3F6BX 2BGRA 2H3EA 1A4XA 4TLMB 2IT1A 1XZJA 2BFOA 3GT3A 1E79A 3C74A 4RADA 4GNRA 5EJEA 5JMOA 2IEDA 1Z4JA 3IPCA 4ZYUA 4XX1A 3TCNA 2NXNA 1F2TA 2XCIA 5KJCA 4R2LA 5AQ1A 4XUEA 2ZIAA 1P7WA 2HLPA 2YRWA 4UOZA 5IH7A 2RK3A 2PJZA 5JVDA 1NVAA 2FPMA 1BD4A 3H1TA 3WGLA 1IJBA 2CL7X 3BJMA 1LJLA 4EYKA 4OJQA 3MWKA 4A8JA 2BFCB 3IUMA 4M87A 1A9XB 5CVEA 4C4AA 3A4TA 2B37A 5BSMA 2OHXA 3GLHB 3BCUA 5M34A 3UBTA 1ZYUA 3U4QB 1BH2A 1ADYA 3DF7A 4TMWA 3AT1A 2VZ0A 2JD2A 4NOMA 3TS1A 3C24A 5BWMA 3K31A 1YOVB 3RIHA 4XYLA 3IDZA 1NC3A 1Y5NA 3FAZA 3GJSA 3NIFB 4B84A 1SCIA 2ZB2A 1P45A 3U61B 2GBCA 5AQEA 5HKBA 4YYEA 1GQRA 1A8PA 1AF7A 3C3PA 4DQ0A 1QPGA 4G8CA 3VDXA 1JKJA 3DE0X 3H83A 1C3OB 1GO2A 3HWWA 3ONEA 4P8RA 4YRLA 5KVVA 1PE0A 1FMTA 3BTOA 3BMNB 3GJ4A 3U4AA 2ESRA 1SWWA 5SV2A 2ODPA 5A0TA 1QFSA 1QOQB 1ZC4A 2WJVA 1QGZA 3FZQA 4UBMA 3SIWA 4XUGB 1RWWA 2HHLA 1QIDA 5I7FA 3AHIA 2WFMA 2J0UB 3KR1A 4E13A 4QE3A 3RBZA 3GX1A 3MTDA 4JLBA 4UU1A 3VAZA 2W6ID 3NBZC 1G9TA 3QUQA 4K2AA 1U3VA 1IPFA 3JYQA 4W5HA 5J5VA 1XEXB 1OKKD 5EJ8A 1W0JA 1LC3A 4ZVQA 3OLVA 4QIHA 2IZ0A 3EZXA 1SXGA 2LIPA 4L2IA 5BW5A 1NG9A 3KPJA 3M4XA 4YJGB 1F0NA 2FAXA 4O4HB 1I0IA 1S8NA 4WY5A 4XVHA 3UMJA 4AROA 4DQUA 1YTUA 2BFAA 3RSFA 1TA0A 3TOZA 1J1UA 1TCCA 3Q3CA 4PLPA 2XIJA 4F9GA 2PQ0A 3L3BA 3BREA 1WVIA 2ST1A 5EWJB 3CNNA 1N6IA 4JEMA 5HZGA 1SD2A 2E7ZA 2W9XA 1NF3A 1Z83A 2C9ZA 2HREA 1IZZA 2H7VA 2VJYA 4D9MA 2Y3IA 4MV7A 1MABB 1RJWA 2GQ0A 3G8YA 2QPOA 4CYMA 2ZQYA 4Z1MA 3B2NA 4EB6B 3PCXA 4YCCA 1NZDA 2W42A 2Q21A 3GDHA 2W7TA 1KO5A 2QTRA 2QVYX 2KLBA