1KGFA

Structure of beta-lactamase asn 170 gln mutant
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
257
structure length
257
Chain Sequence
b'KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELQYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
molecule tags Hydrolase
source organism Staphylococcus aureus
publication title Elimination of the hydrolytic water molecule in a class A beta-lactamase mutant: crystal structure and kinetics.
pubmed doi rcsb
total genus 87
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1996-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1kgfA00
4PM9A 1XP4A 2WUQA 4WBGA 5BOHA 3IF6C 3IH9A 2EX6A 3BFGA 1W5DA 4OP8A 4Q8IA 4JXVA 3BYDA 1IELA 4KQRA 3N4IA 5F1FA 2WKIA 4S2MA 2WGWA 5FAQA 2WGIA 3W8KA 1XKZA 1YLZA 1JVJA 2EX9A 5EECA 3G31A 2OLUA 2Y2IA 1ALQA 1LL9A 2ZQDA 5CXWA 2J7VA 2OSUA 1K54A 1YLWA 2I72A 4BJPA 4DE2A 4KZ8A 2H5SA 2Z2MB 1JTDA 5CTMA 4NETA 4OQGA 5E2EA 5EVIA 1IKGA 5FQKA 5GHYA 5HAIA 4E3NA 2EFXA 2XLNA 4MBKA 3UDXA 4BD1A 3IXGA 5JYPA 3P98A 3IWIA 4QB8A 2HDQA 1ZG6A 1M6KA 3WS4A 3HBRA 4M3KA 1AXBA 1JTGA 2J8YA 4FH4A 2J9OA 2J9PA 1IKIA 4PM5A 4BL3A 1PI5A 1K55C 1KVMA 3G34A 1NY0A 3SH9A 5CECA 4LENA 3MZFA 4KZBA 5CHMA 3M6BA 4P87A 3N8SA 2Q9NA 1L2SA 2HP9A 3WS5A 1SDNA 5FQMA 2Y91A 1LI9A 2HP6A 3N8LA 4HESA 3UE1A 3WS2A 4EWFA 3OPLA 2XF3A 5FAOA 1FOFA 5CERA 3SOIA 4OPQA 4YINA 4R23A 4XXRA 3PBSA 2ZJ9A 3V39A 2XDMA 5F82A 2BLSA 4C75A 4OQIA 4Y0OA 3WRTA 3VP3A 3UDIA 3DW0A 3S22A 4GB7A 4LV3A 1FCNA 3UPOA 2JC7A 3BFCA 2V1ZA 5CHJA 1K6SA 2BG1A 1NJ4A 4RX3A 4JBFA 1PWDA 2QMIA 3G35A 4A5RA 3TSGA 3N6IA 3W4QA 4JXGA 4JF5A 5M1AA 4KG6A 1PYYA 2EFUA 3SS3A 3BFDA 3VSKA 3CMZA 3GQZA 3OCLA 3V3RA 3VMAA 5HAPA 4UAAA 2IWCA 1MWUA 4LV2A 1I2WA 2Y2KA 1EROA 4WZ5C 1QMFA 3BM6A 2R9XA 5TFQA 4B4XA 4WEKA 3G2ZA 4JKTA 4EBNA 2HDSA 1W8QA 1QMEA 2FFFB 3ZCZA 4RX2A 4E3LA 1PW8A 3QNCA 3WWXA 3IXBA 3P09A 3SH8A 5EUAA 1S6RA 1XA7A 3CG5A 4PM6A 3QHYA 4ZBEA 3DTMA 3RXWA 4B88A 3UE0A 3ZNTA 4OH0A 3ZFZA 1WYCA 1JWZA 4WEJA 4PPRA 1K56A 3IF6B 4KG5A 3FZCA 2RCXA 2Y2PA 4JXSA 3HLDA 3PBOA 1XXMA 2ZC6B 4OOMA 3C5AA 3BECA 5AQBA 3B3XA 2HDUA 5FQIA 4WZ4A 1YQSA 3MZEA 4OLGA 4MNRA 4GKUA 4RYEA 4R3JA 1IEMA 1KE4A 4E6XA 3MBZA 2E8IA 4IBRA 5AQ9A 3LY3A 1K25A 4OQ0A 4KZ7A 2VGKA 5GLBA 1XPBA 2JBFA 1HZOA 4R0QA 4S2NA 3IXDA 3NC8A 3GVBA 4KZ5A 4WMCA 1I2SA 4OPRA 1GA0A 3NDEA 3IF6A 5FAPA 4X6TA 3C4OA 4WELA 3CZDA 3UPPA 4QJGA 1RCJA 1FR1A 3M2JA 4N1XA 3N8RA 4GD8A 1BUEA 3I7JA 3MKEA 1DJAA 1ESIA 3IHAA 3OPPA 4S2NC 5TR7A 5I94A 1W7FA 4FCFA 3MKFA 1ES5A 1LLBA 1U60A 1Q2PA 5A91A 5KZHA 3HREA 3VOYA 4CJNA 1RP5A 2B5RA 1H8ZA 4GZBA 1MPLA 4IVKA 3O86A 1MY8A 4PM8A 1KE3A 4BQMA 2GDNA 1BTLA 4F94A 3C4PA 2XH9A 3OZHA 4EUZA 2ZC7A 2ZMAA 4FSFA 3IXHA 4CPKA 1BSGA 4DKIA 1TDLA 1MWTA 1MXOA 1K6RA 1MBLA 3Q7ZA 3W4OA 1CEFA 5E43A 3ITAA 3NIAA 1NYYA 1L0GA 3V50A 4IEDA 4WZ5A 5CHUA 4S2PA 3WS1A 1LHYA 4OLDA 3BRMA 4FH2A 1BLPA 5EOOA 3NBLA 3WS0A 4BD0A 5HAQA 4K0WA 1GHIA 1HD8A 1GA9A 3W4PA 4N1HA 1I5QA 4Y0TA 2ZQAA 2Y2LA 4JPMA 2Y2MA 5E2HA 5FI7A 2Z2LB 4P0MA 2ZM2A 5EVID 1K4FA 3GR2A 5GL9A 1ES3A 5JYOA 5J8XA 4ID4A 1Y54A 3ZG0A 2JE5A 1S0WA 4DE3A 4E3JA 1NXYA 3GSGA 4OPYA 3VP4A 2WZZA 1GHPA 1FSWA 1PWGA 4OP5A 1N9BA 5HX9A 1IYSA 1EI5A 5HW3A 2G2WA 3V3SA 4RVAA 2DCFA 1TDGA 3PBQA 5AQAA 3PAEA 2WGVA 3NDGA 1BLSA 3GTCA 5GLCA 4OQHA 4X69A 1CI9A 5DF8A 3VFFA 5A93A 5DTKA 1FSYA 1O7EA 4E3KA 4UA9A 1TEMA 1MKIA 1YLPA 3SS5A 4KENB 1G6AA 5FQJA 4EBPA 2Y2NA 3HUNA 4PMAA 4QHCA 1KGFA 5HARA 2HPBA 3BEBA 2QPNA 2HP5A 2ZQ8A 1TVFA 5EE8A 5E2GA 4LV0A 4K91A 3VOZA 1ES4A 2ZLYA 4N92A 4IVIA 5FA7A 1MWRA 3HLWA 4E3OA 3ZHHA 5CTNA 2JCHA 1G68A 5FI6A 4HBUA 5KSCA 3HLBA 4NK3A 4JLFA 5G18A 4GDBA 1YMXA 3A3IA 3N7WA 4H8RA 5DF9A 3FYZA 1YT4A 2HDRA 4GD6A 4DXCA 2X01A 4P85A 5FI2A 4GN2A 1MWSA 4E3MA 3M2KA 3BFFA 1JWVA 3EQVA 3FKWA 3UN7A 3QNBA 1K4EA 4GOGA 2IWDA 4HEFA 2C5WB 2ZC5B 5CGSA 5FATA 4GNUA 4QU3A 1YMSA 2WKHA 3PTEA 1SCWA 2WADA 1JWPA 2WGWB 4BENA 1Z6FA 2A3UA 1DJCA 1KE0A 5DTSA 1WYBA 4LCLA 4KZ4A 1CI8A 1IYQA 1L0FA 4X55A 4OVDA 5EOEA 5DVAA 2H10A 1H5XA 3A3FA 5CRFA 3OPHA 4S2OA 4QY5A 3ZVWA 3FV7A 3IHBA 5FQ9A 3Q7VA 3OPRA 3ZG8B 1HTZA 4C6YA 2Y2OA 5CGWA 3JYIA 1VM1A 3GMWA 1K57C 5GHXA 5EVLA 4E6WA 2EXAA 4MEZA 1GHMA 4Y0UA 4JXWA 3UPNA 3E2KA 1ES2A 4S2IA 4S2LA 4MBHA 3ZG7B 3NI9A 1E3UA 1KVLA 3PBNA 1YM1A 1SKFA 4RA7A 2RL3A 2Y59A 5U47A 1M40A 2DNSA 2EXBA 3ITBA 3HLFA 3MXSA 4P6BA 4XUZA 4JF6A 4KZ6A 5D3OA 2X02A 4UHUA 3EQUA 4LCMA 5A90A 3IF5A 3UY6A 1YLJA 2G2UA 3FWLA 4KQOA 1FCMA 2XR0A 3MFDA 2XFTA 3PBTA 5HL1A 3ZVTA 1KGEA 3OC2A 3TOIA 2Y2QA 1SDEA 1W79A 2P9VA 3PBRA 4PM7A 5AQ7A 3VSLA 5KMWA 1KGGA 5GLDA 3S4XA 1ONGA 4B4ZA 3LCEA 4DDYA 3A3DA 1WE4A 4ZDXA 2V2FF 5FQQA 5FDHA 3MXRA 2ZM0A 3S1YA 3VP0A 2XGNA 2ZC3B 4N9KA 4WYYA 4X56A 1DJBA 2ZM8A 3MZDA 4DE1A 4X53A 2OLVA 4OOLA 1KDSA 3G32A 3HUOA 3E2LA 5L2FA 2C6WB 2P9VB 2PU2A 5GHZA 3SH7A 1K38A 4ZAMA 4X68A 1BLCA 3RXXA 4JF4A 5F83A 3TG9A 4DDSA 4C3QA 3G2YA 3VFHA 4YFMA 4EV4A 3UE3A 5F1GA 5CEBA 1Q2QA 3VP1A 3G4PA 1ZG4A 1PIOA 4XUXA 2A49A 4UA6A 1ESUA 5EVIC 1RGYA 3UDFA 1O07A 1BT5A 2P74A 1NYMA 2XFSA 1GCEA 4MLLA 2ZQ7A 2Y4AA 4S2KA 1LI0A 1H8YA 1PW1A 4E3IA 3AGFA 3HVFA 1BULA 1E25A 4KZ3A 4KQQA 3BLMA 1XX2A 2V20A 1VQQA 3HUMA 4U0TA 4U3TA 3CJMA 1NZOA 1ZKJA 4S2JA 1K55A 1C3BA 2UWXA 3G30A 2R9WA 3Q07A 3HLGA 3GV9A 2DRWA 4HBTA 4OOYA 1PZOA 2Y2HA 4GDNA 1K57A 2Y2GA 1NZUA 3AGDA 3UO9A 4L0LA 4QY6A 3ZG9B 4Z9QA 3IQAA 4EBLA 5A92A 3ISGA 2ZQ9A 4QD4A 3VP2A 1RGZA 3BFEA 4EQIA 4K0XA 1HVBA 1CK3A 1FCOA 4WM9A 1SHVA 5CEDA 2Q9MA 4KG2A 1PWCA 2ZD8A 4DF6A 1NRFA 1E3UD 3LO7A 4LV1A 4DRTA 5M19A 1ERMA 4R4SA 5HFOA 2WAFA 1LL5A 3DWZA 2XD1A 2QZ6A 3D4FA 1XGJA 2X71A 1PZPA 3HLEA 5CGXA 2WK0A 2WAEA 4R1GA 5FSRA 4WMCD 4Y7PA 3Q82A 3HLCA 3UNWA 3C7UA 4ZJ1A 5EVIB 3WRZA 1OMEA 3LY4A 3PAGA 4BLMA 1K54C 1PI4A 1L0EA 4FD8A 3ZNYA 3LEZA 3RJUA 3FKVA 4KZ9A 4OONA 1ERQA 2WKEA 3M6HA 2PBYA 3Q81A 3IT9A 4OKPA 4MBFA 2XD5A 3O88A 3HL9A 4O7DA 3BLSA 2IWBA 3DWKA 1XGIA 2WZXA 4U0XA 1DY6A 3A3EA 1BLHA 5IHVA 1K56D 1L0DA 4ZJ3A 2H0TA 4BL2A 3V5MA 1IYPA 1E4DA 5EPHA 1CEGA 3IWOA 4KZAA 3Q7VB 1N4OA 1FQGA 4ZJ2A 3O3VA 2Y55A 3ZG5A 4DE0A 5M18A 4DXBA 2CC1A 1YLYA 4OPZA 2XQZA 1EWZA 2XEPA 2ZQCA 3OCNA 5E2FA 4D2OA 4IBXA 2H0YA 4UA7A 5DTTA 2WYXA 2ZC4B 3C7VA 5TGFA 3ZDJA 3AGEA 4ZTKA 4R3BA 5DF7A 1W8YA 1YLTA 3O87A 2FFYA 3NCKA 3ZGAB 2OV5A 1J9MA 2EX2A 5GLAA 1ONHA 1FR6A 2PU4A 3IWQA 3Q1FA 5KSHA 5FASA 1XA1A 1KDWA 1ZC2A 1BZAA 4R4RA 3GRJA 3A3JA 4N9LA 2EX8A 1IYOA 3IH8A 2Y2JA 3SS4A 2XK1A 3NY4A 2VGJA
chains in the Genus database with same CATH superfamily
2WUQA 4WBGA 1UWPX 2W0NA 3LR3A 3FG8A 2QJ5A 1IELA 4EW7A 1YLZA 2EX9A 3IS2A 1SKOA 5CXWA 2OSUA 5EV0A 1DP9A 4LLOB 4DE2A 5GHYA 4NETA 5E2EA 3IXGA 2HDQA 2E8JA 1ZHHB 1AXBA 1D1JA 2V1AA 5CECA 5CHMA 1TS6A 3MZFA 3M6BA 3N8SA 5F69A 2HP9A 4O8GA 1SDNA 1LI9A 2HP6A 3N8LA 2XF3A 1FOFA 4YINA 2XDMA 4RQ9A 4GB7A 3UB6A 2JC7A 5CHJA 1K6SA 2OWJA 2BG1A 5TBMA 4RX3A 1TS7A 1PWDA 3RH8B 3T4OA 4A5RA 3FPWA 3E4PA 3TSGA 3W4QA 4KG6A 3SS3A 3CMZA 4WF0A 2IWCA 3UB8A 3RFBA 1EROA 1QMFA 2PHYA 3BM6A 1BYWA 4MN7A 3G2ZA 4I3AA 2VX8A 4EBNA 3VE4A 1P9RA 1TD5A 3SH8A 2ZBBA 2PT7A 2W1RA 5G4YA 1JWZA 1F5MA 4PPRA 1K56A 3K3CA 1NLYA 3HLDA 3UE6A 2PD7A 3MZEA 4GKUA 4RYEA 3MBZA 4QPRA 2VGKA 4S2NA 4KZ5A 4Y5FA 3NDEA 1S1ZA 4QJGA 2BASA 4GD8A 4DN0A 4S2NC 4IUHA 3S7NA 4ARZA 3V67A 2B5RA 3JVVA 4GHIB 1VETA 1MY8A 4PM8A 3C4PA 4EUZA 2ZMAA 1P0ZA 1P97A 3C8CA 4FSFA 1MXOA 1N9NA 4FTXA 3W4OA 1FIKA 3LR4A 3ITAA 1L0GA 5LBRA 3WS1A 4FH2A 1BLPA 4EETB 4K0WA 1HD8A 3W4PA 4Y2FA 2JKTI 2ZM2A 1K4FA 3GR2A 4M4XA 5J8XA 4DJ2A 3VP4A 4EEPA 1N9BA 1IYSA 1EI5A 2J3TC 5AQAA 2WGVA 3NDGA 4OQHA 3TW8A 3VFFA 4E3KA 1O7EA 1Z09A 2JKFA 4R38A 5FQJA 4EBPA 3LIAA 4K08A 3BEBA 2QPNA 5E2GA 4IVIA 2BTFP 3ZHHA 5K5BA 2VEAA 3UB9A 4NK3A 5G18A 2HZ5A 3N7WA 3QP6A 4GD6A 2HDRA 4DXCA 3EQVA 3FKWA 5HDDA 2ZC5B 5CGSA 4QU3A 2WKHA 2WADA 1XJ4A 1JWPA 2WGWB 3T50A 4KZ4A 1CI8A 1IYQA 1L0FA 2J3WA 4G3VA 3A3FA 5CRFA 4S2OA 2FH5A 5FQ9A 1HTZA 3W2ZA 2HJ9C 5GHXA 5EVLA 4NXFA 4JXWA 4H6JB 3NI9A 1E3UA 3E0YA 2EWWA 5HL6A 3MXSA 4P6BA 4HJ4A 4UHUA 3EQUA 5A90A 3IF5A 2WKRA 2QWSA 4KQOA 2V8CA 4UEYA 2XR0A 3OBFA 5HL1A 1TS8A 1VEUA 3TOIA 3PBRA 2P9VA 1W79A 4PM7A 3VSLA 1NWZA 2D01A 1XJ6A 4FUWA 3MXRA 4X56A 2WKPA 1DJBA 1VEUB 3ZYTA 3E2LA 5L2FA 1K38A 4X68A 1F2KA 4JF4A 3UE3A 1Q2QA 5I5LA 1ZG4A 1PIOA 3SZTA 1ESUA 5EVIC 1RGYA 3UDFA 3LIBA 1NYMA 2L0WA 2ZQ7A 2Y4AA 1LI0A 1H8YA 1BULA 1E25A 4KQQA 3HUMA 2G7UA 4NXBA 3G30A 2UWXA 2R9WA 3GV9A 4OOYA 4LPZA 3B47A 2Q0OA 1K57A 3UO9A 4R70A 4L0LA 4QY6A 4X25A 4ETXA 2ZQ9A 2ZMFA 2ACGA 5HD3A 3U4LP 5HD5A 1SHVA 5CEDA 3MQQA 4HH2A 4DF6A 3LO7A 4DRTA 1ERMA 2J3TD 2WAEA 4L9GA 4O0PA 4Y7PA 3UNWA 3WRZA 1K54C 3LR5A 3ZNYA 5J7EA 2PR5A 1ERQA 3Q81A 5EM0A 1AWIA 3IBRA 1D06A 2M7UA 1OPXA 3DWKA 2O99A 5IHVA 3LR0A 4BL2A 3GDIA 1HLUP 1LL8A 1FQGA 2Y55A 4DXBA 5J4EA 2CC1A 1YLYA 1DP8A 2V1BA 3OCNA 1ODVA 3LFVA 5GLAA 4HP4A 5FASA 1XA1A 3UMDA 1BZAA 1FILA 1IYOA 1OTDA 3IH8A 2XK1A 5EM1A 5BOHA 1MC0A 3BFGA 1W5DA 1IFQA 2A2LA 4JXVA 3T4SA 4Q8IA 4G3KA 1XFNA 4KQRA 3N4IA 3IX4A 2WGIA 1XKZA 5EECA 3S7PA 4MN5A 5L10A 1LL9A 4BJPA 4XT2A 4KZ8A 3CI6A 1JTDA 4E3NA 5EVIA 2Y79A 5HZHA 1IKGA 2M7VA 1OJGA 4MBKA 5JYPA 4B93A 1ZG6A 3HBRA 5IT5A 4FH4A 1IKIA 3SH9A 1NY0A 4LENA 1ACFA 3WS5A 3H82B 5FQMA 1G5UA 5HDSA 3OPLA 2DMWA 4OPQA 1T1BA 3V39A 3FC7A 3LIEA 4C75A 3UDIA 5DJUA 4LFUA 4LV3A 3EEAA 3CITA 2V1ZA 3EGDC 1L3LA 3F1OB 3QP1A 2EA9A 3F1NA 2KLIA 3T1QB 2QKPA 4JF5A 5M1AA 3BFDA 3VSKA 5HAPA 3V3RA 4UAAA 4LV2A 2Y2KA 4WZ5C 3LIFA 1G6OA 4B4XA 4WEKA 3MSHA 4RX2A 5L07A 4AFIA 3LYXA 3P09A 1D7EA 1XA7A 3CG5A 4LGWA 3QHYA 3DTMA 4D60A 3UE0A 4BWIA 1WYCA 1NRJA 4HI4A 4KG5A 3FZCA 2RCXA 4JXSA 2HV1A 3PBOA 2VLGA 2ZC6B 3BECA 5AQBA 4E6XA 2Z6CA 2E8IA 3CPTA 5GLBA 2JBFA 2MJ6A 1H0MA 4R0QA 4NXEA 3IXDA 3NC8A 5FAPA 4X6TA 4WLAA 1RCJA 1FR1A 4N1XA 3C38A 1BUEA 3OPPA 2EWVA 5I94A 4FCFA 1ES5A 4EQ1A 3KYQA 5F68A 1H8ZA 4GZBA 3O86A 3T1XA 4BQMA 2GDNA 4ME4A 2XH9A 3OZHA 1EW0A 1DRMA 3IXHA 4CPKA 1BSGA 4DKIA 1MWTA 5E43A 3G6OA 4NXGA 2OAP1 3NIAA 4S2PA 2CMNA 1YKDA 3BRMA 3MFXA 2V9AA 4BD0A 3NOPC 5HAQA 1GHIA 4N1HA 2Y2LA 4GS9A 1V9ZA 2Y2MA 5E2HA 2V8FA 1VHMA 2Z2LB 5EVID 3T4QA 1ES3A 2JE5A 1S0WA 3BY9A 4X1LA 2JN7A 1GHPA 2WZZA 2ZOIA 2K2NA 1CJFA 2PBDP 1T1CA 5HW3A 4RVAA 1W63Q 1BLSA 3GTCA 5GLCA 4X69A 2QHKA 4GS9B 5F6AA 1FSYA 1TEMA 3HJIA 2Y2NA 4QHCA 1KGFA 1TVFA 5EE8A 3VOZA 4K91A 5L09A 4N92A 4E3OA 2VV6A 5FL3A 1VETB 2W3FA 3HLBA 5KSCA 3B33A 1YMXA 4H8RA 4PAUA 4EESA 4ESPA 2P04A 5FI2A 4E3MA 1MWSA 3BFFA 4GOGA 2IWDA 2C5WB 4O01A 2P08A 4GNUA 3KYZA 3PTEA 5CX7A 4H6JA 4MN6A 1Z6FA 2A3UA 1DJCA 3D72A 1WYBA 2JKTM 5IU1A 3KSGA 4OVDA 2H10A 1H5XA 3EEHA 5MC7A 3ZVWA 4UQIS 3MJQA 1OT9A 3Q7VA 2A24B 3JYIA 3GMWA 2EXAA 4MEZA 3UPNA 3E2KA 4S2IA 4I3IA 5G4ZA 1SKFA 5U47A 2QJ7A 1M40A 3ITBA 4JF6A 3T4TA 1GSWA 3NJAA 1FCMA 4Y3IA 1N9LA 3PBTA 2V0UA 4I3JA 1SDEA 4GHIA 3CAXA 5KMWA 5GLDA 4ZRRA 4DDYA 3A3DA 4Q0JA 4ZDXA 2ZMVA 1W63M 3VP0A 1S66L 2XGNA 2ZM8A 4Y13A 2OLVA 3HUOA 5DJTA 2PU2A 3GECA 1BLCA 2JKRM 4C3QA 3VFHA 4JGOA 5F1GA 3G4PA 4XUXA 2A49A 2P74A 3NOUC 2XFSA 3MR0A 4S2KA 3HVFA 4KZ3A 3NOTC 2HF6A 1XX2A 2V20A 1VQQA 4U3TA 2PD8A 1NZOA 3IX8A 1K55A 3K2NA 1YSQA 2DRWA 1PZOA 2Y2HA 4GDNA 1NZUA 3ZG9B 4UQIM 3IQAA 2O0YA 2VA0A 3KX0X 5A92A 3A0VA 4MMNA 3EOIA 4I38A 1RGZA 3BFEA 1HVBA 4HJ3A 1OTAA 1PWCA 5M19A 2WAFA 2ZL1B 1XGJA 5CGXA 2WK0A 5FSRA 3Q82A 3PAGA 5FEGA 1PI4A 1L0EA 3LUQA 3RJUA 3FKVA 5IS1A 3M6HA 4OKPA 3HL9A 3QP2A 2GX5A 1YPRA 2WZXA 1DY6A 4U0XA 3A3EA 1XFQA 1BLHA 4ZJ3A 1XJ3A 2H0TA 1OJ5A 5HWTA 1N4OA 4ZJ2A 3O3VA 5M18A 5E2FA 3PR6A 2WYXA 2ZC4B 3ZDJA 3AGEA 1W8YA 3O87A 2FFYA 3NCKA 2OV5A 2EX2A 1FR6A 3Q1FA 4BBVA 1ZC2A 4R4RA 3A3JA 4N9LA 2Y2JA 3SS4A 2VGJA 4PM9A 1XP4A 3IF6C 3IH9A 3MS6A 2EX6A 1STZA 4HHDA 4EERA 2WKIA 5FAQA 3W8KA 1JVJA 2YKHA 2H28A 1TS0A 3G31A 3A0RA 4WUJA 1ALQA 4HQAA 1YLWA 2I72A 4HY8A 3QP8A 2Z2MB 4OQGA 5HAIA 2AVXA 2XLNA 4BD1A 4QB8A 3IWIA 3S7OA 1M6KA 2D02A 3WS4A 2VJWA 1JTGA 2J9PA 4BL3A 4DMZA 2LB9A 1K55C 1KVMA 3G34A 4MDZA 4KZBA 2Q9NA 1L2SA 2Y91A 4EWFA 3KYEA 2PAVP 5FAOA 1OT6A 3F1PA 2O9CA 4OQIA 3S22A 2O9AA 1FCNA 2R78A 3BQ8A 5FDSA 2QMIA 2W3EA 2KDKA 3G35A 4F3LB 4MCWA 2W27A 2GZAA 2EFUA 3OCLA 3VMAA 4P6ZM 1MWUA 1I2WA 2R9XA 5TFQA 3RTYA 4JKTA 1W8QA 4WL9A 3QNCA 3WWXA 3IXBA 5EUAA 1S6RA 3ICYA 1DP6A 3ZNTA 2OWHA 2Y2PA 5HSQA 3C5AA 4WZ4A 2W1TB 1K25A 4OQ0A 2PYRA 1XPBA 1HZOA 1I2SA 4OPRA 1GA0A 3IF6A 3A0SA 3C4OA 4WELA 1LT0A 4HH3A 3CZDA 4Q0IA 3E4QA 3M2JA 3S7QA 1ZTUA 3KSFA 3D9YA 3I7JA 1DJAA 1ESIA 1W7FA 3MKFA 1S4RA 5TBMB 1Q2PA 1PRQA 3HREA 2XA7M 1RP5A 2JKGA 1KE3A 1BTLA 2ZC7A 3MMHA 3H9WA 4FOFA 4PHTA 1K6RA 1MBLA 3Q7ZA 3V50A 3T4JA 3KSIA 4WZ5A 2L1MA 5CHUA 1LHYA 4OLDA 4QWOA 2XA7S 1K0KA 1OTIA 1VB6A 5HWWA 3NBLA 1GA9A 5FI7A 3H82A 5GL9A 5JYOA 4CLCD 2PR6A 1NXYA 2M1CA 3GSGA 4OPYA 1PWGA 4OP5A 3VE3A 2P7JA 2G2WA 3V3SA 4Y15A 1TDGA 3PBQA 1CI9A 5A93A 3SS5A 2XRNA 4KENB 1G6AA 1JNUA 3R4KA 3HUNA 4PMAA 3MQOA 4LV0A 4I5SA 5FA7A 3R7WA 1LSXA 1TF1A 2JCHA 5FI6A 4HBUA 2L4RA 4JLFA 3A3IA 1YT4A 3P01A 1LSVA 3M2KA 1JWVA 2OOLA 1K4EA 3C2WA 4KUKA 2OAQ1 4HJ6A 5FATA 3R7WB 3T4LA 1SCWA 3H7WA 5AVFA 2JKRI 1MKMA 4LCLA 2Y8HA 2J80A 2ZOHA 3OOVA 3OPHA 1F98A 4QY5A 3FV7A 3IHBA 3IX3A 2Y2OA 1VM1A 3TJZC 4S2LA 4KUOA 4MBHA 3ZG7B 1KVLA 1YM1A 1T19A 4RA7A 2Y59A 5D3OA 1YAXA 2GJ3A 4KZ6A 3JPUA 4LCMA 1Y28A 1YLJA 2G2UA 2K7SA 3ZVTA 4JGQA 5AQ7A 3S4XA 5AJGA 2O9BA 5FQQA 2ZM0A 1H3QA 2ZC3B 3C30A 5HWVA 2GNXA 3IS2B 4OOLA 1YSPA 5GHZA 3SH7A 2PYPA 3MQ0A 4ZAMA 3RXXA 3TG9A 1OTEA 4DDSA 2WKQA 4EV4A 5CEBA 5J3WA 3VP1A 3QP4A 3T12B 3UMEA 4UA6A 1BT5A 4BMWA 1PW1A 3AGFA 3P7NA 3HJKA 3BLMA 5HPFA 4LRZE 3NHQA 3CJMA 1ZKJA 4S2JA 5DFXA 5KIZA 5L8MA 3E4OA 5A8BA 2B95A 1C3BA 3HLGA 4HBTA 5AVEA 4CLCA 2Y2GA 3AGDA 3LI8A 4EBLA 4QD4A 1UGUA 3VP2A 2UV0E 2KOIA 4EQIA 4K0XA 3DTKA 1CK3A 1FCOA 3EGXC 4WM9A 5F5YA 1P9WA 2Q9MA 3CHWP 4R4SA 5HFOA 1F9IA 1LL5A 3D4FA 1PZPA 3HLEA 3T4KA 4CLCB 5HPIA 2KX6A 2PRFA 2VGLM 3C7UA 2V0WA 4ZJ1A 5DKLA 3BW6A 1OMEA 3LY4A 4FD8A 2NUTC 3LEZA 4KZ9A 4OONA 1G28A 2WKEA 2PBYA 4MBFA 2XD5A 3O88A 4O7DA 1XGIA 1S67L 2VV7A 1K56D 3L7HA 3VOLA 3V5MA 1IYPA 5EPHA 2B18A 1PFLA 3IWOA 3Q7VB 4KZAA 3JVUA 5HDCA 4DE0A 2ZQCA 3LI9A 4IBXA 4D2OA 2H0YA 5DKKA 4UA7A 5DTTA 3C7VA 4ZTKA 4R3BA 1YLTA 4Y17A 2HGVA 4EEUA 2PU4A 5KSHA 4YOFA 3F1NB 2VKSA 3NY4A 4II7A 4DJ3A 4OP8A 3BYDA 5F1FA 4S2MA 2WGWA 1MZUA 2ZL1A 2PDRA 2OLUA 2Y2IA 2ZQDA 2J7VA 1K54A 2H5SA 5CTMA 5FQKA 2EFXA 3UDXA 3P98A 3OLOA 4M3KA 3F1PB 2J8YA 2J9OA 4EU0A 4PM5A 4NEED 1PI5A 4P87A 4EUVA 1LSWA 3WS2A 4HESA 3UE1A 1GSVA 4KQDA 5CERA 3SOIA 5DFYA 3L9KA 4R23A 4XXRA 3PBSA 2ZJ9A 1H8MA 5F82A 2BLSA 4Y0OA 3WRTA 3VP3A 3DW0A 3UPOA 1CQAA 3BFCA 1NJ4A 4JBFA 1Y4OA 2A24A 3N6IA 4B9OA 4JXGA 1A0KA 1PYYA 3GQZA 2K31A 3DTIA 4L9EA 3BY8A 4R6LA 2HDSA 1QMEA 2FFFB 3ZCZA 4E3LA 3K3DA 3BJNA 1PW8A 4XT2B 2W3GA 4PM6A 4ZBEA 3RXWA 4B88A 2VZWA 3SW1A 4OH0A 3ZFZA 4WEJA 1SZVA 3IF6B 2HJEA 1XXMA 1UWNX 1NLZA 4L9FA 4OOMA 4LRXC 3B3XA 2HDUA 5FQIA 1YQSA 3D3OA 4OLGA 4MNRA 4R3JA 1IEMA 1KE4A 4IBRA 5AQ9A 3LY3A 4KZ7A 4X1MA 4WMCA 3GVBA 3T1SA 4PKYG 3PHYA 3UPPA 2Z6DA 3IBJA 3LEQA 3N8RA 4JGRA 3MKEA 3IHAA 5TR7A 1LLBA 1U60A 5A91A 5KZHA 3VOYA 4CJNA 1MPLA 4IVKA 4GCZA 5EFWA 4F94A 1TDLA 1OTBA 1CEFA 3DAVA 4ARZB 3KO6A 1NYYA 4IEDA 3O5YA 3NULA 4YWZA 3FPVA 4P6ZS 4NKPA 2FZ0A 5EOOA 3WS0A 1I5QA 4Y0TA 2ZQAA 4JPMA 3ULFA 4G3WA 4GLQA 4P0MA 4ID4A 1Y54A 3ZG0A 3U2AA 3CLOA 4DE3A 4E3JA 1FSWA 3UB5P 2W1TA 5HX9A 2DCFA 3PAEA 1XJ2A 5DF8A 5DTKA 4UA9A 2IA2A 3T1RA 1MKIA 1YLPA 4LRYC 5HARA 3ZQ5A 2HPBA 4I39A 2ZQ8A 2HP5A 3B42A 3BWLA 1ES4A 2ZLYA 1MWRA 3HLWA 1J3WA 2NUPC 5CTNA 3H7WB 1G68A 4GDBA 5DF9A 3FYZA 4GW9A 2X01A 4P85A 4GN2A 5EVEA 2W3HA 3UN7A 3QNBA 4HIAA 4IJGA 4HEFA 1YMSA 2LB5A 4BENA 1PNEA 1IOUA 1KE0A 5DTSA 2XROA 4X55A 5EOEA 5DVAA 4ETZA 4R3AA 3F1OA 3CWFA 3OPRA 3ZG8B 4C6YA 5CGWA 1K57C 4E6WA 4F3LA 1GHMA 4Y0UA 1ES2A 4BBTA 3PBNA 2RL3A 4XUZA 2DNSA 2EXBA 3HLFA 4WN5A 2X02A 2INWA 4E04A 4IHQA 3UY6A 3PXPA 5FEFA 3FWLA 3MFDA 2XFTA 3DBAA 3E98A 1KGEA 3OC2A 2Y2QA 2I9VA 1KGGA 1ONGA 4B4ZA 3UB7A 3LCEA 2VGLS 1WE4A 2V2FF 5FDHA 3S1YA 3CUEA 4Q0HA 4N9KA 4WYYA 3MZDA 4DE1A 3BQAA 4X53A 4Z1WA 1KDSA 3G32A 2C6WB 1KOUA 2P9VB 3LGOA 3TE8A 5F83A 3G2YA 5C5KA 4YFMA 4CLCC 3MF0A 3QP5A 1O07A 3PYPA 1GCEA 4MLLA 1N9OA 4IUKA 4E3IA 4HP9A 1GSXA 4U0TA 3VV4A 3Q07A 4PKYA 4HNBA 2QYBA 2B02A 2YKFA 2VV8A 4Z9QA 3MXQA 3ISGA 4GJ4A 3EWKA 3CPTB 4KG2A 2ZD8A 1NRFA 1E3UD 4LV1A 3DWZA 3NECA 2XD1A 2QZ6A 2X71A 4JGPA 2W3DA 5TJJA 4R1GA 4CQHA 4NG2A 4WMCD 3HLCA 1T1AA 2VK3A 5EVIB 4BLMA 1X0OA 3KSHA 1V9YA 3DTEA 2XSSA 3IT9A 1CF0A 3BLSA 2IWBA 2JHEA 3LIDA 1L0DA 1T18A 1E4DA 1CEGA 3LICA 4HOIA 3ZG5A 4OPZA 3HCYA 2XQZA 1EWZA 2XEPA 4YNRA 1WA9A 5TGFA 5DF7A 3TRCA 3ZGAB 1J9MA 1S4SA 1ONHA 3IWQA 1KDWA 4EXOA 3GRJA 1SKOB 2EX8A 3CUEC 4BBUA 4CLCE 1S1YA
chains in the Genus database with same CATH topology
4PM9A 1XP4A 2WUQA 4WBGA 5BOHA 3IF6C 3IH9A 2EX6A 3BFGA 1W5DA 4OP8A 4Q8IA 4JXVA 3BYDA 1IELA 4KQRA 3N4IA 5F1FA 2WKIA 4S2MA 2WGWA 5FAQA 2WGIA 3W8KA 1XKZA 1YLZA 1JVJA 2EX9A 5EECA 3G31A 2OLUA 2Y2IA 1ALQA 1LL9A 2ZQDA 5CXWA 2J7VA 2OSUA 1K54A 1YLWA 2I72A 4BJPA 4DE2A 4KZ8A 2H5SA 2Z2MB 1JTDA 5CTMA 4NETA 4OQGA 5E2EA 5EVIA 1IKGA 5FQKA 5GHYA 5HAIA 4E3NA 2EFXA 2XLNA 4MBKA 3UDXA 4BD1A 3IXGA 5JYPA 3P98A 3IWIA 4QB8A 2HDQA 1ZG6A 1M6KA 3WS4A 3HBRA 4M3KA 1AXBA 1JTGA 2J8YA 4FH4A 2J9OA 2J9PA 1IKIA 4PM5A 4BL3A 1PI5A 1K55C 1KVMA 3G34A 1NY0A 3SH9A 5CECA 4LENA 3MZFA 4KZBA 5CHMA 3M6BA 4P87A 3N8SA 2Q9NA 1L2SA 2HP9A 3WS5A 1SDNA 5FQMA 2Y91A 1LI9A 2HP6A 3N8LA 4HESA 3UE1A 3WS2A 4EWFA 3OPLA 2XF3A 5FAOA 1FOFA 5CERA 3SOIA 4OPQA 4YINA 4R23A 4XXRA 3PBSA 2ZJ9A 3V39A 2XDMA 5F82A 2BLSA 4C75A 4OQIA 4Y0OA 3WRTA 3VP3A 3UDIA 3DW0A 3S22A 4GB7A 4LV3A 1FCNA 3UPOA 2JC7A 3BFCA 2V1ZA 5CHJA 1K6SA 2BG1A 1NJ4A 4RX3A 4JBFA 1PWDA 2QMIA 3G35A 4A5RA 3TSGA 3N6IA 3W4QA 4JXGA 4JF5A 5M1AA 4KG6A 1PYYA 2EFUA 3SS3A 3BFDA 3VSKA 3CMZA 3GQZA 3OCLA 3V3RA 3VMAA 5HAPA 4UAAA 2IWCA 1MWUA 4LV2A 1I2WA 2Y2KA 1EROA 4WZ5C 1QMFA 3BM6A 2R9XA 5TFQA 4B4XA 4WEKA 3G2ZA 4JKTA 4EBNA 2HDSA 1W8QA 1QMEA 2FFFB 3ZCZA 4RX2A 4E3LA 1PW8A 3QNCA 3WWXA 3IXBA 3P09A 3SH8A 5EUAA 1S6RA 1XA7A 3CG5A 4PM6A 3QHYA 4ZBEA 3DTMA 3RXWA 4B88A 3UE0A 3ZNTA 4OH0A 3ZFZA 1WYCA 1JWZA 4WEJA 4PPRA 1K56A 3IF6B 4KG5A 3FZCA 2RCXA 2Y2PA 4JXSA 3HLDA 3PBOA 1XXMA 2ZC6B 4OOMA 3C5AA 3BECA 5AQBA 3B3XA 2HDUA 5FQIA 4WZ4A 1YQSA 3MZEA 4OLGA 4MNRA 4GKUA 4RYEA 4R3JA 1IEMA 1KE4A 4E6XA 3MBZA 2E8IA 4IBRA 5AQ9A 3LY3A 1K25A 4OQ0A 4KZ7A 2VGKA 5GLBA 1XPBA 2JBFA 1HZOA 4R0QA 4S2NA 3IXDA 3NC8A 3GVBA 4KZ5A 4WMCA 1I2SA 4OPRA 1GA0A 3NDEA 3IF6A 5FAPA 4X6TA 3C4OA 4WELA 3CZDA 3UPPA 4QJGA 1RCJA 1FR1A 3M2JA 4N1XA 3N8RA 4GD8A 1BUEA 3I7JA 3MKEA 1DJAA 1ESIA 3IHAA 3OPPA 4S2NC 5TR7A 5I94A 1W7FA 4FCFA 3MKFA 1ES5A 1LLBA 1U60A 1Q2PA 5A91A 5KZHA 3HREA 3VOYA 4CJNA 1RP5A 2B5RA 1H8ZA 4GZBA 1MPLA 4IVKA 3O86A 1MY8A 4PM8A 1KE3A 4BQMA 2GDNA 1BTLA 4F94A 3C4PA 2XH9A 3OZHA 4EUZA 2ZC7A 2ZMAA 4FSFA 3IXHA 4CPKA 1BSGA 4DKIA 1TDLA 1MWTA 1MXOA 1K6RA 1MBLA 3Q7ZA 3W4OA 1CEFA 5E43A 3ITAA 3NIAA 1NYYA 1L0GA 3V50A 4IEDA 4WZ5A 5CHUA 4S2PA 3WS1A 1LHYA 4OLDA 3BRMA 4FH2A 1BLPA 5EOOA 3NBLA 3WS0A 4BD0A 5HAQA 4K0WA 1GHIA 1HD8A 1GA9A 3W4PA 4N1HA 1I5QA 4Y0TA 2ZQAA 2Y2LA 4JPMA 2Y2MA 5E2HA 5FI7A 2Z2LB 4P0MA 2ZM2A 5EVID 1K4FA 3GR2A 5GL9A 1ES3A 5JYOA 5J8XA 4ID4A 1Y54A 3ZG0A 2JE5A 1S0WA 4DE3A 4E3JA 1NXYA 3GSGA 4OPYA 3VP4A 2WZZA 1GHPA 1FSWA 1PWGA 4OP5A 1N9BA 5HX9A 1IYSA 1EI5A 5HW3A 2G2WA 3V3SA 4RVAA 2DCFA 1TDGA 3PBQA 5AQAA 3PAEA 2WGVA 3NDGA 1BLSA 3GTCA 5GLCA 4OQHA 4X69A 1CI9A 5DF8A 3VFFA 5A93A 5DTKA 1FSYA 1O7EA 4E3KA 4UA9A 1TEMA 1MKIA 1YLPA 3SS5A 4KENB 1G6AA 5FQJA 4EBPA 2Y2NA 3HUNA 4PMAA 4QHCA 1KGFA 5HARA 2HPBA 3BEBA 2QPNA 2HP5A 2ZQ8A 1TVFA 5EE8A 5E2GA 4LV0A 4K91A 3VOZA 1ES4A 2ZLYA 4N92A 4IVIA 5FA7A 1MWRA 3HLWA 4E3OA 3ZHHA 5CTNA 2JCHA 1G68A 5FI6A 4HBUA 5KSCA 3HLBA 4NK3A 4JLFA 5G18A 4GDBA 1YMXA 3A3IA 3N7WA 4H8RA 5DF9A 3FYZA 1YT4A 2HDRA 4GD6A 4DXCA 2X01A 4P85A 5FI2A 4GN2A 1MWSA 4E3MA 3M2KA 3BFFA 1JWVA 3EQVA 3FKWA 3UN7A 3QNBA 1K4EA 4GOGA 2IWDA 4HEFA 2C5WB 2ZC5B 5CGSA 5FATA 4GNUA 4QU3A 1YMSA 2WKHA 3PTEA 1SCWA 2WADA 1JWPA 2WGWB 4BENA 1Z6FA 2A3UA 1DJCA 1KE0A 5DTSA 1WYBA 4LCLA 4KZ4A 1CI8A 1IYQA 1L0FA 4X55A 4OVDA 5EOEA 5DVAA 2H10A 1H5XA 3A3FA 5CRFA 3OPHA 4S2OA 4QY5A 3ZVWA 3FV7A 3IHBA 5FQ9A 3Q7VA 3OPRA 3ZG8B 1HTZA 4C6YA 2Y2OA 5CGWA 3JYIA 1VM1A 3GMWA 1K57C 5GHXA 5EVLA 4E6WA 2EXAA 4MEZA 1GHMA 4Y0UA 4JXWA 3UPNA 3E2KA 1ES2A 4S2IA 4S2LA 4MBHA 3ZG7B 3NI9A 1E3UA 1KVLA 3PBNA 1YM1A 1SKFA 4RA7A 2RL3A 2Y59A 5U47A 1M40A 2DNSA 2EXBA 3ITBA 3HLFA 3MXSA 4P6BA 4XUZA 4JF6A 4KZ6A 5D3OA 2X02A 4UHUA 3EQUA 4LCMA 5A90A 3IF5A 3UY6A 1YLJA 2G2UA 3FWLA 4KQOA 1FCMA 2XR0A 3MFDA 2XFTA 3PBTA 5HL1A 3ZVTA 1KGEA 3OC2A 3TOIA 2Y2QA 1SDEA 1W79A 2P9VA 3PBRA 4PM7A 5AQ7A 3VSLA 5KMWA 1KGGA 5GLDA 3S4XA 1ONGA 4B4ZA 3LCEA 4DDYA 3A3DA 1WE4A 4ZDXA 2V2FF 5FQQA 5FDHA 3MXRA 2ZM0A 3S1YA 3VP0A 2XGNA 2ZC3B 4N9KA 4WYYA 4X56A 1DJBA 2ZM8A 3MZDA 4DE1A 4X53A 2OLVA 4OOLA 1KDSA 3G32A 3HUOA 3E2LA 5L2FA 2C6WB 2P9VB 2PU2A 5GHZA 3SH7A 1K38A 4ZAMA 4X68A 1BLCA 3RXXA 4JF4A 5F83A 3TG9A 4DDSA 4C3QA 3G2YA 3VFHA 4YFMA 4EV4A 3UE3A 5F1GA 5CEBA 1Q2QA 3VP1A 3G4PA 1ZG4A 1PIOA 4XUXA 2A49A 4UA6A 1ESUA 5EVIC 1RGYA 3UDFA 1O07A 1BT5A 2P74A 1NYMA 2XFSA 1GCEA 4MLLA 2ZQ7A 2Y4AA 4S2KA 1LI0A 1H8YA 1PW1A 4E3IA 3AGFA 3HVFA 1BULA 1E25A 4KZ3A 4KQQA 3BLMA 1XX2A 2V20A 1VQQA 3HUMA 4U0TA 4U3TA 3CJMA 1NZOA 1ZKJA 4S2JA 1K55A 1C3BA 2UWXA 3G30A 2R9WA 3Q07A 3HLGA 3GV9A 2DRWA 4HBTA 4OOYA 1PZOA 2Y2HA 4GDNA 1K57A 2Y2GA 1NZUA 3AGDA 3UO9A 4L0LA 4QY6A 3ZG9B 4Z9QA 3IQAA 4EBLA 5A92A 3ISGA 2ZQ9A 4QD4A 3VP2A 1RGZA 3BFEA 4EQIA 4K0XA 1HVBA 1CK3A 1FCOA 4WM9A 1SHVA 5CEDA 2Q9MA 4KG2A 1PWCA 2ZD8A 4DF6A 1NRFA 1E3UD 3LO7A 4LV1A 4DRTA 5M19A 1ERMA 4R4SA 5HFOA 2WAFA 1LL5A 3DWZA 2XD1A 2QZ6A 3D4FA 1XGJA 2X71A 1PZPA 3HLEA 5CGXA 2WK0A 2WAEA 4R1GA 5FSRA 4WMCD 4Y7PA 3Q82A 3HLCA 3UNWA 3C7UA 4ZJ1A 5EVIB 3WRZA 1OMEA 3LY4A 3PAGA 4BLMA 1K54C 1PI4A 1L0EA 4FD8A 3ZNYA 3LEZA 3RJUA 3FKVA 4KZ9A 4OONA 1ERQA 2WKEA 3M6HA 2PBYA 3Q81A 3IT9A 4OKPA 4MBFA 2XD5A 3O88A 3HL9A 4O7DA 3BLSA 2IWBA 3DWKA 1XGIA 2WZXA 4U0XA 1DY6A 3A3EA 1BLHA 5IHVA 1K56D 1L0DA 4ZJ3A 2H0TA 4BL2A 3V5MA 1IYPA 1E4DA 5EPHA 1CEGA 3IWOA 4KZAA 3Q7VB 1N4OA 1FQGA 4ZJ2A 3O3VA 2Y55A 3ZG5A 4DE0A 5M18A 4DXBA 2CC1A 1YLYA 4OPZA 2XQZA 1EWZA 2XEPA 2ZQCA 3OCNA 5E2FA 4D2OA 4IBXA 2H0YA 4UA7A 5DTTA 2WYXA 2ZC4B 3C7VA 5TGFA 3ZDJA 3AGEA 4ZTKA 4R3BA 5DF7A 1W8YA 1YLTA 3O87A 2FFYA 3NCKA 3ZGAB 2OV5A 1J9MA 2EX2A 5GLAA 1ONHA 1FR6A 2PU4A 3IWQA 3Q1FA 5KSHA 5FASA 1XA1A 1KDWA 1ZC2A 1BZAA 4R4RA 3GRJA 3A3JA 4N9LA 2EX8A 1IYOA 3IH8A 2Y2JA 3SS4A 2XK1A 3NY4A 2VGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PM9 A;  1XP4 A;  2WUQ A;  4WBG A;  5BOH A;  3IF6 C;  3IH9 A;  2EX6 A;  3BFG A;  1W5D A;  4OP8 A;  4Q8I A;  4JXV A;  3BYD A;  1IEL A;  4KQR A;  3N4I A;  5F1F A;  2WKI A;  4S2M A;  2WGW A;  5FAQ A;  2WGI A;  3W8K A;  1XKZ A;  1YLZ A;  1JVJ A;  2EX9 A;  5EEC A;  3G31 A;  2OLU A;  2Y2I A;  1ALQ A;  1LL9 A;  2ZQD A;  5CXW A;  2J7V A;  2OSU A;  1K54 A;  1YLW A;  2I72 A;  4BJP A;  4DE2 A;  4KZ8 A;  2H5S A;  2Z2M B;  1JTD A;  5CTM A;  4NET A;  4OQG A;  5E2E A;  5EVI A;  1IKG A;  5FQK A;  5GHY A;  5HAI A;  4E3N A;  2EFX A;  2XLN A;  4MBK A;  3UDX A;  4BD1 A;  3IXG A;  5JYP A;  3P98 A;  3IWI A;  4QB8 A;  2HDQ A;  1ZG6 A;  1M6K A;  3WS4 A;  3HBR A;  4M3K A;  1AXB A;  1JTG A;  2J8Y A;  4FH4 A;  2J9O A;  2J9P A;  1IKI A;  4PM5 A;  4BL3 A;  1PI5 A;  1K55 C;  1KVM A;  3G34 A;  1NY0 A;  3SH9 A;  5CEC A;  4LEN A;  3MZF A;  4KZB A;  5CHM A;  3M6B A;  4P87 A;  3N8S A;  2Q9N A;  1L2S A;  2HP9 A;  3WS5 A;  1SDN A;  5FQM A;  2Y91 A;  1LI9 A;  2HP6 A;  3N8L A;  4HES A;  3UE1 A;  3WS2 A;  4EWF A;  3OPL A;  2XF3 A;  5FAO A;  1FOF A;  5CER A;  3SOI A;  4OPQ A;  4YIN A;  4R23 A;  4XXR A;  3PBS A;  2ZJ9 A;  3V39 A;  2XDM A;  5F82 A;  2BLS A;  4C75 A;  4OQI A;  4Y0O A;  3WRT A;  3VP3 A;  3UDI A;  3DW0 A;  3S22 A;  4GB7 A;  4LV3 A;  1FCN A;  3UPO A;  2JC7 A;  3BFC A;  2V1Z A;  5CHJ A;  1K6S A;  2BG1 A;  1NJ4 A;  4RX3 A;  4JBF A;  1PWD A;  2QMI A;  3G35 A;  4A5R A;  3TSG A;  3N6I A;  3W4Q A;  4JXG A;  4JF5 A;  5M1A A;  4KG6 A;  1PYY A;  2EFU A;  3SS3 A;  3BFD A;  3VSK A;  3CMZ A;  3GQZ A;  3OCL A;  3V3R A;  3VMA A;  5HAP A;  4UAA A;  2IWC A;  1MWU A;  4LV2 A;  1I2W A;  2Y2K A;  1ERO A;  4WZ5 C;  1QMF A;  3BM6 A;  2R9X A;  5TFQ A;  4B4X A;  4WEK A;  3G2Z A;  4JKT A;  4EBN A;  2HDS A;  1W8Q A;  1QME A;  2FFF B;  3ZCZ A;  4RX2 A;  4E3L A;  1PW8 A;  3QNC A;  3WWX A;  3IXB A;  3P09 A;  3SH8 A;  5EUA A;  1S6R A;  1XA7 A;  3CG5 A;  4PM6 A;  3QHY A;  4ZBE A;  3DTM A;  3RXW A;  4B88 A;  3UE0 A;  3ZNT A;  4OH0 A;  3ZFZ A;  1WYC A;  1JWZ A;  4WEJ A;  4PPR A;  1K56 A;  3IF6 B;  4KG5 A;  3FZC A;  2RCX A;  2Y2P A;  4JXS A;  3HLD A;  3PBO A;  1XXM A;  2ZC6 B;  4OOM A;  3C5A A;  3BEC A;  5AQB A;  3B3X A;  2HDU A;  5FQI A;  4WZ4 A;  1YQS A;  3MZE A;  4OLG A;  4MNR A;  4GKU A;  4RYE A;  4R3J A;  1IEM A;  1KE4 A;  4E6X A;  3MBZ A;  2E8I A;  4IBR A;  5AQ9 A;  3LY3 A;  1K25 A;  4OQ0 A;  4KZ7 A;  2VGK A;  5GLB A;  1XPB A;  2JBF A;  1HZO A;  4R0Q A;  4S2N A;  3IXD A;  3NC8 A;  3GVB A;  4KZ5 A;  4WMC A;  1I2S A;  4OPR A;  1GA0 A;  3NDE A;  3IF6 A;  5FAP A;  4X6T A;  3C4O A;  4WEL A;  3CZD A;  3UPP A;  4QJG A;  1RCJ A;  1FR1 A;  3M2J A;  4N1X A;  3N8R A;  4GD8 A;  1BUE A;  3I7J A;  3MKE A;  1DJA A;  1ESI A;  3IHA A;  3OPP A;  4S2N C;  5TR7 A;  5I94 A;  1W7F A;  4FCF A;  3MKF A;  1ES5 A;  1LLB A;  1U60 A;  1Q2P A;  5A91 A;  5KZH A;  3HRE A;  3VOY A;  4CJN A;  1RP5 A;  2B5R A;  1H8Z A;  4GZB A;  1MPL A;  4IVK A;  3O86 A;  1MY8 A;  4PM8 A;  1KE3 A;  4BQM A;  2GDN A;  1BTL A;  4F94 A;  3C4P A;  2XH9 A;  3OZH A;  4EUZ A;  2ZC7 A;  2ZMA A;  4FSF A;  3IXH A;  4CPK A;  1BSG A;  4DKI A;  1TDL A;  1MWT A;  1MXO A;  1K6R A;  1MBL A;  3Q7Z A;  3W4O A;  1CEF A;  5E43 A;  3ITA A;  3NIA A;  1NYY A;  1L0G A;  3V50 A;  4IED A;  4WZ5 A;  5CHU A;  4S2P A;  3WS1 A;  1LHY A;  4OLD A;  3BRM A;  4FH2 A;  1BLP A;  5EOO A;  3NBL A;  3WS0 A;  4BD0 A;  5HAQ A;  4K0W A;  1GHI A;  1HD8 A;  1GA9 A;  3W4P A;  4N1H A;  1I5Q A;  4Y0T A;  2ZQA A;  2Y2L A;  4JPM A;  2Y2M A;  5E2H A;  5FI7 A;  2Z2L B;  4P0M A;  2ZM2 A;  5EVI D;  1K4F A;  3GR2 A;  5GL9 A;  1ES3 A;  5JYO A;  5J8X A;  4ID4 A;  1Y54 A;  3ZG0 A;  2JE5 A;  1S0W A;  4DE3 A;  4E3J A;  1NXY A;  3GSG A;  4OPY A;  3VP4 A;  2WZZ A;  1GHP A;  1FSW A;  1PWG A;  4OP5 A;  1N9B A;  5HX9 A;  1IYS A;  1EI5 A;  5HW3 A;  2G2W A;  3V3S A;  4RVA A;  2DCF A;  1TDG A;  3PBQ A;  5AQA A;  3PAE A;  2WGV A;  3NDG A;  1BLS A;  3GTC A;  5GLC A;  4OQH A;  4X69 A;  1CI9 A;  5DF8 A;  3VFF A;  5A93 A;  5DTK A;  1FSY A;  1O7E A;  4E3K A;  4UA9 A;  1TEM A;  1MKI A;  1YLP A;  3SS5 A;  4KEN B;  1G6A A;  5FQJ A;  4EBP A;  2Y2N A;  3HUN A;  4PMA A;  4QHC A;  1KGF A;  5HAR A;  2HPB A;  3BEB A;  2QPN A;  2HP5 A;  2ZQ8 A;  1TVF A;  5EE8 A;  5E2G A;  4LV0 A;  4K91 A;  3VOZ A;  1ES4 A;  2ZLY A;  4N92 A;  4IVI A;  5FA7 A;  1MWR A;  3HLW A;  4E3O A;  3ZHH A;  5CTN A;  2JCH A;  1G68 A;  5FI6 A;  4HBU A;  5KSC A;  3HLB A;  4NK3 A;  4JLF A;  5G18 A;  4GDB A;  1YMX A;  3A3I A;  3N7W A;  4H8R A;  5DF9 A;  3FYZ A;  1YT4 A;  2HDR A;  4GD6 A;  4DXC A;  2X01 A;  4P85 A;  5FI2 A;  4GN2 A;  1MWS A;  4E3M A;  3M2K A;  3BFF A;  1JWV A;  3EQV A;  3FKW A;  3UN7 A;  3QNB A;  1K4E A;  4GOG A;  2IWD A;  4HEF A;  2C5W B;  2ZC5 B;  5CGS A;  5FAT A;  4GNU A;  4QU3 A;  1YMS A;  2WKH A;  3PTE A;  1SCW A;  2WAD A;  1JWP A;  2WGW B;  4BEN A;  1Z6F A;  2A3U A;  1DJC A;  1KE0 A;  5DTS A;  1WYB A;  4LCL A;  4KZ4 A;  1CI8 A;  1IYQ A;  1L0F A;  4X55 A;  4OVD A;  5EOE A;  5DVA A;  2H10 A;  1H5X A;  3A3F A;  5CRF A;  3OPH A;  4S2O A;  4QY5 A;  3ZVW A;  3FV7 A;  3IHB A;  5FQ9 A;  3Q7V A;  3OPR A;  3ZG8 B;  1HTZ A;  4C6Y A;  2Y2O A;  5CGW A;  3JYI A;  1VM1 A;  3GMW A;  1K57 C;  5GHX A;  5EVL A;  4E6W A;  2EXA A;  4MEZ A;  1GHM A;  4Y0U A;  4JXW A;  3UPN A;  3E2K A;  1ES2 A;  4S2I A;  4S2L A;  4MBH A;  3ZG7 B;  3NI9 A;  1E3U A;  1KVL A;  3PBN A;  1YM1 A;  1SKF A;  4RA7 A;  2RL3 A;  2Y59 A;  5U47 A;  1M40 A;  2DNS A;  2EXB A;  3ITB A;  3HLF A;  3MXS A;  4P6B A;  4XUZ A;  4JF6 A;  4KZ6 A;  5D3O A;  2X02 A;  4UHU A;  3EQU A;  4LCM A;  5A90 A;  3IF5 A;  3UY6 A;  1YLJ A;  2G2U A;  3FWL A;  4KQO A;  1FCM A;  2XR0 A;  3MFD A;  2XFT A;  3PBT A;  5HL1 A;  3ZVT A;  1KGE A;  3OC2 A;  3TOI A;  2Y2Q A;  1SDE A;  1W79 A;  2P9V A;  3PBR A;  4PM7 A;  5AQ7 A;  3VSL A;  5KMW A;  1KGG A;  5GLD A;  3S4X A;  1ONG A;  4B4Z A;  3LCE A;  4DDY A;  3A3D A;  1WE4 A;  4ZDX A;  2V2F F;  5FQQ A;  5FDH A;  3MXR A;  2ZM0 A;  3S1Y A;  3VP0 A;  2XGN A;  2ZC3 B;  4N9K A;  4WYY A;  4X56 A;  1DJB A;  2ZM8 A;  3MZD A;  4DE1 A;  4X53 A;  2OLV A;  4OOL A;  1KDS A;  3G32 A;  3HUO A;  3E2L A;  5L2F A;  2C6W B;  2P9V B;  2PU2 A;  5GHZ A;  3SH7 A;  1K38 A;  4ZAM A;  4X68 A;  1BLC A;  3RXX A;  4JF4 A;  5F83 A;  3TG9 A;  4DDS A;  4C3Q A;  3G2Y A;  3VFH A;  4YFM A;  4EV4 A;  3UE3 A;  5F1G A;  5CEB A;  1Q2Q A;  3VP1 A;  3G4P A;  1ZG4 A;  1PIO A;  4XUX A;  2A49 A;  4UA6 A;  1ESU A;  5EVI C;  1RGY A;  3UDF A;  1O07 A;  1BT5 A;  2P74 A;  1NYM A;  2XFS A;  1GCE A;  4MLL A;  2ZQ7 A;  2Y4A A;  4S2K A;  1LI0 A;  1H8Y A;  1PW1 A;  4E3I A;  3AGF A;  3HVF A;  1BUL A;  1E25 A;  4KZ3 A;  4KQQ A;  3BLM A;  1XX2 A;  2V20 A;  1VQQ A;  3HUM A;  4U0T A;  4U3T A;  3CJM A;  1NZO A;  1ZKJ A;  4S2J A;  1K55 A;  1C3B A;  2UWX A;  3G30 A;  2R9W A;  3Q07 A;  3HLG A;  3GV9 A;  2DRW A;  4HBT A;  4OOY A;  1PZO A;  2Y2H A;  4GDN A;  1K57 A;  2Y2G A;  1NZU A;  3AGD A;  3UO9 A;  4L0L A;  4QY6 A;  3ZG9 B;  4Z9Q A;  3IQA A;  4EBL A;  5A92 A;  3ISG A;  2ZQ9 A;  4QD4 A;  3VP2 A;  1RGZ A;  3BFE A;  4EQI A;  4K0X A;  1HVB A;  1CK3 A;  1FCO A;  4WM9 A;  1SHV A;  5CED A;  2Q9M A;  4KG2 A;  1PWC A;  2ZD8 A;  4DF6 A;  1NRF A;  1E3U D;  3LO7 A;  4LV1 A;  4DRT A;  5M19 A;  1ERM A;  4R4S A;  5HFO A;  2WAF A;  1LL5 A;  3DWZ A;  2XD1 A;  2QZ6 A;  3D4F A;  1XGJ A;  2X71 A;  1PZP A;  3HLE A;  5CGX A;  2WK0 A;  2WAE A;  4R1G A;  5FSR A;  4WMC D;  4Y7P A;  3Q82 A;  3HLC A;  3UNW A;  3C7U A;  4ZJ1 A;  5EVI B;  3WRZ A;  1OME A;  3LY4 A;  3PAG A;  4BLM A;  1K54 C;  1PI4 A;  1L0E A;  4FD8 A;  3ZNY A;  3LEZ A;  3RJU A;  3FKV A;  4KZ9 A;  4OON A;  1ERQ A;  2WKE A;  3M6H A;  2PBY A;  3Q81 A;  3IT9 A;  4OKP A;  4MBF A;  2XD5 A;  3O88 A;  3HL9 A;  4O7D A;  3BLS A;  2IWB A;  3DWK A;  1XGI A;  2WZX A;  4U0X A;  1DY6 A;  3A3E A;  1BLH A;  5IHV A;  1K56 D;  1L0D A;  4ZJ3 A;  2H0T A;  4BL2 A;  3V5M A;  1IYP A;  1E4D A;  5EPH A;  1CEG A;  3IWO A;  4KZA A;  3Q7V B;  1N4O A;  1FQG A;  4ZJ2 A;  3O3V A;  2Y55 A;  3ZG5 A;  4DE0 A;  5M18 A;  4DXB A;  2CC1 A;  1YLY A;  4OPZ A;  2XQZ A;  1EWZ A;  2XEP A;  2ZQC A;  3OCN A;  5E2F A;  4D2O A;  4IBX A;  2H0Y A;  4UA7 A;  5DTT A;  2WYX A;  2ZC4 B;  3C7V A;  5TGF A;  3ZDJ A;  3AGE A;  4ZTK A;  4R3B A;  5DF7 A;  1W8Y A;  1YLT A;  3O87 A;  2FFY A;  3NCK A;  3ZGA B;  2OV5 A;  1J9M A;  2EX2 A;  5GLA A;  1ONH A;  1FR6 A;  2PU4 A;  3IWQ A;  3Q1F A;  5KSH A;  5FAS A;  1XA1 A;  1KDW A;  1ZC2 A;  1BZA A;  4R4R A;  3GRJ A;  3A3J A;  4N9L A;  2EX8 A;  1IYO A;  3IH8 A;  2Y2J A;  3SS4 A;  2XK1 A;  3NY4 A;  2VGJ A; 
#chains in the Genus database with same CATH topology
 2WUQ A;  4WBG A;  1UWP X;  2W0N A;  3LR3 A;  3FG8 A;  2QJ5 A;  1IEL A;  4EW7 A;  1YLZ A;  2EX9 A;  3IS2 A;  1SKO A;  5CXW A;  2OSU A;  5EV0 A;  1DP9 A;  4LLO B;  4DE2 A;  5GHY A;  4NET A;  5E2E A;  3IXG A;  2HDQ A;  2E8J A;  1ZHH B;  1AXB A;  1D1J A;  2V1A A;  5CEC A;  5CHM A;  1TS6 A;  3MZF A;  3M6B A;  3N8S A;  5F69 A;  2HP9 A;  4O8G A;  1SDN A;  1LI9 A;  2HP6 A;  3N8L A;  2XF3 A;  1FOF A;  4YIN A;  2XDM A;  4RQ9 A;  4GB7 A;  3UB6 A;  2JC7 A;  5CHJ A;  1K6S A;  2OWJ A;  2BG1 A;  5TBM A;  4RX3 A;  1TS7 A;  1PWD A;  3RH8 B;  3T4O A;  4A5R A;  3FPW A;  3E4P A;  3TSG A;  3W4Q A;  4KG6 A;  3SS3 A;  3CMZ A;  4WF0 A;  2IWC A;  3UB8 A;  3RFB A;  1ERO A;  1QMF A;  2PHY A;  3BM6 A;  1BYW A;  4MN7 A;  3G2Z A;  4I3A A;  2VX8 A;  4EBN A;  3VE4 A;  1P9R A;  1TD5 A;  3SH8 A;  2ZBB A;  2PT7 A;  2W1R A;  5G4Y A;  1JWZ A;  1F5M A;  4PPR A;  1K56 A;  3K3C A;  1NLY A;  3HLD A;  3UE6 A;  2PD7 A;  3MZE A;  4GKU A;  4RYE A;  3MBZ A;  4QPR A;  2VGK A;  4S2N A;  4KZ5 A;  4Y5F A;  3NDE A;  1S1Z A;  4QJG A;  2BAS A;  4GD8 A;  4DN0 A;  4S2N C;  4IUH A;  3S7N A;  4ARZ A;  3V67 A;  2B5R A;  3JVV A;  4GHI B;  1VET A;  1MY8 A;  4PM8 A;  3C4P A;  4EUZ A;  2ZMA A;  1P0Z A;  1P97 A;  3C8C A;  4FSF A;  1MXO A;  1N9N A;  4FTX A;  3W4O A;  1FIK A;  3LR4 A;  3ITA A;  1L0G A;  5LBR A;  3WS1 A;  4FH2 A;  1BLP A;  4EET B;  4K0W A;  1HD8 A;  3W4P A;  4Y2F A;  2JKT I;  2ZM2 A;  1K4F A;  3GR2 A;  4M4X A;  5J8X A;  4DJ2 A;  3VP4 A;  4EEP A;  1N9B A;  1IYS A;  1EI5 A;  2J3T C;  5AQA A;  2WGV A;  3NDG A;  4OQH A;  3TW8 A;  3VFF A;  4E3K A;  1O7E A;  1Z09 A;  2JKF A;  4R38 A;  5FQJ A;  4EBP A;  3LIA A;  4K08 A;  3BEB A;  2QPN A;  5E2G A;  4IVI A;  2BTF P;  3ZHH A;  5K5B A;  2VEA A;  3UB9 A;  4NK3 A;  5G18 A;  2HZ5 A;  3N7W A;  3QP6 A;  4GD6 A;  2HDR A;  4DXC A;  3EQV A;  3FKW A;  5HDD A;  2ZC5 B;  5CGS A;  4QU3 A;  2WKH A;  2WAD A;  1XJ4 A;  1JWP A;  2WGW B;  3T50 A;  4KZ4 A;  1CI8 A;  1IYQ A;  1L0F A;  2J3W A;  4G3V A;  3A3F A;  5CRF A;  4S2O A;  2FH5 A;  5FQ9 A;  1HTZ A;  3W2Z A;  2HJ9 C;  5GHX A;  5EVL A;  4NXF A;  4JXW A;  4H6J B;  3NI9 A;  1E3U A;  3E0Y A;  2EWW A;  5HL6 A;  3MXS A;  4P6B A;  4HJ4 A;  4UHU A;  3EQU A;  5A90 A;  3IF5 A;  2WKR A;  2QWS A;  4KQO A;  2V8C A;  4UEY A;  2XR0 A;  3OBF A;  5HL1 A;  1TS8 A;  1VEU A;  3TOI A;  3PBR A;  2P9V A;  1W79 A;  4PM7 A;  3VSL A;  1NWZ A;  2D01 A;  1XJ6 A;  4FUW A;  3MXR A;  4X56 A;  2WKP A;  1DJB A;  1VEU B;  3ZYT A;  3E2L A;  5L2F A;  1K38 A;  4X68 A;  1F2K A;  4JF4 A;  3UE3 A;  1Q2Q A;  5I5L A;  1ZG4 A;  1PIO A;  3SZT A;  1ESU A;  5EVI C;  1RGY A;  3UDF A;  3LIB A;  1NYM A;  2L0W A;  2ZQ7 A;  2Y4A A;  1LI0 A;  1H8Y A;  1BUL A;  1E25 A;  4KQQ A;  3HUM A;  2G7U A;  4NXB A;  3G30 A;  2UWX A;  2R9W A;  3GV9 A;  4OOY A;  4LPZ A;  3B47 A;  2Q0O A;  1K57 A;  3UO9 A;  4R70 A;  4L0L A;  4QY6 A;  4X25 A;  4ETX A;  2ZQ9 A;  2ZMF A;  2ACG A;  5HD3 A;  3U4L P;  5HD5 A;  1SHV A;  5CED A;  3MQQ A;  4HH2 A;  4DF6 A;  3LO7 A;  4DRT A;  1ERM A;  2J3T D;  2WAE A;  4L9G A;  4O0P A;  4Y7P A;  3UNW A;  3WRZ A;  1K54 C;  3LR5 A;  3ZNY A;  5J7E A;  2PR5 A;  1ERQ A;  3Q81 A;  5EM0 A;  1AWI A;  3IBR A;  1D06 A;  2M7U A;  1OPX A;  3DWK A;  2O99 A;  5IHV A;  3LR0 A;  4BL2 A;  3GDI A;  1HLU P;  1LL8 A;  1FQG A;  2Y55 A;  4DXB A;  5J4E A;  2CC1 A;  1YLY A;  1DP8 A;  2V1B A;  3OCN A;  1ODV A;  3LFV A;  5GLA A;  4HP4 A;  5FAS A;  1XA1 A;  3UMD A;  1BZA A;  1FIL A;  1IYO A;  1OTD A;  3IH8 A;  2XK1 A;  5EM1 A;  5BOH A;  1MC0 A;  3BFG A;  1W5D A;  1IFQ A;  2A2L A;  4JXV A;  3T4S A;  4Q8I A;  4G3K A;  1XFN A;  4KQR A;  3N4I A;  3IX4 A;  2WGI A;  1XKZ A;  5EEC A;  3S7P A;  4MN5 A;  5L10 A;  1LL9 A;  4BJP A;  4XT2 A;  4KZ8 A;  3CI6 A;  1JTD A;  4E3N A;  5EVI A;  2Y79 A;  5HZH A;  1IKG A;  2M7V A;  1OJG A;  4MBK A;  5JYP A;  4B93 A;  1ZG6 A;  3HBR A;  5IT5 A;  4FH4 A;  1IKI A;  3SH9 A;  1NY0 A;  4LEN A;  1ACF A;  3WS5 A;  3H82 B;  5FQM A;  1G5U A;  5HDS A;  3OPL A;  2DMW A;  4OPQ A;  1T1B A;  3V39 A;  3FC7 A;  3LIE A;  4C75 A;  3UDI A;  5DJU A;  4LFU A;  4LV3 A;  3EEA A;  3CIT A;  2V1Z A;  3EGD C;  1L3L A;  3F1O B;  3QP1 A;  2EA9 A;  3F1N A;  2KLI A;  3T1Q B;  2QKP A;  4JF5 A;  5M1A A;  3BFD A;  3VSK A;  5HAP A;  3V3R A;  4UAA A;  4LV2 A;  2Y2K A;  4WZ5 C;  3LIF A;  1G6O A;  4B4X A;  4WEK A;  3MSH A;  4RX2 A;  5L07 A;  4AFI A;  3LYX A;  3P09 A;  1D7E A;  1XA7 A;  3CG5 A;  4LGW A;  3QHY A;  3DTM A;  4D60 A;  3UE0 A;  4BWI A;  1WYC A;  1NRJ A;  4HI4 A;  4KG5 A;  3FZC A;  2RCX A;  4JXS A;  2HV1 A;  3PBO A;  2VLG A;  2ZC6 B;  3BEC A;  5AQB A;  4E6X A;  2Z6C A;  2E8I A;  3CPT A;  5GLB A;  2JBF A;  2MJ6 A;  1H0M A;  4R0Q A;  4NXE A;  3IXD A;  3NC8 A;  5FAP A;  4X6T A;  4WLA A;  1RCJ A;  1FR1 A;  4N1X A;  3C38 A;  1BUE A;  3OPP A;  2EWV A;  5I94 A;  4FCF A;  1ES5 A;  4EQ1 A;  3KYQ A;  5F68 A;  1H8Z A;  4GZB A;  3O86 A;  3T1X A;  4BQM A;  2GDN A;  4ME4 A;  2XH9 A;  3OZH A;  1EW0 A;  1DRM A;  3IXH A;  4CPK A;  1BSG A;  4DKI A;  1MWT A;  5E43 A;  3G6O A;  4NXG A;  2OAP 1;  3NIA A;  4S2P A;  2CMN A;  1YKD A;  3BRM A;  3MFX A;  2V9A A;  4BD0 A;  3NOP C;  5HAQ A;  1GHI A;  4N1H A;  2Y2L A;  4GS9 A;  1V9Z A;  2Y2M A;  5E2H A;  2V8F A;  1VHM A;  2Z2L B;  5EVI D;  3T4Q A;  1ES3 A;  2JE5 A;  1S0W A;  3BY9 A;  4X1L A;  2JN7 A;  1GHP A;  2WZZ A;  2ZOI A;  2K2N A;  1CJF A;  2PBD P;  1T1C A;  5HW3 A;  4RVA A;  1W63 Q;  1BLS A;  3GTC A;  5GLC A;  4X69 A;  2QHK A;  4GS9 B;  5F6A A;  1FSY A;  1TEM A;  3HJI A;  2Y2N A;  4QHC A;  1KGF A;  1TVF A;  5EE8 A;  3VOZ A;  4K91 A;  5L09 A;  4N92 A;  4E3O A;  2VV6 A;  5FL3 A;  1VET B;  2W3F A;  3HLB A;  5KSC A;  3B33 A;  1YMX A;  4H8R A;  4PAU A;  4EES A;  4ESP A;  2P04 A;  5FI2 A;  4E3M A;  1MWS A;  3BFF A;  4GOG A;  2IWD A;  2C5W B;  4O01 A;  2P08 A;  4GNU A;  3KYZ A;  3PTE A;  5CX7 A;  4H6J A;  4MN6 A;  1Z6F A;  2A3U A;  1DJC A;  3D72 A;  1WYB A;  2JKT M;  5IU1 A;  3KSG A;  4OVD A;  2H10 A;  1H5X A;  3EEH A;  5MC7 A;  3ZVW A;  4UQI S;  3MJQ A;  1OT9 A;  3Q7V A;  2A24 B;  3JYI A;  3GMW A;  2EXA A;  4MEZ A;  3UPN A;  3E2K A;  4S2I A;  4I3I A;  5G4Z A;  1SKF A;  5U47 A;  2QJ7 A;  1M40 A;  3ITB A;  4JF6 A;  3T4T A;  1GSW A;  3NJA A;  1FCM A;  4Y3I A;  1N9L A;  3PBT A;  2V0U A;  4I3J A;  1SDE A;  4GHI A;  3CAX A;  5KMW A;  5GLD A;  4ZRR A;  4DDY A;  3A3D A;  4Q0J A;  4ZDX A;  2ZMV A;  1W63 M;  3VP0 A;  1S66 L;  2XGN A;  2ZM8 A;  4Y13 A;  2OLV A;  3HUO A;  5DJT A;  2PU2 A;  3GEC A;  1BLC A;  2JKR M;  4C3Q A;  3VFH A;  4JGO A;  5F1G A;  3G4P A;  4XUX A;  2A49 A;  2P74 A;  3NOU C;  2XFS A;  3MR0 A;  4S2K A;  3HVF A;  4KZ3 A;  3NOT C;  2HF6 A;  1XX2 A;  2V20 A;  1VQQ A;  4U3T A;  2PD8 A;  1NZO A;  3IX8 A;  1K55 A;  3K2N A;  1YSQ A;  2DRW A;  1PZO A;  2Y2H A;  4GDN A;  1NZU A;  3ZG9 B;  4UQI M;  3IQA A;  2O0Y A;  2VA0 A;  3KX0 X;  5A92 A;  3A0V A;  4MMN A;  3EOI A;  4I38 A;  1RGZ A;  3BFE A;  1HVB A;  4HJ3 A;  1OTA A;  1PWC A;  5M19 A;  2WAF A;  2ZL1 B;  1XGJ A;  5CGX A;  2WK0 A;  5FSR A;  3Q82 A;  3PAG A;  5FEG A;  1PI4 A;  1L0E A;  3LUQ A;  3RJU A;  3FKV A;  5IS1 A;  3M6H A;  4OKP A;  3HL9 A;  3QP2 A;  2GX5 A;  1YPR A;  2WZX A;  1DY6 A;  4U0X A;  3A3E A;  1XFQ A;  1BLH A;  4ZJ3 A;  1XJ3 A;  2H0T A;  1OJ5 A;  5HWT A;  1N4O A;  4ZJ2 A;  3O3V A;  5M18 A;  5E2F A;  3PR6 A;  2WYX A;  2ZC4 B;  3ZDJ A;  3AGE A;  1W8Y A;  3O87 A;  2FFY A;  3NCK A;  2OV5 A;  2EX2 A;  1FR6 A;  3Q1F A;  4BBV A;  1ZC2 A;  4R4R A;  3A3J A;  4N9L A;  2Y2J A;  3SS4 A;  2VGJ A;  4PM9 A;  1XP4 A;  3IF6 C;  3IH9 A;  3MS6 A;  2EX6 A;  1STZ A;  4HHD A;  4EER A;  2WKI A;  5FAQ A;  3W8K A;  1JVJ A;  2YKH A;  2H28 A;  1TS0 A;  3G31 A;  3A0R A;  4WUJ A;  1ALQ A;  4HQA A;  1YLW A;  2I72 A;  4HY8 A;  3QP8 A;  2Z2M B;  4OQG A;  5HAI A;  2AVX A;  2XLN A;  4BD1 A;  4QB8 A;  3IWI A;  3S7O A;  1M6K A;  2D02 A;  3WS4 A;  2VJW A;  1JTG A;  2J9P A;  4BL3 A;  4DMZ A;  2LB9 A;  1K55 C;  1KVM A;  3G34 A;  4MDZ A;  4KZB A;  2Q9N A;  1L2S A;  2Y91 A;  4EWF A;  3KYE A;  2PAV P;  5FAO A;  1OT6 A;  3F1P A;  2O9C A;  4OQI A;  3S22 A;  2O9A A;  1FCN A;  2R78 A;  3BQ8 A;  5FDS A;  2QMI A;  2W3E A;  2KDK A;  3G35 A;  4F3L B;  4MCW A;  2W27 A;  2GZA A;  2EFU A;  3OCL A;  3VMA A;  4P6Z M;  1MWU A;  1I2W A;  2R9X A;  5TFQ A;  3RTY A;  4JKT A;  1W8Q A;  4WL9 A;  3QNC A;  3WWX A;  3IXB A;  5EUA A;  1S6R A;  3ICY A;  1DP6 A;  3ZNT A;  2OWH A;  2Y2P A;  5HSQ A;  3C5A A;  4WZ4 A;  2W1T B;  1K25 A;  4OQ0 A;  2PYR A;  1XPB A;  1HZO A;  1I2S A;  4OPR A;  1GA0 A;  3IF6 A;  3A0S A;  3C4O A;  4WEL A;  1LT0 A;  4HH3 A;  3CZD A;  4Q0I A;  3E4Q A;  3M2J A;  3S7Q A;  1ZTU A;  3KSF A;  3D9Y A;  3I7J A;  1DJA A;  1ESI A;  1W7F A;  3MKF A;  1S4R A;  5TBM B;  1Q2P A;  1PRQ A;  3HRE A;  2XA7 M;  1RP5 A;  2JKG A;  1KE3 A;  1BTL A;  2ZC7 A;  3MMH A;  3H9W A;  4FOF A;  4PHT A;  1K6R A;  1MBL A;  3Q7Z A;  3V50 A;  3T4J A;  3KSI A;  4WZ5 A;  2L1M A;  5CHU A;  1LHY A;  4OLD A;  4QWO A;  2XA7 S;  1K0K A;  1OTI A;  1VB6 A;  5HWW A;  3NBL A;  1GA9 A;  5FI7 A;  3H82 A;  5GL9 A;  5JYO A;  4CLC D;  2PR6 A;  1NXY A;  2M1C A;  3GSG A;  4OPY A;  1PWG A;  4OP5 A;  3VE3 A;  2P7J A;  2G2W A;  3V3S A;  4Y15 A;  1TDG A;  3PBQ A;  1CI9 A;  5A93 A;  3SS5 A;  2XRN A;  4KEN B;  1G6A A;  1JNU A;  3R4K A;  3HUN A;  4PMA A;  3MQO A;  4LV0 A;  4I5S A;  5FA7 A;  3R7W A;  1LSX A;  1TF1 A;  2JCH A;  5FI6 A;  4HBU A;  2L4R A;  4JLF A;  3A3I A;  1YT4 A;  3P01 A;  1LSV A;  3M2K A;  1JWV A;  2OOL A;  1K4E A;  3C2W A;  4KUK A;  2OAQ 1;  4HJ6 A;  5FAT A;  3R7W B;  3T4L A;  1SCW A;  3H7W A;  5AVF A;  2JKR I;  1MKM A;  4LCL A;  2Y8H A;  2J80 A;  2ZOH A;  3OOV A;  3OPH A;  1F98 A;  4QY5 A;  3FV7 A;  3IHB A;  3IX3 A;  2Y2O A;  1VM1 A;  3TJZ C;  4S2L A;  4KUO A;  4MBH A;  3ZG7 B;  1KVL A;  1YM1 A;  1T19 A;  4RA7 A;  2Y59 A;  5D3O A;  1YAX A;  2GJ3 A;  4KZ6 A;  3JPU A;  4LCM A;  1Y28 A;  1YLJ A;  2G2U A;  2K7S A;  3ZVT A;  4JGQ A;  5AQ7 A;  3S4X A;  5AJG A;  2O9B A;  5FQQ A;  2ZM0 A;  1H3Q A;  2ZC3 B;  3C30 A;  5HWV A;  2GNX A;  3IS2 B;  4OOL A;  1YSP A;  5GHZ A;  3SH7 A;  2PYP A;  3MQ0 A;  4ZAM A;  3RXX A;  3TG9 A;  1OTE A;  4DDS A;  2WKQ A;  4EV4 A;  5CEB A;  5J3W A;  3VP1 A;  3QP4 A;  3T12 B;  3UME A;  4UA6 A;  1BT5 A;  4BMW A;  1PW1 A;  3AGF A;  3P7N A;  3HJK A;  3BLM A;  5HPF A;  4LRZ E;  3NHQ A;  3CJM A;  1ZKJ A;  4S2J A;  5DFX A;  5KIZ A;  5L8M A;  3E4O A;  5A8B A;  2B95 A;  1C3B A;  3HLG A;  4HBT A;  5AVE A;  4CLC A;  2Y2G A;  3AGD A;  3LI8 A;  4EBL A;  4QD4 A;  1UGU A;  3VP2 A;  2UV0 E;  2KOI A;  4EQI A;  4K0X A;  3DTK A;  1CK3 A;  1FCO A;  3EGX C;  4WM9 A;  5F5Y A;  1P9W A;  2Q9M A;  3CHW P;  4R4S A;  5HFO A;  1F9I A;  1LL5 A;  3D4F A;  1PZP A;  3HLE A;  3T4K A;  4CLC B;  5HPI A;  2KX6 A;  2PRF A;  2VGL M;  3C7U A;  2V0W A;  4ZJ1 A;  5DKL A;  3BW6 A;  1OME A;  3LY4 A;  4FD8 A;  2NUT C;  3LEZ A;  4KZ9 A;  4OON A;  1G28 A;  2WKE A;  2PBY A;  4MBF A;  2XD5 A;  3O88 A;  4O7D A;  1XGI A;  1S67 L;  2VV7 A;  1K56 D;  3L7H A;  3VOL A;  3V5M A;  1IYP A;  5EPH A;  2B18 A;  1PFL A;  3IWO A;  3Q7V B;  4KZA A;  3JVU A;  5HDC A;  4DE0 A;  2ZQC A;  3LI9 A;  4IBX A;  4D2O A;  2H0Y A;  5DKK A;  4UA7 A;  5DTT A;  3C7V A;  4ZTK A;  4R3B A;  1YLT A;  4Y17 A;  2HGV A;  4EEU A;  2PU4 A;  5KSH A;  4YOF A;  3F1N B;  2VKS A;  3NY4 A;  4II7 A;  4DJ3 A;  4OP8 A;  3BYD A;  5F1F A;  4S2M A;  2WGW A;  1MZU A;  2ZL1 A;  2PDR A;  2OLU A;  2Y2I A;  2ZQD A;  2J7V A;  1K54 A;  2H5S A;  5CTM A;  5FQK A;  2EFX A;  3UDX A;  3P98 A;  3OLO A;  4M3K A;  3F1P B;  2J8Y A;  2J9O A;  4EU0 A;  4PM5 A;  4NEE D;  1PI5 A;  4P87 A;  4EUV A;  1LSW A;  3WS2 A;  4HES A;  3UE1 A;  1GSV A;  4KQD A;  5CER A;  3SOI A;  5DFY A;  3L9K A;  4R23 A;  4XXR A;  3PBS A;  2ZJ9 A;  1H8M A;  5F82 A;  2BLS A;  4Y0O A;  3WRT A;  3VP3 A;  3DW0 A;  3UPO A;  1CQA A;  3BFC A;  1NJ4 A;  4JBF A;  1Y4O A;  2A24 A;  3N6I A;  4B9O A;  4JXG A;  1A0K A;  1PYY A;  3GQZ A;  2K31 A;  3DTI A;  4L9E A;  3BY8 A;  4R6L A;  2HDS A;  1QME A;  2FFF B;  3ZCZ A;  4E3L A;  3K3D A;  3BJN A;  1PW8 A;  4XT2 B;  2W3G A;  4PM6 A;  4ZBE A;  3RXW A;  4B88 A;  2VZW A;  3SW1 A;  4OH0 A;  3ZFZ A;  4WEJ A;  1SZV A;  3IF6 B;  2HJE A;  1XXM A;  1UWN X;  1NLZ A;  4L9F A;  4OOM A;  4LRX C;  3B3X A;  2HDU A;  5FQI A;  1YQS A;  3D3O A;  4OLG A;  4MNR A;  4R3J A;  1IEM A;  1KE4 A;  4IBR A;  5AQ9 A;  3LY3 A;  4KZ7 A;  4X1M A;  4WMC A;  3GVB A;  3T1S A;  4PKY G;  3PHY A;  3UPP A;  2Z6D A;  3IBJ A;  3LEQ A;  3N8R A;  4JGR A;  3MKE A;  3IHA A;  5TR7 A;  1LLB A;  1U60 A;  5A91 A;  5KZH A;  3VOY A;  4CJN A;  1MPL A;  4IVK A;  4GCZ A;  5EFW A;  4F94 A;  1TDL A;  1OTB A;  1CEF A;  3DAV A;  4ARZ B;  3KO6 A;  1NYY A;  4IED A;  3O5Y A;  3NUL A;  4YWZ A;  3FPV A;  4P6Z S;  4NKP A;  2FZ0 A;  5EOO A;  3WS0 A;  1I5Q A;  4Y0T A;  2ZQA A;  4JPM A;  3ULF A;  4G3W A;  4GLQ A;  4P0M A;  4ID4 A;  1Y54 A;  3ZG0 A;  3U2A A;  3CLO A;  4DE3 A;  4E3J A;  1FSW A;  3UB5 P;  2W1T A;  5HX9 A;  2DCF A;  3PAE A;  1XJ2 A;  5DF8 A;  5DTK A;  4UA9 A;  2IA2 A;  3T1R A;  1MKI A;  1YLP A;  4LRY C;  5HAR A;  3ZQ5 A;  2HPB A;  4I39 A;  2ZQ8 A;  2HP5 A;  3B42 A;  3BWL A;  1ES4 A;  2ZLY A;  1MWR A;  3HLW A;  1J3W A;  2NUP C;  5CTN A;  3H7W B;  1G68 A;  4GDB A;  5DF9 A;  3FYZ A;  4GW9 A;  2X01 A;  4P85 A;  4GN2 A;  5EVE A;  2W3H A;  3UN7 A;  3QNB A;  4HIA A;  4IJG A;  4HEF A;  1YMS A;  2LB5 A;  4BEN A;  1PNE A;  1IOU A;  1KE0 A;  5DTS A;  2XRO A;  4X55 A;  5EOE A;  5DVA A;  4ETZ A;  4R3A A;  3F1O A;  3CWF A;  3OPR A;  3ZG8 B;  4C6Y A;  5CGW A;  1K57 C;  4E6W A;  4F3L A;  1GHM A;  4Y0U A;  1ES2 A;  4BBT A;  3PBN A;  2RL3 A;  4XUZ A;  2DNS A;  2EXB A;  3HLF A;  4WN5 A;  2X02 A;  2INW A;  4E04 A;  4IHQ A;  3UY6 A;  3PXP A;  5FEF A;  3FWL A;  3MFD A;  2XFT A;  3DBA A;  3E98 A;  1KGE A;  3OC2 A;  2Y2Q A;  2I9V A;  1KGG A;  1ONG A;  4B4Z A;  3UB7 A;  3LCE A;  2VGL S;  1WE4 A;  2V2F F;  5FDH A;  3S1Y A;  3CUE A;  4Q0H A;  4N9K A;  4WYY A;  3MZD A;  4DE1 A;  3BQA A;  4X53 A;  4Z1W A;  1KDS A;  3G32 A;  2C6W B;  1KOU A;  2P9V B;  3LGO A;  3TE8 A;  5F83 A;  3G2Y A;  5C5K A;  4YFM A;  4CLC C;  3MF0 A;  3QP5 A;  1O07 A;  3PYP A;  1GCE A;  4MLL A;  1N9O A;  4IUK A;  4E3I A;  4HP9 A;  1GSX A;  4U0T A;  3VV4 A;  3Q07 A;  4PKY A;  4HNB A;  2QYB A;  2B02 A;  2YKF A;  2VV8 A;  4Z9Q A;  3MXQ A;  3ISG A;  4GJ4 A;  3EWK A;  3CPT B;  4KG2 A;  2ZD8 A;  1NRF A;  1E3U D;  4LV1 A;  3DWZ A;  3NEC A;  2XD1 A;  2QZ6 A;  2X71 A;  4JGP A;  2W3D A;  5TJJ A;  4R1G A;  4CQH A;  4NG2 A;  4WMC D;  3HLC A;  1T1A A;  2VK3 A;  5EVI B;  4BLM A;  1X0O A;  3KSH A;  1V9Y A;  3DTE A;  2XSS A;  3IT9 A;  1CF0 A;  3BLS A;  2IWB A;  2JHE A;  3LID A;  1L0D A;  1T18 A;  1E4D A;  1CEG A;  3LIC A;  4HOI A;  3ZG5 A;  4OPZ A;  3HCY A;  2XQZ A;  1EWZ A;  2XEP A;  4YNR A;  1WA9 A;  5TGF A;  5DF7 A;  3TRC A;  3ZGA B;  1J9M A;  1S4S A;  1ONH A;  3IWQ A;  1KDW A;  4EXO A;  3GRJ A;  1SKO B;  2EX8 A;  3CUE C;  4BBU A;  4CLC E;  1S1Y A; 
#chains in the Genus database with same CATH homology
 4PM9 A;  1XP4 A;  2WUQ A;  4WBG A;  5BOH A;  3IF6 C;  3IH9 A;  2EX6 A;  3BFG A;  1W5D A;  4OP8 A;  4Q8I A;  4JXV A;  3BYD A;  1IEL A;  4KQR A;  3N4I A;  5F1F A;  2WKI A;  4S2M A;  2WGW A;  5FAQ A;  2WGI A;  3W8K A;  1XKZ A;  1YLZ A;  1JVJ A;  2EX9 A;  5EEC A;  3G31 A;  2OLU A;  2Y2I A;  1ALQ A;  1LL9 A;  2ZQD A;  5CXW A;  2J7V A;  2OSU A;  1K54 A;  1YLW A;  2I72 A;  4BJP A;  4DE2 A;  4KZ8 A;  2H5S A;  2Z2M B;  1JTD A;  5CTM A;  4NET A;  4OQG A;  5E2E A;  5EVI A;  1IKG A;  5FQK A;  5GHY A;  5HAI A;  4E3N A;  2EFX A;  2XLN A;  4MBK A;  3UDX A;  4BD1 A;  3IXG A;  5JYP A;  3P98 A;  3IWI A;  4QB8 A;  2HDQ A;  1ZG6 A;  1M6K A;  3WS4 A;  3HBR A;  4M3K A;  1AXB A;  1JTG A;  2J8Y A;  4FH4 A;  2J9O A;  2J9P A;  1IKI A;  4PM5 A;  4BL3 A;  1PI5 A;  1K55 C;  1KVM A;  3G34 A;  1NY0 A;  3SH9 A;  5CEC A;  4LEN A;  3MZF A;  4KZB A;  5CHM A;  3M6B A;  4P87 A;  3N8S A;  2Q9N A;  1L2S A;  2HP9 A;  3WS5 A;  1SDN A;  5FQM A;  2Y91 A;  1LI9 A;  2HP6 A;  3N8L A;  4HES A;  3UE1 A;  3WS2 A;  4EWF A;  3OPL A;  2XF3 A;  5FAO A;  1FOF A;  5CER A;  3SOI A;  4OPQ A;  4YIN A;  4R23 A;  4XXR A;  3PBS A;  2ZJ9 A;  3V39 A;  2XDM A;  5F82 A;  2BLS A;  4C75 A;  4OQI A;  4Y0O A;  3WRT A;  3VP3 A;  3UDI A;  3DW0 A;  3S22 A;  4GB7 A;  4LV3 A;  1FCN A;  3UPO A;  2JC7 A;  3BFC A;  2V1Z A;  5CHJ A;  1K6S A;  2BG1 A;  1NJ4 A;  4RX3 A;  4JBF A;  1PWD A;  2QMI A;  3G35 A;  4A5R A;  3TSG A;  3N6I A;  3W4Q A;  4JXG A;  4JF5 A;  5M1A A;  4KG6 A;  1PYY A;  2EFU A;  3SS3 A;  3BFD A;  3VSK A;  3CMZ A;  3GQZ A;  3OCL A;  3V3R A;  3VMA A;  5HAP A;  4UAA A;  2IWC A;  1MWU A;  4LV2 A;  1I2W A;  2Y2K A;  1ERO A;  4WZ5 C;  1QMF A;  3BM6 A;  2R9X A;  5TFQ A;  4B4X A;  4WEK A;  3G2Z A;  4JKT A;  4EBN A;  2HDS A;  1W8Q A;  1QME A;  2FFF B;  3ZCZ A;  4RX2 A;  4E3L A;  1PW8 A;  3QNC A;  3WWX A;  3IXB A;  3P09 A;  3SH8 A;  5EUA A;  1S6R A;  1XA7 A;  3CG5 A;  4PM6 A;  3QHY A;  4ZBE A;  3DTM A;  3RXW A;  4B88 A;  3UE0 A;  3ZNT A;  4OH0 A;  3ZFZ A;  1WYC A;  1JWZ A;  4WEJ A;  4PPR A;  1K56 A;  3IF6 B;  4KG5 A;  3FZC A;  2RCX A;  2Y2P A;  4JXS A;  3HLD A;  3PBO A;  1XXM A;  2ZC6 B;  4OOM A;  3C5A A;  3BEC A;  5AQB A;  3B3X A;  2HDU A;  5FQI A;  4WZ4 A;  1YQS A;  3MZE A;  4OLG A;  4MNR A;  4GKU A;  4RYE A;  4R3J A;  1IEM A;  1KE4 A;  4E6X A;  3MBZ A;  2E8I A;  4IBR A;  5AQ9 A;  3LY3 A;  1K25 A;  4OQ0 A;  4KZ7 A;  2VGK A;  5GLB A;  1XPB A;  2JBF A;  1HZO A;  4R0Q A;  4S2N A;  3IXD A;  3NC8 A;  3GVB A;  4KZ5 A;  4WMC A;  1I2S A;  4OPR A;  1GA0 A;  3NDE A;  3IF6 A;  5FAP A;  4X6T A;  3C4O A;  4WEL A;  3CZD A;  3UPP A;  4QJG A;  1RCJ A;  1FR1 A;  3M2J A;  4N1X A;  3N8R A;  4GD8 A;  1BUE A;  3I7J A;  3MKE A;  1DJA A;  1ESI A;  3IHA A;  3OPP A;  4S2N C;  5TR7 A;  5I94 A;  1W7F A;  4FCF A;  3MKF A;  1ES5 A;  1LLB A;  1U60 A;  1Q2P A;  5A91 A;  5KZH A;  3HRE A;  3VOY A;  4CJN A;  1RP5 A;  2B5R A;  1H8Z A;  4GZB A;  1MPL A;  4IVK A;  3O86 A;  1MY8 A;  4PM8 A;  1KE3 A;  4BQM A;  2GDN A;  1BTL A;  4F94 A;  3C4P A;  2XH9 A;  3OZH A;  4EUZ A;  2ZC7 A;  2ZMA A;  4FSF A;  3IXH A;  4CPK A;  1BSG A;  4DKI A;  1TDL A;  1MWT A;  1MXO A;  1K6R A;  1MBL A;  3Q7Z A;  3W4O A;  1CEF A;  5E43 A;  3ITA A;  3NIA A;  1NYY A;  1L0G A;  3V50 A;  4IED A;  4WZ5 A;  5CHU A;  4S2P A;  3WS1 A;  1LHY A;  4OLD A;  3BRM A;  4FH2 A;  1BLP A;  5EOO A;  3NBL A;  3WS0 A;  4BD0 A;  5HAQ A;  4K0W A;  1GHI A;  1HD8 A;  1GA9 A;  3W4P A;  4N1H A;  1I5Q A;  4Y0T A;  2ZQA A;  2Y2L A;  4JPM A;  2Y2M A;  5E2H A;  5FI7 A;  2Z2L B;  4P0M A;  2ZM2 A;  5EVI D;  1K4F A;  3GR2 A;  5GL9 A;  1ES3 A;  5JYO A;  5J8X A;  4ID4 A;  1Y54 A;  3ZG0 A;  2JE5 A;  1S0W A;  4DE3 A;  4E3J A;  1NXY A;  3GSG A;  4OPY A;  3VP4 A;  2WZZ A;  1GHP A;  1FSW A;  1PWG A;  4OP5 A;  1N9B A;  5HX9 A;  1IYS A;  1EI5 A;  5HW3 A;  2G2W A;  3V3S A;  4RVA A;  2DCF A;  1TDG A;  3PBQ A;  5AQA A;  3PAE A;  2WGV A;  3NDG A;  1BLS A;  3GTC A;  5GLC A;  4OQH A;  4X69 A;  1CI9 A;  5DF8 A;  3VFF A;  5A93 A;  5DTK A;  1FSY A;  1O7E A;  4E3K A;  4UA9 A;  1TEM A;  1MKI A;  1YLP A;  3SS5 A;  4KEN B;  1G6A A;  5FQJ A;  4EBP A;  2Y2N A;  3HUN A;  4PMA A;  4QHC A;  1KGF A;  5HAR A;  2HPB A;  3BEB A;  2QPN A;  2HP5 A;  2ZQ8 A;  1TVF A;  5EE8 A;  5E2G A;  4LV0 A;  4K91 A;  3VOZ A;  1ES4 A;  2ZLY A;  4N92 A;  4IVI A;  5FA7 A;  1MWR A;  3HLW A;  4E3O A;  3ZHH A;  5CTN A;  2JCH A;  1G68 A;  5FI6 A;  4HBU A;  5KSC A;  3HLB A;  4NK3 A;  4JLF A;  5G18 A;  4GDB A;  1YMX A;  3A3I A;  3N7W A;  4H8R A;  5DF9 A;  3FYZ A;  1YT4 A;  2HDR A;  4GD6 A;  4DXC A;  2X01 A;  4P85 A;  5FI2 A;  4GN2 A;  1MWS A;  4E3M A;  3M2K A;  3BFF A;  1JWV A;  3EQV A;  3FKW A;  3UN7 A;  3QNB A;  1K4E A;  4GOG A;  2IWD A;  4HEF A;  2C5W B;  2ZC5 B;  5CGS A;  5FAT A;  4GNU A;  4QU3 A;  1YMS A;  2WKH A;  3PTE A;  1SCW A;  2WAD A;  1JWP A;  2WGW B;  4BEN A;  1Z6F A;  2A3U A;  1DJC A;  1KE0 A;  5DTS A;  1WYB A;  4LCL A;  4KZ4 A;  1CI8 A;  1IYQ A;  1L0F A;  4X55 A;  4OVD A;  5EOE A;  5DVA A;  2H10 A;  1H5X A;  3A3F A;  5CRF A;  3OPH A;  4S2O A;  4QY5 A;  3ZVW A;  3FV7 A;  3IHB A;  5FQ9 A;  3Q7V A;  3OPR A;  3ZG8 B;  1HTZ A;  4C6Y A;  2Y2O A;  5CGW A;  3JYI A;  1VM1 A;  3GMW A;  1K57 C;  5GHX A;  5EVL A;  4E6W A;  2EXA A;  4MEZ A;  1GHM A;  4Y0U A;  4JXW A;  3UPN A;  3E2K A;  1ES2 A;  4S2I A;  4S2L A;  4MBH A;  3ZG7 B;  3NI9 A;  1E3U A;  1KVL A;  3PBN A;  1YM1 A;  1SKF A;  4RA7 A;  2RL3 A;  2Y59 A;  5U47 A;  1M40 A;  2DNS A;  2EXB A;  3ITB A;  3HLF A;  3MXS A;  4P6B A;  4XUZ A;  4JF6 A;  4KZ6 A;  5D3O A;  2X02 A;  4UHU A;  3EQU A;  4LCM A;  5A90 A;  3IF5 A;  3UY6 A;  1YLJ A;  2G2U A;  3FWL A;  4KQO A;  1FCM A;  2XR0 A;  3MFD A;  2XFT A;  3PBT A;  5HL1 A;  3ZVT A;  1KGE A;  3OC2 A;  3TOI A;  2Y2Q A;  1SDE A;  1W79 A;  2P9V A;  3PBR A;  4PM7 A;  5AQ7 A;  3VSL A;  5KMW A;  1KGG A;  5GLD A;  3S4X A;  1ONG A;  4B4Z A;  3LCE A;  4DDY A;  3A3D A;  1WE4 A;  4ZDX A;  2V2F F;  5FQQ A;  5FDH A;  3MXR A;  2ZM0 A;  3S1Y A;  3VP0 A;  2XGN A;  2ZC3 B;  4N9K A;  4WYY A;  4X56 A;  1DJB A;  2ZM8 A;  3MZD A;  4DE1 A;  4X53 A;  2OLV A;  4OOL A;  1KDS A;  3G32 A;  3HUO A;  3E2L A;  5L2F A;  2C6W B;  2P9V B;  2PU2 A;  5GHZ A;  3SH7 A;  1K38 A;  4ZAM A;  4X68 A;  1BLC A;  3RXX A;  4JF4 A;  5F83 A;  3TG9 A;  4DDS A;  4C3Q A;  3G2Y A;  3VFH A;  4YFM A;  4EV4 A;  3UE3 A;  5F1G A;  5CEB A;  1Q2Q A;  3VP1 A;  3G4P A;  1ZG4 A;  1PIO A;  4XUX A;  2A49 A;  4UA6 A;  1ESU A;  5EVI C;  1RGY A;  3UDF A;  1O07 A;  1BT5 A;  2P74 A;  1NYM A;  2XFS A;  1GCE A;  4MLL A;  2ZQ7 A;  2Y4A A;  4S2K A;  1LI0 A;  1H8Y A;  1PW1 A;  4E3I A;  3AGF A;  3HVF A;  1BUL A;  1E25 A;  4KZ3 A;  4KQQ A;  3BLM A;  1XX2 A;  2V20 A;  1VQQ A;  3HUM A;  4U0T A;  4U3T A;  3CJM A;  1NZO A;  1ZKJ A;  4S2J A;  1K55 A;  1C3B A;  2UWX A;  3G30 A;  2R9W A;  3Q07 A;  3HLG A;  3GV9 A;  2DRW A;  4HBT A;  4OOY A;  1PZO A;  2Y2H A;  4GDN A;  1K57 A;  2Y2G A;  1NZU A;  3AGD A;  3UO9 A;  4L0L A;  4QY6 A;  3ZG9 B;  4Z9Q A;  3IQA A;  4EBL A;  5A92 A;  3ISG A;  2ZQ9 A;  4QD4 A;  3VP2 A;  1RGZ A;  3BFE A;  4EQI A;  4K0X A;  1HVB A;  1CK3 A;  1FCO A;  4WM9 A;  1SHV A;  5CED A;  2Q9M A;  4KG2 A;  1PWC A;  2ZD8 A;  4DF6 A;  1NRF A;  1E3U D;  3LO7 A;  4LV1 A;  4DRT A;  5M19 A;  1ERM A;  4R4S A;  5HFO A;  2WAF A;  1LL5 A;  3DWZ A;  2XD1 A;  2QZ6 A;  3D4F A;  1XGJ A;  2X71 A;  1PZP A;  3HLE A;  5CGX A;  2WK0 A;  2WAE A;  4R1G A;  5FSR A;  4WMC D;  4Y7P A;  3Q82 A;  3HLC A;  3UNW A;  3C7U A;  4ZJ1 A;  5EVI B;  3WRZ A;  1OME A;  3LY4 A;  3PAG A;  4BLM A;  1K54 C;  1PI4 A;  1L0E A;  4FD8 A;  3ZNY A;  3LEZ A;  3RJU A;  3FKV A;  4KZ9 A;  4OON A;  1ERQ A;  2WKE A;  3M6H A;  2PBY A;  3Q81 A;  3IT9 A;  4OKP A;  4MBF A;  2XD5 A;  3O88 A;  3HL9 A;  4O7D A;  3BLS A;  2IWB A;  3DWK A;  1XGI A;  2WZX A;  4U0X A;  1DY6 A;  3A3E A;  1BLH A;  5IHV A;  1K56 D;  1L0D A;  4ZJ3 A;  2H0T A;  4BL2 A;  3V5M A;  1IYP A;  1E4D A;  5EPH A;  1CEG A;  3IWO A;  4KZA A;  3Q7V B;  1N4O A;  1FQG A;  4ZJ2 A;  3O3V A;  2Y55 A;  3ZG5 A;  4DE0 A;  5M18 A;  4DXB A;  2CC1 A;  1YLY A;  4OPZ A;  2XQZ A;  1EWZ A;  2XEP A;  2ZQC A;  3OCN A;  5E2F A;  4D2O A;  4IBX A;  2H0Y A;  4UA7 A;  5DTT A;  2WYX A;  2ZC4 B;  3C7V A;  5TGF A;  3ZDJ A;  3AGE A;  4ZTK A;  4R3B A;  5DF7 A;  1W8Y A;  1YLT A;  3O87 A;  2FFY A;  3NCK A;  3ZGA B;  2OV5 A;  1J9M A;  2EX2 A;  5GLA A;  1ONH A;  1FR6 A;  2PU4 A;  3IWQ A;  3Q1F A;  5KSH A;  5FAS A;  1XA1 A;  1KDW A;  1ZC2 A;  1BZA A;  4R4R A;  3GRJ A;  3A3J A;  4N9L A;  2EX8 A;  1IYO A;  3IH8 A;  2Y2J A;  3SS4 A;  2XK1 A;  3NY4 A;  2VGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...