1KGFA

Structure of beta-lactamase asn 170 gln mutant
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELQYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elimination of the hydrolytic water molecule in a class A beta-lactamase mutant: crystal structure and kinetics.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords BETA-LACTAMASE
total genus 87
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1996-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1kgfA00
5EVIA 3M6HA 3HL9A 4PM9A 1FR1A 4EBNA 1JWPA 3A3EA 1BTLA 3M6BA 1BUEA 5TGFA 1CI9A 1K4EA 1JTDA 3GR2A 3RXXA 5FSRA 1L2SA 5FI2A 2Y2LA 4BD0A 3IH9A 2ZC7A 4E3JA 2QPNA 4E3KA 1SHVA 3W8KA 2WKEA 1MWSA 4OVDA 1Q2QA 1TDLA 3HUNA 4LENA 1XKZA 2ZQ9A 3W4QA 1WE4A 2DRWA 5EOEA 4ID4A 2ZQ8A 1NXYA 1K38A 2Q9NA 3PBOA 5BOHA 4MEZA 3Q07A 3TG9A 1FCMA 3M2KA 2XQZA 3OC2A 1GA0A 5CGSA 3SS3A 3TOIA 1ZKJA 1KGFA 4X53A 4JXVA 3WS4A 1W8QA 4E3LA 5I94A 4FCFA 3HUOA 1BLSA 1NZUA 4HESA 5FQMA 4UHUA 4BLMA 1ES5A 2HPBA 2Y2QA 4KZ5A 4OLDA 1PZOA 4IEDA 4KG6A 5E2HA 1EROA 5AQ7A 1L0GA 4BJPA 4DE2A 2HDRA 3WRTA 2RL3A 3BFCA 4WMCA 3VP1A 3ZCZA 4DDSA 4E3IA 3PBRA 4LV0A 3PBTA 2V2FF 4X68A 5AQ9A 3ZG9B 5GHYA 4OP8A 4UA7A 5CGXA 1KDWA 3WS2A 5DF7A 2Q9MA 5TR7A 2ZMAA 3UDIA 3Q81A 1IYPA 1PW8A 4KG2A 3WS1A 3N6IA 4OP5A 3MZEA 3G34A 3UPPA 1ES3A 4YFMA 5FQKA 5GL9A 4WZ5C 3BFEA 1YLTA 5FQQA 1RGZA 5TFQA 1MKIA 3CJMA 4KQOA 4EUZA 1KE3A 1BULA 5EVID 1K57A 4JLFA 3MFDA 1MXOA 3SH7A 2JC7A 4OQ0A 3HUMA 1M40A 2EX8A 2OSUA 4GD8A 3HLGA 1QMEA 2PU2A 3IH8A 3ZVTA 5M1AA 2J9PA 1ONGA 5CXWA 4JBFA 1JWVA 3IWQA 3VP2A 5CEDA 5CHUA 5CERA 4GKUA 2XEPA 3ZG7B 1C3BA 1FSWA 3WRZA 3B3XA 5EUAA 1WYBA 5HAIA 4K0XA 4E3NA 4RVAA 4LV1A 3HREA 4JXWA 4OLGA 1PWCA 2HP6A 2IWBA 1W79A 5CGWA 1XXMA 4R1GA 4MBHA 2HDQA 2WYXA 1WYCA 4LV2A 4N92A 5FQIA 4B4XA 3MKFA 1TDGA 1YQSA 3OPHA 1ES4A 1XGIA 2H5SA 4WZ5A 5DF9A 5EPHA 3VP0A 1O7EA 2Y2IA 2XDMA 2J8YA 4OKPA 5AQBA 4OPQA 3MZFA 1K25A 4HBTA 4P85A 1FSYA 4WEKA 3LO7A 5GHZA 3UE3A 2FFFB 1JWZA 3ZDJA 5FAOA 4C75A 4KZ9A 5M18A 2JBFA 2X02A 1FCOA 1HVBA 2WAEA 3SS4A 3LY3A 3SH8A 3IXBA 2G2UA 4Y7PA 1MWRA 2ZM2A 2OV5A 2WKHA 3C4PA 4WZ4A 5CHJA 4GDBA 2Y2PA 5FQ9A 3SS5A 1BT5A 1GCEA 2QZ6A 3IXGA 1YLJA 3O88A 5HAPA 1ALQA 2EFUA 5HX9A 3VSKA 4MLLA 4N9LA 1KDSA 2BG1A 4R4RA 1ZC2A 4ZDXA 3MXSA 3HBRA 4KZ6A 4RX3A 2XK1A 3UN7A 5E2FA 3C7UA 3HLEA 1O07A 2Y2MA 2Y4AA 5G18A 1SKFA 4WBGA 5A93A 1KE0A 5GHXA 4QY5A 3VOYA 3IT9A 5EVLA 4JF4A 4MNRA 5EOOA 1H5XA 1YMXA 1GHMA 5FAQA 4OQIA 3V3RA 1S0WA 1S6RA 5EVIB 1U60A 5JYOA 4EWFA 4OPZA 4U0TA 4N9KA 1ERMA 4QY6A 5CTNA 3BYDA 4S2MA 4ZAMA 1N9BA 1N4OA 4N1XA 3QNBA 2OLVA 3NIAA 3ITAA 1PYYA 4R0QA 4DE1A 4Q8IA 3MKEA 1XX2A 4KZBA 2UWXA 4WM9A 1NZOA 4RYEA 4S2NA 5F1GA 3UDFA 3VMAA 2Y59A 2FFYA 5FATA 4S2PA 4EQIA 1Z6FA 2Z2MB 3CMZA 3IWIA 4C3QA 4OPRA 1H8YA 4S2OA 2Y2GA 3SOIA 3ZFZA 3W4OA 3IXDA 1JVJA 2ZLYA 4X69A 3UNWA 4GOGA 2H10A 1PWDA 1PIOA 3LY4A 1LL5A 3GVBA 1MPLA 3UDXA 4S2KA 4Y0TA 3C7VA 3QHYA 4BQMA 2ZJ9A 2EX6A 3UY6A 3WS0A 4GN2A 5E2GA 4DRTA 1YLYA 1ESUA 1G68A 4U3TA 2IWDA 1SDNA 3P09A 2ZQAA 1W5DA 4NETA 4ZJ1A 4E3OA 3Q1FA 2XLNA 4JPMA 1K6RA 4QJGA 1K56A 2IWCA 4ZBEA 1ONHA 2ZM0A 1GA9A 4QU3A 4DXBA 3RXWA 2VGJA 3IF6B 1XP4A 1K4FA 5L2FA 5HL1A 4S2NC 5DTTA 1XA1A 4K91A 3IHAA 1K55A 4R3BA 4QB8A 4DE3A 5GLAA 4LV3A 3IF6C 1VQQA 2Y55A 3BFFA 1YLPA 3G2ZA 1IYSA 2V20A 3Q7VA 3E2LA 4RA7A 2ZC4B 5DF8A 5KZHA 3VFHA 3Q7ZA 3FV7A 2ZD8A 1DY6A 3LEZA 4DDYA 3S4XA 4FH2A 1GHIA 1KGEA 3AGFA 3PBSA 3AGEA 3NC8A 1RGYA 4PM6A 5U47A 4CJNA 5A90A 1OMEA 1PZPA 5KSHA 3FZCA 1FQGA 1HD8A 3BRMA 5EECA 2QMIA 5FDHA 4NK3A 4S2IA 4E3MA 1E3UA 1W7FA 4Y0OA 1VM1A 2DCFA 2P9VA 1K54C 2X71A 5F1FA 1LL9A 2J7VA 4LCMA 3BM6A 3ZHHA 1FCNA 4R3JA 1NJ4A 4N1HA 3CG5A 1HTZA 1I5QA 4K0WA 2EXAA 2ZC5B 1IEMA 2ZC6B 1YLWA 4UA6A 2Y2NA 3UE0A 1LHYA 4JXGA 3AGDA 1AXBA 3ZG0A 4ZTKA 2GDNA 4XXRA 1H8ZA 3W4PA 3ZVWA 1CEFA 4BD1A 3NCKA 1QMFA 1XGJA 4H8RA 2DNSA 1BLHA 5FAPA 4CPKA 2HP5A 3N8SA 3DWZA 1TEMA 2EXBA 2A3UA 3DW0A 3O3VA 2XD5A 2Z2LB 2P74A 4JF6A 4RX2A 2R9WA 3DWKA 1I2WA 2EFXA 3HLWA 4M3KA 2XFTA 4OH0A 2J9OA 4X6TA 1MBLA 1YMSA 4MBKA 3BFDA 3G35A 2VGKA 4F94A 2PU4A 1IELA 1FOFA 4KQQA 3HLCA 3VOZA 1PI4A 4P0MA 4A5RA 4XUZA 3VP4A 5DTKA 4O7DA 3O87A 3UO9A 3PAGA 1Q2PA 1SCWA 4KENB 1PW1A 2I72A 1LI0A 1DJBA 3A3JA 3UPOA 1XPBA 4P87A 2RCXA 1E25A 3NBLA 3IXHA 4L0LA 3ITBA 1BSGA 3BEBA 3OZHA 3PBNA 4R4SA 4KZ3A 3C4OA 1BLPA 5A92A 3OPPA 3UPNA 2WKIA 1ES2A 2Y2OA 5KMWA 4UA9A 3N8LA 3QNCA 4U0XA 2WGWA 3VP3A 1KVLA 1NY0A 1E3UD 2PBYA 2XF3A 4ZJ2A 4JXSA 2P9VB 5FI7A 4OPYA 4PM7A 3V5MA 5CHMA 4KZ4A 2R9XA 5IHVA 1CI8A 4X56A 2WGIA 3M2JA 2ZQ7A 4QD4A 2EX2A 4R23A 4WELA 1MWUA 5E43A 4ZJ3A 3I7JA 3G4PA 2Y2HA 1MY8A 3MXRA 4DF6A 1IKIA 3G31A 3ZGAB 5HW3A 3OPLA 1L0EA 3HLBA 3BLSA 2Y91A 1K57C 2HDUA 4WYYA 4WEJA 2WUQA 2WAFA 4HEFA 1E4DA 3P98A 4B88A 3N7WA 3UE1A 4BL3A 4XUXA 1BLCA 4DKIA 2B5RA 4GNUA 3ZG8B 2H0TA 1L0DA 3N4IA 5AQAA 3FYZA 4PM8A 5D3OA 1MWTA 3RJUA 2CC1A 3NI9A 2ZQDA 5HAQA 5FI6A 2G2WA 1HZOA 1PWGA 1Y54A 2V1ZA 5A91A 4FH4A 2X01A 1BZAA 4X55A 1NRFA 1RCJA 4C6YA 5HFOA 4DXCA 3EQVA 4Z9QA 3G32A 3IQAA 1NYMA 1YT4A 1DJCA 4EBLA 4FSFA 1EI5A 3BFGA 3OCLA 5CECA 3HVFA 2Y2JA 3Q82A 4IBRA 5JYPA 4LCLA 2H0YA 5GLCA 3C5AA 3E2KA 3EQUA 3OCNA 3DTMA 4MBFA 5GLDA 1KE4A 1ZG4A 2XD1A 3HLFA 2WGWB 2BLSA 3A3FA 1CK3A 1IYOA 1ZG6A 2WZXA 4JKTA 4KZ8A 3OPRA 3D4FA 1GHPA 4PM5A 4EV4A 4IVIA 4OQHA 1YLZA 3GRJA 4UAAA 4IVKA 3FKWA 2WZZA 3IF5A 1K54A 1L0FA 4OQGA 4BENA 1YM1A 5CTMA 3MZDA 3PBQA 3V3SA 1XA7A 3GSGA 4GZBA 3N8RA 5FQJA 3V50A 3WS5A 3IHBA 3FWLA 1K56D 5DTSA 1M6KA 4S2JA 4BL2A 5DVAA 3NDGA 1KGGA 3A3IA 3JYIA 5EVIC 1TVFA 1PI5A 2XFSA 2JCHA 1CEGA 3G30A 3CZDA 2XGNA 3NY4A 1LI9A 1LLBA 2XR0A 3FKVA 1KVMA 2ZQCA 1ESIA 1G6AA 3G2YA 3O86A 4S2LA 3TSGA 4FD8A 4OOYA 1J9MA 4QHCA 3IWOA 2A49A 1NYYA 3GV9A 2C5WB 4IBXA 3ZNTA 5FA7A 3WWXA 1IKGA 4Y0UA 3GMWA 3LCEA 3MBZA 3BECA 2XH9A 1EWZA 2E8IA 1K6SA 3V39A 4DE0A 1ERQA 3HLDA 4D2OA 3SH9A 2WADA 4KZAA 1DJAA 4HBUA 1SDEA 4OOLA 1W8YA 4GDNA 4PPRA 4JF5A 5F83A 4EBPA 3VFFA 3PTEA 3GTCA 4OOMA 2JE5A 3ISGA 3Q7VB 4WMCD 1JTGA 2EX9A 3ZG5A 2OLUA 3S1YA 4E6XA 3A3DA 3PAEA 4GD6A 5E2EA 4KQRA 2HP9A 4KZ7A 4PMAA 3VSLA 3BLMA 2Y2KA 4GB7A 4YINA 3GQZA 5FASA 3IF6A 1RP5A 5EE8A 2ZC3B 4B4ZA 5HARA 4E6WA 1I2SA 5J8XA 1FR6A 5KSCA 1K55C 1IYQA 4KG5A 4OONA 2WGVA 3NDEA 2WK0A 3S22A 2ZM8A 5CEBA 3ZNYA 5M19A 2HDSA 2C6WB 5F82A 5GLBA 4P6BA 5CRFA
chains in the Genus database with same CATH superfamily
3M6HA 4PM9A 1FR1A 4EBNA 3A3EA 2PT7A 3CITA 3LI8A 4P6ZM 3LIDA 5LBRA 1P9RA 3NOPC 1W63M 1K4EA 4BBVA 3RXXA 1TS0A 3E4PA 2ZC7A 3CUEC 3D9YA 4D60A 5TBMB 1NXYA 1K38A 3OC2A 3TOIA 3SS3A 3EWKA 4JXVA 5CX7A 3HUOA 1BLSA 5G4ZA 2VA0A 3LYXA 2Y2QA 1EROA 5AQ7A 4DE2A 2FH5A 3BFCA 3CWFA 3PBTA 3ZG9B 5CGXA 1ODVA 2Q9MA 2J3WA 5TR7A 1PW8A 1VETA 3MZEA 1BYWA 4WZ5C 1BULA 3D72A 5EVID 4IHQA 2OSUA 2GNXA 5M1AA 2J9PA 5CEDA 1C3BA 1FSWA 4MCWA 4NKPA 4LV1A 3HREA 4OLGA 1PWCA 1W79A 4UEYA 3LICA 2HDQA 3PHYA 4HOIA 1WYCA 1H0MA 4N92A 3R7WB 1YQSA 1NLZA 4MMNA 5EPHA 2XDMA 4KUKA 2WKQA 3LR5A 1DP9A 5GHZA 2O99A 3S7OA 3ZDJA 5M18A 3CAXA 2X02A 2G2UA 1MWRA 2P7JA 2WKHA 4WZ4A 2Y2PA 2VK3A 5HPFA 2QZ6A 3GDIA 4I3AA 4L9FA 3O88A 5HAPA 2L1MA 4MLLA 2BG1A 4ZDXA 4KZ6A 5E2FA 1TS8A 2Y4AA 4WBGA 3VOLA 3KSHA 4PHTA 5EVLA 4JF4A 2VLGA 5FEFA 1YMXA 3KX0X 3V3RA 2D02A 3MSHA 1S0WA 1U60A 5JYOA 3UB6A 4N9KA 4QY6A 4GHIA 1N9BA 4N1XA 3NIAA 4HJ4A 4CLCA 4R0QA 1CQAA 3MKEA 3T4TA 1VEUB 3EEHA 2XA7M 4S2NA 5FATA 4S2PA 2ZOHA 4C3QA 4I3JA 1XJ2A 4X69A 3BJNA 1PIOA 3NOUC 2GJ3A 4S2KA 5L10A 3T4QA 2ZJ9A 3E4QA 3UY6A 4GN2A 4PAUA 3HCYA 1YLYA 3T4KA 4U3TA 1W5DA 4NETA 2IWCA 1GA9A 1VETB 1XP4A 4HNBA 2B95A 4S2NC 1XA1A 3IHAA 1K55A 4DE3A 2JKGA 4LV3A 3KYZA 2Y55A 3BFFA 1YLPA 1IYSA 3A0VA 4RA7A 5KZHA 1P97A 2PYRA 3FV7A 1TS6A 3AGFA 1KGEA 3PBSA 4PM6A 3AGEA 1RGYA 5KSHA 2QJ5A 2QMIA 4NK3A 2J7VA 4R3JA 1GSVA 4HY8A 1NJ4A 4N1HA 1HTZA 4K0WA 3UE0A 3GECA 1AXBA 4ZTKA 4X1MA 2DNSA 1BLHA 4GLQA 1TEMA 3T4LA 1MC0A 1VEUA 2P74A 2W3FA 3DWKA 1I2WA 3HLWA 4OH0A 3BFDA 3G35A 2VGKA 1S66L 1IELA 1FOFA 4ETZA 3CHWP 3TE8A 5DTKA 3MQOA 3T12B 3VE3A 1Q2PA 1J3WA 4EW7A 4LRXC 3T4JA 4Y3IA 3A3JA 1V9ZA 3C2WA 3H82A 4HH2A 2WGWA 4I38A 1E3UD 4ZJ2A 4JXSA 4NEED 1OTBA 5K5BA 5CHMA 2GX5A 4X56A 2ZQ7A 4QD4A 2MJ6A 3RTYA 3IX8A 2Z6DA 1IKIA 5HW3A 3OPLA 3BLSA 1K57C 5HL6A 2XROA 4WYYA 3PR6A 2XA7S 1JNUA 4G3VA 3NECA 1BLCA 4LRZE 1G28A 2VZWA 4JGOA 2DMWA 4PM8A 2CC1A 3NI9A 5C5KA 1Y54A 4I39A 4HP9A 1NRFA 3SZTA 1YT4A 1DJCA 4EBLA 4HQAA 3BFGA 4IBRA 4LCLA 3IX4A 4MBFA 1KE4A 3HJKA 1D7EA 3OPRA 5FDSA 4CLCB 3D4FA 5J7EA 4WF0A 2B02A 3FKWA 3OLOA 4OQGA 4MDZA 4Y2FA 1YM1A 5CTMA 1XA7A 3GSGA 1DRMA 3WS5A 3IHBA 3FWLA 5DTSA 3NDGA 4ARZB 4I3IA 2XFSA 1PI5A 2VKSA 2JCHA 1CEGA 2O9AA 4WUJA 2ZQCA 4FD8A 2OAP1 1J9MA 2A49A 2C5WB 5KIZA 4L9GA 1IKGA 3HJIA 3LCEA 5A8BA 1EWZA 2VV8A 1K6SA 3KO6A 4DE0A 3SH9A 1NWZA 4KZAA 1S4SA 4HBUA 5FL3A 2GZAA 1N9NA 2XRNA 3UB9A 3VFFA 3PTEA 1S67L 4OOMA 2JE5A 4E04A 1Y4OA 2EX9A 2IA2A 2J3TC 4EESA 2HP9A 4KZ7A 3BLMA 5FASA 4XT2A 4E6WA 5HARA 5KSCA 5J8XA 3L9KA 4KG5A 2HDSA 3G2YA 3HL9A 1JWPA 2Z6CA 1BTLA 1CJFA 3W2ZA 4F3LB 1JTDA 3GR2A 5HDCA 4E3JA 5HWTA 4E3KA 2WKEA 1Q2QA 4LENA 2DRWA 2HJ9C 2ZQ8A 2Q9NA 4MEZA 3Q07A 1FCMA 3M2KA 1GA0A 4G3KA 3DTEA 3WS4A 1KGFA 5I94A 4M4XA 1NZUA 3JVVA 4HI4A 4UHUA 3SW1A 1N9OA 3NULA 4IEDA 4KG6A 1L0GA 3BWLA 3WRTA 2J3TD 4JGPA 4WMCA 4BMWA 4LV0A 2V2FF 2ZL1B 3T4SA 2HGVA 4DJ2A 2ZMAA 3UPPA 2R78A 5FQKA 5GL9A 1YLTA 1RGZA 3CJMA 1G6OA 3MFDA 1M40A 3DTIA 3H82B 4GJ4A 5CXWA 1IFQA 5CERA 1OTDA 5TBMA 5CGWA 1XXMA 1OTAA 1P0ZA 4LV2A 4B4XA 3MKFA 4HP4A 4Y17A 5MC7A 5IT5A 2ZMFA 4JGRA 4LLOB 4Y15A 4OKPA 4P85A 1FSYA 4Z1WA 3LO7A 3UE3A 1PNEA 3E0YA 3QP2A 1HVBA 3SH8A 4NXFA 1NRJA 2OV5A 3C4PA 4GDBA 2JKTI 3SS5A 1BT5A 1GCEA 3IXGA 4I5SA 5HX9A 5F5YA 1YKDA 3MXSA 2K7SA 3C7UA 2V8FA 1O07A 3HLEA 3QP6A 2VGLM 1SKFA 3CUEA 4DJ3A 4MNRA 2BTFP 5F69A 5FAQA 4OQIA 5CTNA 2VGLS 4ZAMA 2A24B 2OLVA 4R70A 3ITAA 1PYYA 4DE1A 3C38A 1YAXA 2W27A 1NZOA 4HJ6A 1Z6FA 2Z2MB 1XFQA 1H8YA 2Y2GA 3ZFZA 3IXDA 1JVJA 3UDXA 3LIAA 3QHYA 2PRFA 2W1TB 2EX6A 3EGXC 4NXEA 2W3HA 3K2NA 3VV4A 3ZQ5A 4ZJ1A 1S1YA 3Q1FA 1K6RA 4QJGA 1K56A 4ESPA 4ZBEA 4O8GA 2VGJA 3LEQA 4MN5A 3VE4A 4AFIA 5L2FA 4R3AA 4QB8A 3IF6C 4JGQA 2K2NA 2ZC4B 3VFHA 3Q7ZA 2ZD8A 1DY6A 3LEZA 3S4XA 4FH2A 4EXOA 3RH8B 2O9CA 3NC8A 1FILA 2VV6A 3FZCA 3BRMA 3MR0A 5J4EA 1AWIA 5FDHA 1W7FA 2WKPA 2P9VA 4EETB 1K54C 4LCMA 1FCNA 3CG5A 5F6AA 2ZC5B 2W1TA 1YLWA 2LB9A 1LHYA 1F9IA 4JXGA 3AGDA 3CLOA 3ZG0A 2GDNA 3W4PA 3IS2B 1QMFA 4H8RA 2AVXA 5FAPA 3N8SA 3DWZA 3DW0A 2I9VA 2EFXA 5HDDA 2CMNA 2PU4A 3FPWA 3HLCA 3VOZA 4P0MA 4A5RA 1X0OA 3O87A 3PAGA 3IX3A 3F1NA 2I72A 4XT2B 4Q0JA 1LI0A 2O9BA 2L4RA 1BSGA 3OZHA 3P01A 3OPPA 3UPNA 2Y2OA 3DBAA 1Z09A 5KMWA 3VP3A 3IS2A 4GS9B 1ZHHB 2NUTC 4PM7A 3TW8A 1D06A 5E43A 4BWIA 4DF6A 1MY8A 4GCZA 3MQQA 4FOFA 4YOFA 1E4DA 3P98A 4B88A 3N7WA 3UB8A 2L0WA 2JKFA 4DKIA 3ZG8B 4MN6A 1L0DA 4IUKA 5I5LA 3RJUA 3UMEA 5FI6A 2ZMVA 4FH4A 4IUHA 2X01A 1BZAA 1RCJA 5HFOA 1NYMA 3P7NA 5CECA 2Y2JA 3Q82A 5GLCA 3EQUA 3DTMA 1ZG4A 3HLFA 3E4OA 2WGWB 2WZXA 4JKTA 4KZ8A 1GHPA 4PM5A 4IVIA 3FG8A 4G3WA 2WZZA 3FPVA 1ACFA 1UWNX 3MZDA 4L9EA 3N8RA 1K56D 1M6KA 4S2JA 5F68A 1PRQA 3JYIA 5EVIC 1ZTUA 1TVFA 1DP8A 1LLBA 4Q0IA 1G6AA 4KQDA 2W3DA 3IWOA 3GV9A 1S1ZA 3WWXA 4Y0UA 3GMWA 3MBZA 3F1PB 2XH9A 5HDSA 2E8IA 4EUVA 1OT6A 5DFXA 5HD3A 3NJAA 4CQHA 3F1OA 2V0UA 1SDEA 2Y79A 1TF1A 4UQIS 3GTCA 4X25A 3MF0A 1JTGA 5G4YA 2YKHA 4KQRA 4PMAA 4GB7A 3GQZA 4B4ZA 2ZC3B 1IYQA 2WGVA 3TJZC 3T1XA 1HLUP 5M19A 5J3WA 4P6BA 3CI6A 4BBUA 4FUWA 3M6BA 1BUEA 5FSRA 3RFBA 2Y2LA 4BD0A 4PKYG 1SHVA 3W8KA 1MWSA 1XKZA 2ZQ9A 3W4QA 1WE4A 5EOEA 4LRYC 3TG9A 3UE6A 4Y13A 5CGSA 4E3LA 4HESA 3UMDA 4QWOA 2HPBA 4OLDA 1PZOA 5E2HA 4CLCC 2E8JA 5HWWA 1OPXA 4H6JB 4DMZA 2RL3A 3VP1A 1OT9A 3PBRA 2INWA 4X68A 5AQ9A 5GHYA 2QYBA 1KDWA 5DF7A 1T1BA 3UDIA 3Q81A 2JKRI 3N6IA 5L07A 3G34A 1ES3A 4YFMA 5FQQA 4KQOA 5AVEA 4EUZA 1KE3A 1K57A 4JLFA 3SH7A 2JC7A 4OQ0A 2EX8A 1F2KA 2JKTM 3IH8A 3LGOA 4PKYA 1ONGA 2QJ7A 1OJ5A 4JBFA 1JWVA 3IWQA 2VV7A 1A0KA 2P08A 3WRZA 3B3XA 5EUAA 1T18A 4K0XA 4RVAA 3H7WB 3S7QA 1LSXA 2OOLA 4MBHA 2HJEA 5FQIA 3PYPA 1SKOA 4EU0A 1XGIA 5DF9A 5EM0A 3VP0A 1O7EA 2Y2IA 2J8YA 5AQBA 1W63Q 1K25A 4HBTA 4WEKA 1LSWA 1Y28A 3T1QB 2FFFB 5FAOA 4KZ9A 2JBFA 1FCOA 2WAEA 3SS4A 3LY3A 4Y7PA 2ZM2A 1STZA 5FQ9A 2ZOIA 3VSKA 4R4RA 1L3LA 3U4LP 3IBRA 3HBRA 1MZUA 4WL9A 3KSGA 1VHMA 5G18A 5HWVA 5GHXA 4LGWA 3VOYA 3IT9A 1WA9A 5EOOA 1H5XA 5EVIB 1T19A 4U0TA 1ERMA 4S2MA 1N4OA 1G5UA 4Q8IA 3KYQA 2HZ5A 2UWXA 4RYEA 3VMAA 2FFYA 3IWIA 2OWHA 2PYPA 3SOIA 2PHYA 3UNWA 4GOGA 3LY4A 1LL5A 3GVBA 1XJ3A 3FC7A 1H3QA 3C7VA 4BQMA 5E2GA 4DRTA 3OBFA 4X1LA 1ESUA 1SDNA 4E3OA 2ZQAA 2XLNA 3QP4A 4JPMA 3MQ0A 2JN7A 3B33A 4QU3A 3IF6B 1K4FA 5HL1A 2PR6A 5DTTA 4H6JA 2VX8A 5GLAA 3LI9A 3G2ZA 2V20A 3Q7VA 3E2LA 5DF8A 3EOIA 3EEAA 1GHIA 5U47A 1V9YA 2UV0E 3MS6A 1FQGA 1HD8A 5EECA 4E3MA 4S2IA 2B18A 1VM1A 4Y0OA 4II7A 2WKRA 1LL9A 3BM6A 3ZHHA 3D3OA 1I5QA 2EXAA 1IEMA 4UA6A 4EEUA 4XXRA 3ZVWA 4BD1A 3NCKA 1XGJA 1LL8A 1FIKA 4CPKA 2HP5A 4GW9A 3BY9A 2Z2LB 4JF6A 2Q0OA 4X6TA 2R9WA 3NHQA 4LPZA 1MBLA 1YMSA 4MBKA 4NXGA 5HSQA 4F94A 5EVEA 1TD5A 3UO9A 5HPIA 5L8MA 3T1RA 2EWVA 3OOVA 4KENB 5L09A 4P87A 1E25A 2A2LA 3IXHA 4L0LA 3BEBA 4KZ3A 3C4OA 2WKIA 1ES2A 3QNCA 4HHDA 4U0XA 3LIFA 2OWJA 1KVLA 1NY0A 2PBYA 4OPYA 3BW6A 4KZ4A 3T50A 1CI8A 5DJUA 3NOTC 2WGIA 4R23A 4ZJ3A 1UWPX 1MWUA 3I7JA 4ZRRA 3G31A 3ZGAB 2V1BA 4WLAA 2HDUA 4RQ9A 5HZHA 2ZL1A 4WEJA 4P6ZS 2WAFA 4HEFA 5DJTA 4BL3A 4XUXA 1P9WA 1SKOB 5DFYA 4GNUA 5AQAA 3TRCA 1MWTA 3V67A 1HZOA 1PWGA 3T4OA 5A91A 3U2AA 1T1AA 4R6LA 5DKLA 4Z9QA 3G32A 4FSFA 5JYPA 3C5AA 3LUQA 5GLDA 1OTEA 4EQ1A 2XD1A 3CPTA 3A3FA 3K3CA 1IYOA 1ZG6A 4F3LA 2BASA 4OQHA 4CLCE 2G7UA 2V0WA 4UAAA 4IVKA 3IF5A 3V3SA 4HIAA 3V50A 4GZBA 1EW0A 3DAVA 2M1CA 2KLIA 5DVAA 3BQ8A 4GHIB 2W0NA 1CF0A 3R7WA 3DTKA 2W3EA 3E98A 1F98A 2XR0A 3O86A 3TSGA 3KYEA 4QHCA 2PAVP 1NYYA 3ZNTA 3LIBA 1OTIA 3BECA 1S4RA 3V39A 1XJ4A 2WADA 1W8YA 4GDNA 5F83A 2LB5A 3QP8A 3Q7VB 3ISGA 3ZG5A 3S1YA 3PAEA 4GD6A 1TS7A 5IS1A 3VSLA 2Y2KA 3IF6A 4O01A 5EE8A 4ARZA 2EA9A 1I2SA 1FR6A 1T1CA 3QP1A 1VB6A 2WK0A 3S22A 3ZNYA 2C6WB 5F82A 5EVIA 3LFVA 3CPTB 4B9OA 5TGFA 1CI9A 2JKRM 1F5MA 1L2SA 5FI2A 1D1JA 3ZYTA 3IH9A 4ETXA 2QPNA 2HV1A 4OVDA 1SZVA 1TDLA 3HUNA 4ID4A 3PBOA 3F1PA 5BOHA 2XQZA 1ZKJA 2J80A 4X53A 1W8QA 4FCFA 5FQMA 4BLMA 1ES5A 3T1SA 4KZ5A 3KSIA 4BJPA 4ME4A 2HDRA 2QWSA 4DDSA 3ZCZA 4E3IA 4OP8A 4UA7A 3WS2A 3B47A 1IYPA 4KG2A 3WS1A 5IU1A 3A0SA 4OP5A 1KOUA 2V8CA 3BFEA 5TFQA 1MKIA 3LIEA 2PDRA 1H8MA 1MXOA 3HUMA 4GD8A 3HLGA 3JVUA 1QMEA 2PU2A 3O5YA 1GSWA 3ZVTA 2PD8A 3VP2A 5CHUA 4GKUA 5AJGA 2XEPA 3ZG7B 1WYBA 5HAIA 4E3NA 4JXWA 5FEGA 2HP6A 2IWBA 3MMHA 4R1GA 1PFLA 3ULFA 2WYXA 4CLCD 2KOIA 2PBDP 1TDGA 1GSXA 4YNRA 3OPHA 1ES4A 2H5SA 1XFNA 4WZ5A 3H7WA 4OPQA 1DP6A 3MZFA 1JWZA 2M7VA 4NG2A 4C75A 1UGUA 2ACGA 4R38A 3IXBA 2FZ0A 2Y8HA 3A0RA 5CHJA 4GS9A 1YLJA 1ALQA 2QKPA 2EFUA 4N9LA 1KDSA 1ZC2A 4RX3A 2XK1A 3UN7A 2Y2MA 5A93A 2D01A 1KE0A 4QY5A 1YPRA 3MJQA 1GHMA 1S6RA 4EWFA 4OPZA 1LT0A 3BYDA 5EFWA 3QNBA 1IOUA 4YWZA 2VEAA 1XX2A 4KZBA 3JPUA 4WM9A 5F1GA 3UDFA 2Y59A 4EQIA 3CMZA 4OPRA 4S2OA 2QHKA 3W4OA 2ZLYA 2NUPC 2H10A 1PWDA 1MPLA 4Y0TA 3WS0A 3PXPA 1G68A 2IWDA 3ICYA 3P09A 4NXBA 4QPRA 1ONHA 2ZM0A 1YSPA 4DXBA 3RXWA 1YSQA 1XJ6A 4B93A 2ZBBA 3C30A 4K91A 4R3BA 1VQQA 4DN0A 4DDYA 5A90A 4O0PA 3S7NA 4CJNA 1OMEA 1PZPA 2A24A 1E3UA 3BY8A 2DCFA 5F1FA 2X71A 4FTXA 2W1RA 2K31A 2ZC6B 2VJWA 2Y2NA 3IBJA 1H8ZA 1CEFA 2KDKA 4EERA 2EXBA 2A3UA 3O3VA 2XD5A 3R4KA 4RX2A 4M3KA 2XFTA 2J9OA 2YKFA 4KQQA 3EGDC 1PI4A 2H28A 4XUZA 3VP4A 3LR3A 4UQIM 4BBTA 4O7DA 2OAQ1 3B42A 5DKKA 1SCWA 1PW1A 1DJBA 3UPOA 1XPBA 3F1NB 2RCXA 3NBLA 5TJJA 3ITBA 3PBNA 4R4SA 1BLPA 4EEPA 5A92A 1N9LA 4UA9A 3N8LA 4KUOA 2XF3A 2EWWA 5EV0A 2P9VB 5FI7A 3V5MA 3H9WA 2R9XA 5IHVA 3M2JA 2EX2A 4WELA 3G4PA 2Y2HA 3MXRA 3C8CA 1L0EA 3HLBA 2Y91A 2WUQA 4Q0HA 3UE1A 4WN5A 4MN7A 2O0YA 2B5RA 1MKMA 5EM1A 2H0TA 3BQAA 3N4IA 3L7HA 3FYZA 5D3OA 5AVFA 2PR5A 2ZQDA 5HAQA 2G2WA 2V1ZA 4X55A 4C6YA 3S7PA 4DXCA 3EQVA 3IQAA 1EI5A 3OCLA 3HVFA 2V9AA 2H0YA 3OCNA 3E2KA 4K08A 4Y5FA 3KSFA 2BLSA 1CK3A 3G6OA 4EV4A 1OJGA 2V1AA 1YLZA 3GRJA 3MFXA 2P04A 1K54A 1L0FA 4BENA 3PBQA 2M7UA 5FQJA 2KX6A 2HF6A 2W3GA 4BL2A 5HD5A 1KGGA 3A3IA 3QP5A 3G30A 1LSVA 3CZDA 2XGNA 3NY4A 1LI9A 3FKVA 1KVMA 3LR4A 1ESIA 4S2LA 1NLYA 4OOYA 4IBXA 3MXQA 5FA7A 1ERQA 3HLDA 4D2OA 3UB5P 1DJAA 4OOLA 4EBPA 4PPRA 4JF5A 3F1OB 3K3DA 4WMCD 3LR0A 2OLUA 1K0KA 4E6XA 3A3DA 3UB7A 5E2EA 2XSSA 4YINA 1RP5A 2PD7A 1K55C 4HH3A 4IJGA 4OONA 4LFUA 3NDEA 2JHEA 2ZM8A 5CEBA 5GLBA 4HJ3A 5CRFA
chains in the Genus database with same CATH topology
5EVIA 3M6HA 3HL9A 4PM9A 1FR1A 4EBNA 1JWPA 3A3EA 1BTLA 3M6BA 1BUEA 5TGFA 1CI9A 1K4EA 1JTDA 3GR2A 3RXXA 5FSRA 1L2SA 5FI2A 2Y2LA 4BD0A 3IH9A 2ZC7A 4E3JA 2QPNA 4E3KA 1SHVA 3W8KA 2WKEA 1MWSA 4OVDA 1Q2QA 1TDLA 3HUNA 4LENA 1XKZA 2ZQ9A 3W4QA 1WE4A 2DRWA 5EOEA 4ID4A 2ZQ8A 1NXYA 1K38A 2Q9NA 3PBOA 5BOHA 4MEZA 3Q07A 3TG9A 1FCMA 3M2KA 2XQZA 3OC2A 1GA0A 5CGSA 3SS3A 3TOIA 1ZKJA 1KGFA 4X53A 4JXVA 3WS4A 1W8QA 4E3LA 5I94A 4FCFA 3HUOA 1BLSA 1NZUA 4HESA 5FQMA 4UHUA 4BLMA 1ES5A 2HPBA 2Y2QA 4KZ5A 4OLDA 1PZOA 4IEDA 4KG6A 5E2HA 1EROA 5AQ7A 1L0GA 4BJPA 4DE2A 2HDRA 3WRTA 2RL3A 3BFCA 4WMCA 3VP1A 3ZCZA 4DDSA 4E3IA 3PBRA 4LV0A 3PBTA 2V2FF 4X68A 5AQ9A 3ZG9B 5GHYA 4OP8A 4UA7A 5CGXA 1KDWA 3WS2A 5DF7A 2Q9MA 5TR7A 2ZMAA 3UDIA 3Q81A 1IYPA 1PW8A 4KG2A 3WS1A 3N6IA 4OP5A 3MZEA 3G34A 3UPPA 1ES3A 4YFMA 5FQKA 5GL9A 4WZ5C 3BFEA 1YLTA 5FQQA 1RGZA 5TFQA 1MKIA 3CJMA 4KQOA 4EUZA 1KE3A 1BULA 5EVID 1K57A 4JLFA 3MFDA 1MXOA 3SH7A 2JC7A 4OQ0A 3HUMA 1M40A 2EX8A 2OSUA 4GD8A 3HLGA 1QMEA 2PU2A 3IH8A 3ZVTA 5M1AA 2J9PA 1ONGA 5CXWA 4JBFA 1JWVA 3IWQA 3VP2A 5CEDA 5CHUA 5CERA 4GKUA 2XEPA 3ZG7B 1C3BA 1FSWA 3WRZA 3B3XA 5EUAA 1WYBA 5HAIA 4K0XA 4E3NA 4RVAA 4LV1A 3HREA 4JXWA 4OLGA 1PWCA 2HP6A 2IWBA 1W79A 5CGWA 1XXMA 4R1GA 4MBHA 2HDQA 2WYXA 1WYCA 4LV2A 4N92A 5FQIA 4B4XA 3MKFA 1TDGA 1YQSA 3OPHA 1ES4A 1XGIA 2H5SA 4WZ5A 5DF9A 5EPHA 3VP0A 1O7EA 2Y2IA 2XDMA 2J8YA 4OKPA 5AQBA 4OPQA 3MZFA 1K25A 4HBTA 4P85A 1FSYA 4WEKA 3LO7A 5GHZA 3UE3A 2FFFB 1JWZA 3ZDJA 5FAOA 4C75A 4KZ9A 5M18A 2JBFA 2X02A 1FCOA 1HVBA 2WAEA 3SS4A 3LY3A 3SH8A 3IXBA 2G2UA 4Y7PA 1MWRA 2ZM2A 2OV5A 2WKHA 3C4PA 4WZ4A 5CHJA 4GDBA 2Y2PA 5FQ9A 3SS5A 1BT5A 1GCEA 2QZ6A 3IXGA 1YLJA 3O88A 5HAPA 1ALQA 2EFUA 5HX9A 3VSKA 4MLLA 4N9LA 1KDSA 2BG1A 4R4RA 1ZC2A 4ZDXA 3MXSA 3HBRA 4KZ6A 4RX3A 2XK1A 3UN7A 5E2FA 3C7UA 3HLEA 1O07A 2Y2MA 2Y4AA 5G18A 1SKFA 4WBGA 5A93A 1KE0A 5GHXA 4QY5A 3VOYA 3IT9A 5EVLA 4JF4A 4MNRA 5EOOA 1H5XA 1YMXA 1GHMA 5FAQA 4OQIA 3V3RA 1S0WA 1S6RA 5EVIB 1U60A 5JYOA 4EWFA 4OPZA 4U0TA 4N9KA 1ERMA 4QY6A 5CTNA 3BYDA 4S2MA 4ZAMA 1N9BA 1N4OA 4N1XA 3QNBA 2OLVA 3NIAA 3ITAA 1PYYA 4R0QA 4DE1A 4Q8IA 3MKEA 1XX2A 4KZBA 2UWXA 4WM9A 1NZOA 4RYEA 4S2NA 5F1GA 3UDFA 3VMAA 2Y59A 2FFYA 5FATA 4S2PA 4EQIA 1Z6FA 2Z2MB 3CMZA 3IWIA 4C3QA 4OPRA 1H8YA 4S2OA 2Y2GA 3SOIA 3ZFZA 3W4OA 3IXDA 1JVJA 2ZLYA 4X69A 3UNWA 4GOGA 2H10A 1PWDA 1PIOA 3LY4A 1LL5A 3GVBA 1MPLA 3UDXA 4S2KA 4Y0TA 3C7VA 3QHYA 4BQMA 2ZJ9A 2EX6A 3UY6A 3WS0A 4GN2A 5E2GA 4DRTA 1YLYA 1ESUA 1G68A 4U3TA 2IWDA 1SDNA 3P09A 2ZQAA 1W5DA 4NETA 4ZJ1A 4E3OA 3Q1FA 2XLNA 4JPMA 1K6RA 4QJGA 1K56A 2IWCA 4ZBEA 1ONHA 2ZM0A 1GA9A 4QU3A 4DXBA 3RXWA 2VGJA 3IF6B 1XP4A 1K4FA 5L2FA 5HL1A 4S2NC 5DTTA 1XA1A 4K91A 3IHAA 1K55A 4R3BA 4QB8A 4DE3A 5GLAA 4LV3A 3IF6C 1VQQA 2Y55A 3BFFA 1YLPA 3G2ZA 1IYSA 2V20A 3Q7VA 3E2LA 4RA7A 2ZC4B 5DF8A 5KZHA 3VFHA 3Q7ZA 3FV7A 2ZD8A 1DY6A 3LEZA 4DDYA 3S4XA 4FH2A 1GHIA 1KGEA 3AGFA 3PBSA 3AGEA 3NC8A 1RGYA 4PM6A 5U47A 4CJNA 5A90A 1OMEA 1PZPA 5KSHA 3FZCA 1FQGA 1HD8A 3BRMA 5EECA 2QMIA 5FDHA 4NK3A 4S2IA 4E3MA 1E3UA 1W7FA 4Y0OA 1VM1A 2DCFA 2P9VA 1K54C 2X71A 5F1FA 1LL9A 2J7VA 4LCMA 3BM6A 3ZHHA 1FCNA 4R3JA 1NJ4A 4N1HA 3CG5A 1HTZA 1I5QA 4K0WA 2EXAA 2ZC5B 1IEMA 2ZC6B 1YLWA 4UA6A 2Y2NA 3UE0A 1LHYA 4JXGA 3AGDA 1AXBA 3ZG0A 4ZTKA 2GDNA 4XXRA 1H8ZA 3W4PA 3ZVWA 1CEFA 4BD1A 3NCKA 1QMFA 1XGJA 4H8RA 2DNSA 1BLHA 5FAPA 4CPKA 2HP5A 3N8SA 3DWZA 1TEMA 2EXBA 2A3UA 3DW0A 3O3VA 2XD5A 2Z2LB 2P74A 4JF6A 4RX2A 2R9WA 3DWKA 1I2WA 2EFXA 3HLWA 4M3KA 2XFTA 4OH0A 2J9OA 4X6TA 1MBLA 1YMSA 4MBKA 3BFDA 3G35A 2VGKA 4F94A 2PU4A 1IELA 1FOFA 4KQQA 3HLCA 3VOZA 1PI4A 4P0MA 4A5RA 4XUZA 3VP4A 5DTKA 4O7DA 3O87A 3UO9A 3PAGA 1Q2PA 1SCWA 4KENB 1PW1A 2I72A 1LI0A 1DJBA 3A3JA 3UPOA 1XPBA 4P87A 2RCXA 1E25A 3NBLA 3IXHA 4L0LA 3ITBA 1BSGA 3BEBA 3OZHA 3PBNA 4R4SA 4KZ3A 3C4OA 1BLPA 5A92A 3OPPA 3UPNA 2WKIA 1ES2A 2Y2OA 5KMWA 4UA9A 3N8LA 3QNCA 4U0XA 2WGWA 3VP3A 1KVLA 1NY0A 1E3UD 2PBYA 2XF3A 4ZJ2A 4JXSA 2P9VB 5FI7A 4OPYA 4PM7A 3V5MA 5CHMA 4KZ4A 2R9XA 5IHVA 1CI8A 4X56A 2WGIA 3M2JA 2ZQ7A 4QD4A 2EX2A 4R23A 4WELA 1MWUA 5E43A 4ZJ3A 3I7JA 3G4PA 2Y2HA 1MY8A 3MXRA 4DF6A 1IKIA 3G31A 3ZGAB 5HW3A 3OPLA 1L0EA 3HLBA 3BLSA 2Y91A 1K57C 2HDUA 4WYYA 4WEJA 2WUQA 2WAFA 4HEFA 1E4DA 3P98A 4B88A 3N7WA 3UE1A 4BL3A 4XUXA 1BLCA 4DKIA 2B5RA 4GNUA 3ZG8B 2H0TA 1L0DA 3N4IA 5AQAA 3FYZA 4PM8A 5D3OA 1MWTA 3RJUA 2CC1A 3NI9A 2ZQDA 5HAQA 5FI6A 2G2WA 1HZOA 1PWGA 1Y54A 2V1ZA 5A91A 4FH4A 2X01A 1BZAA 4X55A 1NRFA 1RCJA 4C6YA 5HFOA 4DXCA 3EQVA 4Z9QA 3G32A 3IQAA 1NYMA 1YT4A 1DJCA 4EBLA 4FSFA 1EI5A 3BFGA 3OCLA 5CECA 3HVFA 2Y2JA 3Q82A 4IBRA 5JYPA 4LCLA 2H0YA 5GLCA 3C5AA 3E2KA 3EQUA 3OCNA 3DTMA 4MBFA 5GLDA 1KE4A 1ZG4A 2XD1A 3HLFA 2WGWB 2BLSA 3A3FA 1CK3A 1IYOA 1ZG6A 2WZXA 4JKTA 4KZ8A 3OPRA 3D4FA 1GHPA 4PM5A 4EV4A 4IVIA 4OQHA 1YLZA 3GRJA 4UAAA 4IVKA 3FKWA 2WZZA 3IF5A 1K54A 1L0FA 4OQGA 4BENA 1YM1A 5CTMA 3MZDA 3PBQA 3V3SA 1XA7A 3GSGA 4GZBA 3N8RA 5FQJA 3V50A 3WS5A 3IHBA 3FWLA 1K56D 5DTSA 1M6KA 4S2JA 4BL2A 5DVAA 3NDGA 1KGGA 3A3IA 3JYIA 5EVIC 1TVFA 1PI5A 2XFSA 2JCHA 1CEGA 3G30A 3CZDA 2XGNA 3NY4A 1LI9A 1LLBA 2XR0A 3FKVA 1KVMA 2ZQCA 1ESIA 1G6AA 3G2YA 3O86A 4S2LA 3TSGA 4FD8A 4OOYA 1J9MA 4QHCA 3IWOA 2A49A 1NYYA 3GV9A 2C5WB 4IBXA 3ZNTA 5FA7A 3WWXA 1IKGA 4Y0UA 3GMWA 3LCEA 3MBZA 3BECA 2XH9A 1EWZA 2E8IA 1K6SA 3V39A 4DE0A 1ERQA 3HLDA 4D2OA 3SH9A 2WADA 4KZAA 1DJAA 4HBUA 1SDEA 4OOLA 1W8YA 4GDNA 4PPRA 4JF5A 5F83A 4EBPA 3VFFA 3PTEA 3GTCA 4OOMA 2JE5A 3ISGA 3Q7VB 4WMCD 1JTGA 2EX9A 3ZG5A 2OLUA 3S1YA 4E6XA 3A3DA 3PAEA 4GD6A 5E2EA 4KQRA 2HP9A 4KZ7A 4PMAA 3VSLA 3BLMA 2Y2KA 4GB7A 4YINA 3GQZA 5FASA 3IF6A 1RP5A 5EE8A 2ZC3B 4B4ZA 5HARA 4E6WA 1I2SA 5J8XA 1FR6A 5KSCA 1K55C 1IYQA 4KG5A 4OONA 2WGVA 3NDEA 2WK0A 3S22A 2ZM8A 5CEBA 3ZNYA 5M19A 2HDSA 2C6WB 5F82A 5GLBA 4P6BA 5CRFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EVI A;  3M6H A;  3HL9 A;  4PM9 A;  1FR1 A;  4EBN A;  1JWP A;  3A3E A;  1BTL A;  3M6B A;  1BUE A;  5TGF A;  1CI9 A;  1K4E A;  1JTD A;  3GR2 A;  3RXX A;  5FSR A;  1L2S A;  5FI2 A;  2Y2L A;  4BD0 A;  3IH9 A;  2ZC7 A;  4E3J A;  2QPN A;  4E3K A;  1SHV A;  3W8K A;  2WKE A;  1MWS A;  4OVD A;  1Q2Q A;  1TDL A;  3HUN A;  4LEN A;  1XKZ A;  2ZQ9 A;  3W4Q A;  1WE4 A;  2DRW A;  5EOE A;  4ID4 A;  2ZQ8 A;  1NXY A;  1K38 A;  2Q9N A;  3PBO A;  5BOH A;  4MEZ A;  3Q07 A;  3TG9 A;  1FCM A;  3M2K A;  2XQZ A;  3OC2 A;  1GA0 A;  5CGS A;  3SS3 A;  3TOI A;  1ZKJ A;  1KGF A;  4X53 A;  4JXV A;  3WS4 A;  1W8Q A;  4E3L A;  5I94 A;  4FCF A;  3HUO A;  1BLS A;  1NZU A;  4HES A;  5FQM A;  4UHU A;  4BLM A;  1ES5 A;  2HPB A;  2Y2Q A;  4KZ5 A;  4OLD A;  1PZO A;  4IED A;  4KG6 A;  5E2H A;  1ERO A;  5AQ7 A;  1L0G A;  4BJP A;  4DE2 A;  2HDR A;  3WRT A;  2RL3 A;  3BFC A;  4WMC A;  3VP1 A;  3ZCZ A;  4DDS A;  4E3I A;  3PBR A;  4LV0 A;  3PBT A;  2V2F F;  4X68 A;  5AQ9 A;  3ZG9 B;  5GHY A;  4OP8 A;  4UA7 A;  5CGX A;  1KDW A;  3WS2 A;  5DF7 A;  2Q9M A;  5TR7 A;  2ZMA A;  3UDI A;  3Q81 A;  1IYP A;  1PW8 A;  4KG2 A;  3WS1 A;  3N6I A;  4OP5 A;  3MZE A;  3G34 A;  3UPP A;  1ES3 A;  4YFM A;  5FQK A;  5GL9 A;  4WZ5 C;  3BFE A;  1YLT A;  5FQQ A;  1RGZ A;  5TFQ A;  1MKI A;  3CJM A;  4KQO A;  4EUZ A;  1KE3 A;  1BUL A;  5EVI D;  1K57 A;  4JLF A;  3MFD A;  1MXO A;  3SH7 A;  2JC7 A;  4OQ0 A;  3HUM A;  1M40 A;  2EX8 A;  2OSU A;  4GD8 A;  3HLG A;  1QME A;  2PU2 A;  3IH8 A;  3ZVT A;  5M1A A;  2J9P A;  1ONG A;  5CXW A;  4JBF A;  1JWV A;  3IWQ A;  3VP2 A;  5CED A;  5CHU A;  5CER A;  4GKU A;  2XEP A;  3ZG7 B;  1C3B A;  1FSW A;  3WRZ A;  3B3X A;  5EUA A;  1WYB A;  5HAI A;  4K0X A;  4E3N A;  4RVA A;  4LV1 A;  3HRE A;  4JXW A;  4OLG A;  1PWC A;  2HP6 A;  2IWB A;  1W79 A;  5CGW A;  1XXM A;  4R1G A;  4MBH A;  2HDQ A;  2WYX A;  1WYC A;  4LV2 A;  4N92 A;  5FQI A;  4B4X A;  3MKF A;  1TDG A;  1YQS A;  3OPH A;  1ES4 A;  1XGI A;  2H5S A;  4WZ5 A;  5DF9 A;  5EPH A;  3VP0 A;  1O7E A;  2Y2I A;  2XDM A;  2J8Y A;  4OKP A;  5AQB A;  4OPQ A;  3MZF A;  1K25 A;  4HBT A;  4P85 A;  1FSY A;  4WEK A;  3LO7 A;  5GHZ A;  3UE3 A;  2FFF B;  1JWZ A;  3ZDJ A;  5FAO A;  4C75 A;  4KZ9 A;  5M18 A;  2JBF A;  2X02 A;  1FCO A;  1HVB A;  2WAE A;  3SS4 A;  3LY3 A;  3SH8 A;  3IXB A;  2G2U A;  4Y7P A;  1MWR A;  2ZM2 A;  2OV5 A;  2WKH A;  3C4P A;  4WZ4 A;  5CHJ A;  4GDB A;  2Y2P A;  5FQ9 A;  3SS5 A;  1BT5 A;  1GCE A;  2QZ6 A;  3IXG A;  1YLJ A;  3O88 A;  5HAP A;  1ALQ A;  2EFU A;  5HX9 A;  3VSK A;  4MLL A;  4N9L A;  1KDS A;  2BG1 A;  4R4R A;  1ZC2 A;  4ZDX A;  3MXS A;  3HBR A;  4KZ6 A;  4RX3 A;  2XK1 A;  3UN7 A;  5E2F A;  3C7U A;  3HLE A;  1O07 A;  2Y2M A;  2Y4A A;  5G18 A;  1SKF A;  4WBG A;  5A93 A;  1KE0 A;  5GHX A;  4QY5 A;  3VOY A;  3IT9 A;  5EVL A;  4JF4 A;  4MNR A;  5EOO A;  1H5X A;  1YMX A;  1GHM A;  5FAQ A;  4OQI A;  3V3R A;  1S0W A;  1S6R A;  5EVI B;  1U60 A;  5JYO A;  4EWF A;  4OPZ A;  4U0T A;  4N9K A;  1ERM A;  4QY6 A;  5CTN A;  3BYD A;  4S2M A;  4ZAM A;  1N9B A;  1N4O A;  4N1X A;  3QNB A;  2OLV A;  3NIA A;  3ITA A;  1PYY A;  4R0Q A;  4DE1 A;  4Q8I A;  3MKE A;  1XX2 A;  4KZB A;  2UWX A;  4WM9 A;  1NZO A;  4RYE A;  4S2N A;  5F1G A;  3UDF A;  3VMA A;  2Y59 A;  2FFY A;  5FAT A;  4S2P A;  4EQI A;  1Z6F A;  2Z2M B;  3CMZ A;  3IWI A;  4C3Q A;  4OPR A;  1H8Y A;  4S2O A;  2Y2G A;  3SOI A;  3ZFZ A;  3W4O A;  3IXD A;  1JVJ A;  2ZLY A;  4X69 A;  3UNW A;  4GOG A;  2H10 A;  1PWD A;  1PIO A;  3LY4 A;  1LL5 A;  3GVB A;  1MPL A;  3UDX A;  4S2K A;  4Y0T A;  3C7V A;  3QHY A;  4BQM A;  2ZJ9 A;  2EX6 A;  3UY6 A;  3WS0 A;  4GN2 A;  5E2G A;  4DRT A;  1YLY A;  1ESU A;  1G68 A;  4U3T A;  2IWD A;  1SDN A;  3P09 A;  2ZQA A;  1W5D A;  4NET A;  4ZJ1 A;  4E3O A;  3Q1F A;  2XLN A;  4JPM A;  1K6R A;  4QJG A;  1K56 A;  2IWC A;  4ZBE A;  1ONH A;  2ZM0 A;  1GA9 A;  4QU3 A;  4DXB A;  3RXW A;  2VGJ A;  3IF6 B;  1XP4 A;  1K4F A;  5L2F A;  5HL1 A;  4S2N C;  5DTT A;  1XA1 A;  4K91 A;  3IHA A;  1K55 A;  4R3B A;  4QB8 A;  4DE3 A;  5GLA A;  4LV3 A;  3IF6 C;  1VQQ A;  2Y55 A;  3BFF A;  1YLP A;  3G2Z A;  1IYS A;  2V20 A;  3Q7V A;  3E2L A;  4RA7 A;  2ZC4 B;  5DF8 A;  5KZH A;  3VFH A;  3Q7Z A;  3FV7 A;  2ZD8 A;  1DY6 A;  3LEZ A;  4DDY A;  3S4X A;  4FH2 A;  1GHI A;  1KGE A;  3AGF A;  3PBS A;  3AGE A;  3NC8 A;  1RGY A;  4PM6 A;  5U47 A;  4CJN A;  5A90 A;  1OME A;  1PZP A;  5KSH A;  3FZC A;  1FQG A;  1HD8 A;  3BRM A;  5EEC A;  2QMI A;  5FDH A;  4NK3 A;  4S2I A;  4E3M A;  1E3U A;  1W7F A;  4Y0O A;  1VM1 A;  2DCF A;  2P9V A;  1K54 C;  2X71 A;  5F1F A;  1LL9 A;  2J7V A;  4LCM A;  3BM6 A;  3ZHH A;  1FCN A;  4R3J A;  1NJ4 A;  4N1H A;  3CG5 A;  1HTZ A;  1I5Q A;  4K0W A;  2EXA A;  2ZC5 B;  1IEM A;  2ZC6 B;  1YLW A;  4UA6 A;  2Y2N A;  3UE0 A;  1LHY A;  4JXG A;  3AGD A;  1AXB A;  3ZG0 A;  4ZTK A;  2GDN A;  4XXR A;  1H8Z A;  3W4P A;  3ZVW A;  1CEF A;  4BD1 A;  3NCK A;  1QMF A;  1XGJ A;  4H8R A;  2DNS A;  1BLH A;  5FAP A;  4CPK A;  2HP5 A;  3N8S A;  3DWZ A;  1TEM A;  2EXB A;  2A3U A;  3DW0 A;  3O3V A;  2XD5 A;  2Z2L B;  2P74 A;  4JF6 A;  4RX2 A;  2R9W A;  3DWK A;  1I2W A;  2EFX A;  3HLW A;  4M3K A;  2XFT A;  4OH0 A;  2J9O A;  4X6T A;  1MBL A;  1YMS A;  4MBK A;  3BFD A;  3G35 A;  2VGK A;  4F94 A;  2PU4 A;  1IEL A;  1FOF A;  4KQQ A;  3HLC A;  3VOZ A;  1PI4 A;  4P0M A;  4A5R A;  4XUZ A;  3VP4 A;  5DTK A;  4O7D A;  3O87 A;  3UO9 A;  3PAG A;  1Q2P A;  1SCW A;  4KEN B;  1PW1 A;  2I72 A;  1LI0 A;  1DJB A;  3A3J A;  3UPO A;  1XPB A;  4P87 A;  2RCX A;  1E25 A;  3NBL A;  3IXH A;  4L0L A;  3ITB A;  1BSG A;  3BEB A;  3OZH A;  3PBN A;  4R4S A;  4KZ3 A;  3C4O A;  1BLP A;  5A92 A;  3OPP A;  3UPN A;  2WKI A;  1ES2 A;  2Y2O A;  5KMW A;  4UA9 A;  3N8L A;  3QNC A;  4U0X A;  2WGW A;  3VP3 A;  1KVL A;  1NY0 A;  1E3U D;  2PBY A;  2XF3 A;  4ZJ2 A;  4JXS A;  2P9V B;  5FI7 A;  4OPY A;  4PM7 A;  3V5M A;  5CHM A;  4KZ4 A;  2R9X A;  5IHV A;  1CI8 A;  4X56 A;  2WGI A;  3M2J A;  2ZQ7 A;  4QD4 A;  2EX2 A;  4R23 A;  4WEL A;  1MWU A;  5E43 A;  4ZJ3 A;  3I7J A;  3G4P A;  2Y2H A;  1MY8 A;  3MXR A;  4DF6 A;  1IKI A;  3G31 A;  3ZGA B;  5HW3 A;  3OPL A;  1L0E A;  3HLB A;  3BLS A;  2Y91 A;  1K57 C;  2HDU A;  4WYY A;  4WEJ A;  2WUQ A;  2WAF A;  4HEF A;  1E4D A;  3P98 A;  4B88 A;  3N7W A;  3UE1 A;  4BL3 A;  4XUX A;  1BLC A;  4DKI A;  2B5R A;  4GNU A;  3ZG8 B;  2H0T A;  1L0D A;  3N4I A;  5AQA A;  3FYZ A;  4PM8 A;  5D3O A;  1MWT A;  3RJU A;  2CC1 A;  3NI9 A;  2ZQD A;  5HAQ A;  5FI6 A;  2G2W A;  1HZO A;  1PWG A;  1Y54 A;  2V1Z A;  5A91 A;  4FH4 A;  2X01 A;  1BZA A;  4X55 A;  1NRF A;  1RCJ A;  4C6Y A;  5HFO A;  4DXC A;  3EQV A;  4Z9Q A;  3G32 A;  3IQA A;  1NYM A;  1YT4 A;  1DJC A;  4EBL A;  4FSF A;  1EI5 A;  3BFG A;  3OCL A;  5CEC A;  3HVF A;  2Y2J A;  3Q82 A;  4IBR A;  5JYP A;  4LCL A;  2H0Y A;  5GLC A;  3C5A A;  3E2K A;  3EQU A;  3OCN A;  3DTM A;  4MBF A;  5GLD A;  1KE4 A;  1ZG4 A;  2XD1 A;  3HLF A;  2WGW B;  2BLS A;  3A3F A;  1CK3 A;  1IYO A;  1ZG6 A;  2WZX A;  4JKT A;  4KZ8 A;  3OPR A;  3D4F A;  1GHP A;  4PM5 A;  4EV4 A;  4IVI A;  4OQH A;  1YLZ A;  3GRJ A;  4UAA A;  4IVK A;  3FKW A;  2WZZ A;  3IF5 A;  1K54 A;  1L0F A;  4OQG A;  4BEN A;  1YM1 A;  5CTM A;  3MZD A;  3PBQ A;  3V3S A;  1XA7 A;  3GSG A;  4GZB A;  3N8R A;  5FQJ A;  3V50 A;  3WS5 A;  3IHB A;  3FWL A;  1K56 D;  5DTS A;  1M6K A;  4S2J A;  4BL2 A;  5DVA A;  3NDG A;  1KGG A;  3A3I A;  3JYI A;  5EVI C;  1TVF A;  1PI5 A;  2XFS A;  2JCH A;  1CEG A;  3G30 A;  3CZD A;  2XGN A;  3NY4 A;  1LI9 A;  1LLB A;  2XR0 A;  3FKV A;  1KVM A;  2ZQC A;  1ESI A;  1G6A A;  3G2Y A;  3O86 A;  4S2L A;  3TSG A;  4FD8 A;  4OOY A;  1J9M A;  4QHC A;  3IWO A;  2A49 A;  1NYY A;  3GV9 A;  2C5W B;  4IBX A;  3ZNT A;  5FA7 A;  3WWX A;  1IKG A;  4Y0U A;  3GMW A;  3LCE A;  3MBZ A;  3BEC A;  2XH9 A;  1EWZ A;  2E8I A;  1K6S A;  3V39 A;  4DE0 A;  1ERQ A;  3HLD A;  4D2O A;  3SH9 A;  2WAD A;  4KZA A;  1DJA A;  4HBU A;  1SDE A;  4OOL A;  1W8Y A;  4GDN A;  4PPR A;  4JF5 A;  5F83 A;  4EBP A;  3VFF A;  3PTE A;  3GTC A;  4OOM A;  2JE5 A;  3ISG A;  3Q7V B;  4WMC D;  1JTG A;  2EX9 A;  3ZG5 A;  2OLU A;  3S1Y A;  4E6X A;  3A3D A;  3PAE A;  4GD6 A;  5E2E A;  4KQR A;  2HP9 A;  4KZ7 A;  4PMA A;  3VSL A;  3BLM A;  2Y2K A;  4GB7 A;  4YIN A;  3GQZ A;  5FAS A;  3IF6 A;  1RP5 A;  5EE8 A;  2ZC3 B;  4B4Z A;  5HAR A;  4E6W A;  1I2S A;  5J8X A;  1FR6 A;  5KSC A;  1K55 C;  1IYQ A;  4KG5 A;  4OON A;  2WGV A;  3NDE A;  2WK0 A;  3S22 A;  2ZM8 A;  5CEB A;  3ZNY A;  5M19 A;  2HDS A;  2C6W B;  5F82 A;  5GLB A;  4P6B A;  5CRF A; 
#chains in the Genus database with same CATH topology
 3M6H A;  4PM9 A;  1FR1 A;  4EBN A;  3A3E A;  2PT7 A;  3CIT A;  3LI8 A;  4P6Z M;  3LID A;  5LBR A;  1P9R A;  3NOP C;  1W63 M;  1K4E A;  4BBV A;  3RXX A;  1TS0 A;  3E4P A;  2ZC7 A;  3CUE C;  3D9Y A;  4D60 A;  5TBM B;  1NXY A;  1K38 A;  3OC2 A;  3TOI A;  3SS3 A;  3EWK A;  4JXV A;  5CX7 A;  3HUO A;  1BLS A;  5G4Z A;  2VA0 A;  3LYX A;  2Y2Q A;  1ERO A;  5AQ7 A;  4DE2 A;  2FH5 A;  3BFC A;  3CWF A;  3PBT A;  3ZG9 B;  5CGX A;  1ODV A;  2Q9M A;  2J3W A;  5TR7 A;  1PW8 A;  1VET A;  3MZE A;  1BYW A;  4WZ5 C;  1BUL A;  3D72 A;  5EVI D;  4IHQ A;  2OSU A;  2GNX A;  5M1A A;  2J9P A;  5CED A;  1C3B A;  1FSW A;  4MCW A;  4NKP A;  4LV1 A;  3HRE A;  4OLG A;  1PWC A;  1W79 A;  4UEY A;  3LIC A;  2HDQ A;  3PHY A;  4HOI A;  1WYC A;  1H0M A;  4N92 A;  3R7W B;  1YQS A;  1NLZ A;  4MMN A;  5EPH A;  2XDM A;  4KUK A;  2WKQ A;  3LR5 A;  1DP9 A;  5GHZ A;  2O99 A;  3S7O A;  3ZDJ A;  5M18 A;  3CAX A;  2X02 A;  2G2U A;  1MWR A;  2P7J A;  2WKH A;  4WZ4 A;  2Y2P A;  2VK3 A;  5HPF A;  2QZ6 A;  3GDI A;  4I3A A;  4L9F A;  3O88 A;  5HAP A;  2L1M A;  4MLL A;  2BG1 A;  4ZDX A;  4KZ6 A;  5E2F A;  1TS8 A;  2Y4A A;  4WBG A;  3VOL A;  3KSH A;  4PHT A;  5EVL A;  4JF4 A;  2VLG A;  5FEF A;  1YMX A;  3KX0 X;  3V3R A;  2D02 A;  3MSH A;  1S0W A;  1U60 A;  5JYO A;  3UB6 A;  4N9K A;  4QY6 A;  4GHI A;  1N9B A;  4N1X A;  3NIA A;  4HJ4 A;  4CLC A;  4R0Q A;  1CQA A;  3MKE A;  3T4T A;  1VEU B;  3EEH A;  2XA7 M;  4S2N A;  5FAT A;  4S2P A;  2ZOH A;  4C3Q A;  4I3J A;  1XJ2 A;  4X69 A;  3BJN A;  1PIO A;  3NOU C;  2GJ3 A;  4S2K A;  5L10 A;  3T4Q A;  2ZJ9 A;  3E4Q A;  3UY6 A;  4GN2 A;  4PAU A;  3HCY A;  1YLY A;  3T4K A;  4U3T A;  1W5D A;  4NET A;  2IWC A;  1GA9 A;  1VET B;  1XP4 A;  4HNB A;  2B95 A;  4S2N C;  1XA1 A;  3IHA A;  1K55 A;  4DE3 A;  2JKG A;  4LV3 A;  3KYZ A;  2Y55 A;  3BFF A;  1YLP A;  1IYS A;  3A0V A;  4RA7 A;  5KZH A;  1P97 A;  2PYR A;  3FV7 A;  1TS6 A;  3AGF A;  1KGE A;  3PBS A;  4PM6 A;  3AGE A;  1RGY A;  5KSH A;  2QJ5 A;  2QMI A;  4NK3 A;  2J7V A;  4R3J A;  1GSV A;  4HY8 A;  1NJ4 A;  4N1H A;  1HTZ A;  4K0W A;  3UE0 A;  3GEC A;  1AXB A;  4ZTK A;  4X1M A;  2DNS A;  1BLH A;  4GLQ A;  1TEM A;  3T4L A;  1MC0 A;  1VEU A;  2P74 A;  2W3F A;  3DWK A;  1I2W A;  3HLW A;  4OH0 A;  3BFD A;  3G35 A;  2VGK A;  1S66 L;  1IEL A;  1FOF A;  4ETZ A;  3CHW P;  3TE8 A;  5DTK A;  3MQO A;  3T12 B;  3VE3 A;  1Q2P A;  1J3W A;  4EW7 A;  4LRX C;  3T4J A;  4Y3I A;  3A3J A;  1V9Z A;  3C2W A;  3H82 A;  4HH2 A;  2WGW A;  4I38 A;  1E3U D;  4ZJ2 A;  4JXS A;  4NEE D;  1OTB A;  5K5B A;  5CHM A;  2GX5 A;  4X56 A;  2ZQ7 A;  4QD4 A;  2MJ6 A;  3RTY A;  3IX8 A;  2Z6D A;  1IKI A;  5HW3 A;  3OPL A;  3BLS A;  1K57 C;  5HL6 A;  2XRO A;  4WYY A;  3PR6 A;  2XA7 S;  1JNU A;  4G3V A;  3NEC A;  1BLC A;  4LRZ E;  1G28 A;  2VZW A;  4JGO A;  2DMW A;  4PM8 A;  2CC1 A;  3NI9 A;  5C5K A;  1Y54 A;  4I39 A;  4HP9 A;  1NRF A;  3SZT A;  1YT4 A;  1DJC A;  4EBL A;  4HQA A;  3BFG A;  4IBR A;  4LCL A;  3IX4 A;  4MBF A;  1KE4 A;  3HJK A;  1D7E A;  3OPR A;  5FDS A;  4CLC B;  3D4F A;  5J7E A;  4WF0 A;  2B02 A;  3FKW A;  3OLO A;  4OQG A;  4MDZ A;  4Y2F A;  1YM1 A;  5CTM A;  1XA7 A;  3GSG A;  1DRM A;  3WS5 A;  3IHB A;  3FWL A;  5DTS A;  3NDG A;  4ARZ B;  4I3I A;  2XFS A;  1PI5 A;  2VKS A;  2JCH A;  1CEG A;  2O9A A;  4WUJ A;  2ZQC A;  4FD8 A;  2OAP 1;  1J9M A;  2A49 A;  2C5W B;  5KIZ A;  4L9G A;  1IKG A;  3HJI A;  3LCE A;  5A8B A;  1EWZ A;  2VV8 A;  1K6S A;  3KO6 A;  4DE0 A;  3SH9 A;  1NWZ A;  4KZA A;  1S4S A;  4HBU A;  5FL3 A;  2GZA A;  1N9N A;  2XRN A;  3UB9 A;  3VFF A;  3PTE A;  1S67 L;  4OOM A;  2JE5 A;  4E04 A;  1Y4O A;  2EX9 A;  2IA2 A;  2J3T C;  4EES A;  2HP9 A;  4KZ7 A;  3BLM A;  5FAS A;  4XT2 A;  4E6W A;  5HAR A;  5KSC A;  5J8X A;  3L9K A;  4KG5 A;  2HDS A;  3G2Y A;  3HL9 A;  1JWP A;  2Z6C A;  1BTL A;  1CJF A;  3W2Z A;  4F3L B;  1JTD A;  3GR2 A;  5HDC A;  4E3J A;  5HWT A;  4E3K A;  2WKE A;  1Q2Q A;  4LEN A;  2DRW A;  2HJ9 C;  2ZQ8 A;  2Q9N A;  4MEZ A;  3Q07 A;  1FCM A;  3M2K A;  1GA0 A;  4G3K A;  3DTE A;  3WS4 A;  1KGF A;  5I94 A;  4M4X A;  1NZU A;  3JVV A;  4HI4 A;  4UHU A;  3SW1 A;  1N9O A;  3NUL A;  4IED A;  4KG6 A;  1L0G A;  3BWL A;  3WRT A;  2J3T D;  4JGP A;  4WMC A;  4BMW A;  4LV0 A;  2V2F F;  2ZL1 B;  3T4S A;  2HGV A;  4DJ2 A;  2ZMA A;  3UPP A;  2R78 A;  5FQK A;  5GL9 A;  1YLT A;  1RGZ A;  3CJM A;  1G6O A;  3MFD A;  1M40 A;  3DTI A;  3H82 B;  4GJ4 A;  5CXW A;  1IFQ A;  5CER A;  1OTD A;  5TBM A;  5CGW A;  1XXM A;  1OTA A;  1P0Z A;  4LV2 A;  4B4X A;  3MKF A;  4HP4 A;  4Y17 A;  5MC7 A;  5IT5 A;  2ZMF A;  4JGR A;  4LLO B;  4Y15 A;  4OKP A;  4P85 A;  1FSY A;  4Z1W A;  3LO7 A;  3UE3 A;  1PNE A;  3E0Y A;  3QP2 A;  1HVB A;  3SH8 A;  4NXF A;  1NRJ A;  2OV5 A;  3C4P A;  4GDB A;  2JKT I;  3SS5 A;  1BT5 A;  1GCE A;  3IXG A;  4I5S A;  5HX9 A;  5F5Y A;  1YKD A;  3MXS A;  2K7S A;  3C7U A;  2V8F A;  1O07 A;  3HLE A;  3QP6 A;  2VGL M;  1SKF A;  3CUE A;  4DJ3 A;  4MNR A;  2BTF P;  5F69 A;  5FAQ A;  4OQI A;  5CTN A;  2VGL S;  4ZAM A;  2A24 B;  2OLV A;  4R70 A;  3ITA A;  1PYY A;  4DE1 A;  3C38 A;  1YAX A;  2W27 A;  1NZO A;  4HJ6 A;  1Z6F A;  2Z2M B;  1XFQ A;  1H8Y A;  2Y2G A;  3ZFZ A;  3IXD A;  1JVJ A;  3UDX A;  3LIA A;  3QHY A;  2PRF A;  2W1T B;  2EX6 A;  3EGX C;  4NXE A;  2W3H A;  3K2N A;  3VV4 A;  3ZQ5 A;  4ZJ1 A;  1S1Y A;  3Q1F A;  1K6R A;  4QJG A;  1K56 A;  4ESP A;  4ZBE A;  4O8G A;  2VGJ A;  3LEQ A;  4MN5 A;  3VE4 A;  4AFI A;  5L2F A;  4R3A A;  4QB8 A;  3IF6 C;  4JGQ A;  2K2N A;  2ZC4 B;  3VFH A;  3Q7Z A;  2ZD8 A;  1DY6 A;  3LEZ A;  3S4X A;  4FH2 A;  4EXO A;  3RH8 B;  2O9C A;  3NC8 A;  1FIL A;  2VV6 A;  3FZC A;  3BRM A;  3MR0 A;  5J4E A;  1AWI A;  5FDH A;  1W7F A;  2WKP A;  2P9V A;  4EET B;  1K54 C;  4LCM A;  1FCN A;  3CG5 A;  5F6A A;  2ZC5 B;  2W1T A;  1YLW A;  2LB9 A;  1LHY A;  1F9I A;  4JXG A;  3AGD A;  3CLO A;  3ZG0 A;  2GDN A;  3W4P A;  3IS2 B;  1QMF A;  4H8R A;  2AVX A;  5FAP A;  3N8S A;  3DWZ A;  3DW0 A;  2I9V A;  2EFX A;  5HDD A;  2CMN A;  2PU4 A;  3FPW A;  3HLC A;  3VOZ A;  4P0M A;  4A5R A;  1X0O A;  3O87 A;  3PAG A;  3IX3 A;  3F1N A;  2I72 A;  4XT2 B;  4Q0J A;  1LI0 A;  2O9B A;  2L4R A;  1BSG A;  3OZH A;  3P01 A;  3OPP A;  3UPN A;  2Y2O A;  3DBA A;  1Z09 A;  5KMW A;  3VP3 A;  3IS2 A;  4GS9 B;  1ZHH B;  2NUT C;  4PM7 A;  3TW8 A;  1D06 A;  5E43 A;  4BWI A;  4DF6 A;  1MY8 A;  4GCZ A;  3MQQ A;  4FOF A;  4YOF A;  1E4D A;  3P98 A;  4B88 A;  3N7W A;  3UB8 A;  2L0W A;  2JKF A;  4DKI A;  3ZG8 B;  4MN6 A;  1L0D A;  4IUK A;  5I5L A;  3RJU A;  3UME A;  5FI6 A;  2ZMV A;  4FH4 A;  4IUH A;  2X01 A;  1BZA A;  1RCJ A;  5HFO A;  1NYM A;  3P7N A;  5CEC A;  2Y2J A;  3Q82 A;  5GLC A;  3EQU A;  3DTM A;  1ZG4 A;  3HLF A;  3E4O A;  2WGW B;  2WZX A;  4JKT A;  4KZ8 A;  1GHP A;  4PM5 A;  4IVI A;  3FG8 A;  4G3W A;  2WZZ A;  3FPV A;  1ACF A;  1UWN X;  3MZD A;  4L9E A;  3N8R A;  1K56 D;  1M6K A;  4S2J A;  5F68 A;  1PRQ A;  3JYI A;  5EVI C;  1ZTU A;  1TVF A;  1DP8 A;  1LLB A;  4Q0I A;  1G6A A;  4KQD A;  2W3D A;  3IWO A;  3GV9 A;  1S1Z A;  3WWX A;  4Y0U A;  3GMW A;  3MBZ A;  3F1P B;  2XH9 A;  5HDS A;  2E8I A;  4EUV A;  1OT6 A;  5DFX A;  5HD3 A;  3NJA A;  4CQH A;  3F1O A;  2V0U A;  1SDE A;  2Y79 A;  1TF1 A;  4UQI S;  3GTC A;  4X25 A;  3MF0 A;  1JTG A;  5G4Y A;  2YKH A;  4KQR A;  4PMA A;  4GB7 A;  3GQZ A;  4B4Z A;  2ZC3 B;  1IYQ A;  2WGV A;  3TJZ C;  3T1X A;  1HLU P;  5M19 A;  5J3W A;  4P6B A;  3CI6 A;  4BBU A;  4FUW A;  3M6B A;  1BUE A;  5FSR A;  3RFB A;  2Y2L A;  4BD0 A;  4PKY G;  1SHV A;  3W8K A;  1MWS A;  1XKZ A;  2ZQ9 A;  3W4Q A;  1WE4 A;  5EOE A;  4LRY C;  3TG9 A;  3UE6 A;  4Y13 A;  5CGS A;  4E3L A;  4HES A;  3UMD A;  4QWO A;  2HPB A;  4OLD A;  1PZO A;  5E2H A;  4CLC C;  2E8J A;  5HWW A;  1OPX A;  4H6J B;  4DMZ A;  2RL3 A;  3VP1 A;  1OT9 A;  3PBR A;  2INW A;  4X68 A;  5AQ9 A;  5GHY A;  2QYB A;  1KDW A;  5DF7 A;  1T1B A;  3UDI A;  3Q81 A;  2JKR I;  3N6I A;  5L07 A;  3G34 A;  1ES3 A;  4YFM A;  5FQQ A;  4KQO A;  5AVE A;  4EUZ A;  1KE3 A;  1K57 A;  4JLF A;  3SH7 A;  2JC7 A;  4OQ0 A;  2EX8 A;  1F2K A;  2JKT M;  3IH8 A;  3LGO A;  4PKY A;  1ONG A;  2QJ7 A;  1OJ5 A;  4JBF A;  1JWV A;  3IWQ A;  2VV7 A;  1A0K A;  2P08 A;  3WRZ A;  3B3X A;  5EUA A;  1T18 A;  4K0X A;  4RVA A;  3H7W B;  3S7Q A;  1LSX A;  2OOL A;  4MBH A;  2HJE A;  5FQI A;  3PYP A;  1SKO A;  4EU0 A;  1XGI A;  5DF9 A;  5EM0 A;  3VP0 A;  1O7E A;  2Y2I A;  2J8Y A;  5AQB A;  1W63 Q;  1K25 A;  4HBT A;  4WEK A;  1LSW A;  1Y28 A;  3T1Q B;  2FFF B;  5FAO A;  4KZ9 A;  2JBF A;  1FCO A;  2WAE A;  3SS4 A;  3LY3 A;  4Y7P A;  2ZM2 A;  1STZ A;  5FQ9 A;  2ZOI A;  3VSK A;  4R4R A;  1L3L A;  3U4L P;  3IBR A;  3HBR A;  1MZU A;  4WL9 A;  3KSG A;  1VHM A;  5G18 A;  5HWV A;  5GHX A;  4LGW A;  3VOY A;  3IT9 A;  1WA9 A;  5EOO A;  1H5X A;  5EVI B;  1T19 A;  4U0T A;  1ERM A;  4S2M A;  1N4O A;  1G5U A;  4Q8I A;  3KYQ A;  2HZ5 A;  2UWX A;  4RYE A;  3VMA A;  2FFY A;  3IWI A;  2OWH A;  2PYP A;  3SOI A;  2PHY A;  3UNW A;  4GOG A;  3LY4 A;  1LL5 A;  3GVB A;  1XJ3 A;  3FC7 A;  1H3Q A;  3C7V A;  4BQM A;  5E2G A;  4DRT A;  3OBF A;  4X1L A;  1ESU A;  1SDN A;  4E3O A;  2ZQA A;  2XLN A;  3QP4 A;  4JPM A;  3MQ0 A;  2JN7 A;  3B33 A;  4QU3 A;  3IF6 B;  1K4F A;  5HL1 A;  2PR6 A;  5DTT A;  4H6J A;  2VX8 A;  5GLA A;  3LI9 A;  3G2Z A;  2V20 A;  3Q7V A;  3E2L A;  5DF8 A;  3EOI A;  3EEA A;  1GHI A;  5U47 A;  1V9Y A;  2UV0 E;  3MS6 A;  1FQG A;  1HD8 A;  5EEC A;  4E3M A;  4S2I A;  2B18 A;  1VM1 A;  4Y0O A;  4II7 A;  2WKR A;  1LL9 A;  3BM6 A;  3ZHH A;  3D3O A;  1I5Q A;  2EXA A;  1IEM A;  4UA6 A;  4EEU A;  4XXR A;  3ZVW A;  4BD1 A;  3NCK A;  1XGJ A;  1LL8 A;  1FIK A;  4CPK A;  2HP5 A;  4GW9 A;  3BY9 A;  2Z2L B;  4JF6 A;  2Q0O A;  4X6T A;  2R9W A;  3NHQ A;  4LPZ A;  1MBL A;  1YMS A;  4MBK A;  4NXG A;  5HSQ A;  4F94 A;  5EVE A;  1TD5 A;  3UO9 A;  5HPI A;  5L8M A;  3T1R A;  2EWV A;  3OOV A;  4KEN B;  5L09 A;  4P87 A;  1E25 A;  2A2L A;  3IXH A;  4L0L A;  3BEB A;  4KZ3 A;  3C4O A;  2WKI A;  1ES2 A;  3QNC A;  4HHD A;  4U0X A;  3LIF A;  2OWJ A;  1KVL A;  1NY0 A;  2PBY A;  4OPY A;  3BW6 A;  4KZ4 A;  3T50 A;  1CI8 A;  5DJU A;  3NOT C;  2WGI A;  4R23 A;  4ZJ3 A;  1UWP X;  1MWU A;  3I7J A;  4ZRR A;  3G31 A;  3ZGA B;  2V1B A;  4WLA A;  2HDU A;  4RQ9 A;  5HZH A;  2ZL1 A;  4WEJ A;  4P6Z S;  2WAF A;  4HEF A;  5DJT A;  4BL3 A;  4XUX A;  1P9W A;  1SKO B;  5DFY A;  4GNU A;  5AQA A;  3TRC A;  1MWT A;  3V67 A;  1HZO A;  1PWG A;  3T4O A;  5A91 A;  3U2A A;  1T1A A;  4R6L A;  5DKL A;  4Z9Q A;  3G32 A;  4FSF A;  5JYP A;  3C5A A;  3LUQ A;  5GLD A;  1OTE A;  4EQ1 A;  2XD1 A;  3CPT A;  3A3F A;  3K3C A;  1IYO A;  1ZG6 A;  4F3L A;  2BAS A;  4OQH A;  4CLC E;  2G7U A;  2V0W A;  4UAA A;  4IVK A;  3IF5 A;  3V3S A;  4HIA A;  3V50 A;  4GZB A;  1EW0 A;  3DAV A;  2M1C A;  2KLI A;  5DVA A;  3BQ8 A;  4GHI B;  2W0N A;  1CF0 A;  3R7W A;  3DTK A;  2W3E A;  3E98 A;  1F98 A;  2XR0 A;  3O86 A;  3TSG A;  3KYE A;  4QHC A;  2PAV P;  1NYY A;  3ZNT A;  3LIB A;  1OTI A;  3BEC A;  1S4R A;  3V39 A;  1XJ4 A;  2WAD A;  1W8Y A;  4GDN A;  5F83 A;  2LB5 A;  3QP8 A;  3Q7V B;  3ISG A;  3ZG5 A;  3S1Y A;  3PAE A;  4GD6 A;  1TS7 A;  5IS1 A;  3VSL A;  2Y2K A;  3IF6 A;  4O01 A;  5EE8 A;  4ARZ A;  2EA9 A;  1I2S A;  1FR6 A;  1T1C A;  3QP1 A;  1VB6 A;  2WK0 A;  3S22 A;  3ZNY A;  2C6W B;  5F82 A;  5EVI A;  3LFV A;  3CPT B;  4B9O A;  5TGF A;  1CI9 A;  2JKR M;  1F5M A;  1L2S A;  5FI2 A;  1D1J A;  3ZYT A;  3IH9 A;  4ETX A;  2QPN A;  2HV1 A;  4OVD A;  1SZV A;  1TDL A;  3HUN A;  4ID4 A;  3PBO A;  3F1P A;  5BOH A;  2XQZ A;  1ZKJ A;  2J80 A;  4X53 A;  1W8Q A;  4FCF A;  5FQM A;  4BLM A;  1ES5 A;  3T1S A;  4KZ5 A;  3KSI A;  4BJP A;  4ME4 A;  2HDR A;  2QWS A;  4DDS A;  3ZCZ A;  4E3I A;  4OP8 A;  4UA7 A;  3WS2 A;  3B47 A;  1IYP A;  4KG2 A;  3WS1 A;  5IU1 A;  3A0S A;  4OP5 A;  1KOU A;  2V8C A;  3BFE A;  5TFQ A;  1MKI A;  3LIE A;  2PDR A;  1H8M A;  1MXO A;  3HUM A;  4GD8 A;  3HLG A;  3JVU A;  1QME A;  2PU2 A;  3O5Y A;  1GSW A;  3ZVT A;  2PD8 A;  3VP2 A;  5CHU A;  4GKU A;  5AJG A;  2XEP A;  3ZG7 B;  1WYB A;  5HAI A;  4E3N A;  4JXW A;  5FEG A;  2HP6 A;  2IWB A;  3MMH A;  4R1G A;  1PFL A;  3ULF A;  2WYX A;  4CLC D;  2KOI A;  2PBD P;  1TDG A;  1GSX A;  4YNR A;  3OPH A;  1ES4 A;  2H5S A;  1XFN A;  4WZ5 A;  3H7W A;  4OPQ A;  1DP6 A;  3MZF A;  1JWZ A;  2M7V A;  4NG2 A;  4C75 A;  1UGU A;  2ACG A;  4R38 A;  3IXB A;  2FZ0 A;  2Y8H A;  3A0R A;  5CHJ A;  4GS9 A;  1YLJ A;  1ALQ A;  2QKP A;  2EFU A;  4N9L A;  1KDS A;  1ZC2 A;  4RX3 A;  2XK1 A;  3UN7 A;  2Y2M A;  5A93 A;  2D01 A;  1KE0 A;  4QY5 A;  1YPR A;  3MJQ A;  1GHM A;  1S6R A;  4EWF A;  4OPZ A;  1LT0 A;  3BYD A;  5EFW A;  3QNB A;  1IOU A;  4YWZ A;  2VEA A;  1XX2 A;  4KZB A;  3JPU A;  4WM9 A;  5F1G A;  3UDF A;  2Y59 A;  4EQI A;  3CMZ A;  4OPR A;  4S2O A;  2QHK A;  3W4O A;  2ZLY A;  2NUP C;  2H10 A;  1PWD A;  1MPL A;  4Y0T A;  3WS0 A;  3PXP A;  1G68 A;  2IWD A;  3ICY A;  3P09 A;  4NXB A;  4QPR A;  1ONH A;  2ZM0 A;  1YSP A;  4DXB A;  3RXW A;  1YSQ A;  1XJ6 A;  4B93 A;  2ZBB A;  3C30 A;  4K91 A;  4R3B A;  1VQQ A;  4DN0 A;  4DDY A;  5A90 A;  4O0P A;  3S7N A;  4CJN A;  1OME A;  1PZP A;  2A24 A;  1E3U A;  3BY8 A;  2DCF A;  5F1F A;  2X71 A;  4FTX A;  2W1R A;  2K31 A;  2ZC6 B;  2VJW A;  2Y2N A;  3IBJ A;  1H8Z A;  1CEF A;  2KDK A;  4EER A;  2EXB A;  2A3U A;  3O3V A;  2XD5 A;  3R4K A;  4RX2 A;  4M3K A;  2XFT A;  2J9O A;  2YKF A;  4KQQ A;  3EGD C;  1PI4 A;  2H28 A;  4XUZ A;  3VP4 A;  3LR3 A;  4UQI M;  4BBT A;  4O7D A;  2OAQ 1;  3B42 A;  5DKK A;  1SCW A;  1PW1 A;  1DJB A;  3UPO A;  1XPB A;  3F1N B;  2RCX A;  3NBL A;  5TJJ A;  3ITB A;  3PBN A;  4R4S A;  1BLP A;  4EEP A;  5A92 A;  1N9L A;  4UA9 A;  3N8L A;  4KUO A;  2XF3 A;  2EWW A;  5EV0 A;  2P9V B;  5FI7 A;  3V5M A;  3H9W A;  2R9X A;  5IHV A;  3M2J A;  2EX2 A;  4WEL A;  3G4P A;  2Y2H A;  3MXR A;  3C8C A;  1L0E A;  3HLB A;  2Y91 A;  2WUQ A;  4Q0H A;  3UE1 A;  4WN5 A;  4MN7 A;  2O0Y A;  2B5R A;  1MKM A;  5EM1 A;  2H0T A;  3BQA A;  3N4I A;  3L7H A;  3FYZ A;  5D3O A;  5AVF A;  2PR5 A;  2ZQD A;  5HAQ A;  2G2W A;  2V1Z A;  4X55 A;  4C6Y A;  3S7P A;  4DXC A;  3EQV A;  3IQA A;  1EI5 A;  3OCL A;  3HVF A;  2V9A A;  2H0Y A;  3OCN A;  3E2K A;  4K08 A;  4Y5F A;  3KSF A;  2BLS A;  1CK3 A;  3G6O A;  4EV4 A;  1OJG A;  2V1A A;  1YLZ A;  3GRJ A;  3MFX A;  2P04 A;  1K54 A;  1L0F A;  4BEN A;  3PBQ A;  2M7U A;  5FQJ A;  2KX6 A;  2HF6 A;  2W3G A;  4BL2 A;  5HD5 A;  1KGG A;  3A3I A;  3QP5 A;  3G30 A;  1LSV A;  3CZD A;  2XGN A;  3NY4 A;  1LI9 A;  3FKV A;  1KVM A;  3LR4 A;  1ESI A;  4S2L A;  1NLY A;  4OOY A;  4IBX A;  3MXQ A;  5FA7 A;  1ERQ A;  3HLD A;  4D2O A;  3UB5 P;  1DJA A;  4OOL A;  4EBP A;  4PPR A;  4JF5 A;  3F1O B;  3K3D A;  4WMC D;  3LR0 A;  2OLU A;  1K0K A;  4E6X A;  3A3D A;  3UB7 A;  5E2E A;  2XSS A;  4YIN A;  1RP5 A;  2PD7 A;  1K55 C;  4HH3 A;  4IJG A;  4OON A;  4LFU A;  3NDE A;  2JHE A;  2ZM8 A;  5CEB A;  5GLB A;  4HJ3 A;  5CRF A; 
#chains in the Genus database with same CATH homology
 5EVI A;  3M6H A;  3HL9 A;  4PM9 A;  1FR1 A;  4EBN A;  1JWP A;  3A3E A;  1BTL A;  3M6B A;  1BUE A;  5TGF A;  1CI9 A;  1K4E A;  1JTD A;  3GR2 A;  3RXX A;  5FSR A;  1L2S A;  5FI2 A;  2Y2L A;  4BD0 A;  3IH9 A;  2ZC7 A;  4E3J A;  2QPN A;  4E3K A;  1SHV A;  3W8K A;  2WKE A;  1MWS A;  4OVD A;  1Q2Q A;  1TDL A;  3HUN A;  4LEN A;  1XKZ A;  2ZQ9 A;  3W4Q A;  1WE4 A;  2DRW A;  5EOE A;  4ID4 A;  2ZQ8 A;  1NXY A;  1K38 A;  2Q9N A;  3PBO A;  5BOH A;  4MEZ A;  3Q07 A;  3TG9 A;  1FCM A;  3M2K A;  2XQZ A;  3OC2 A;  1GA0 A;  5CGS A;  3SS3 A;  3TOI A;  1ZKJ A;  1KGF A;  4X53 A;  4JXV A;  3WS4 A;  1W8Q A;  4E3L A;  5I94 A;  4FCF A;  3HUO A;  1BLS A;  1NZU A;  4HES A;  5FQM A;  4UHU A;  4BLM A;  1ES5 A;  2HPB A;  2Y2Q A;  4KZ5 A;  4OLD A;  1PZO A;  4IED A;  4KG6 A;  5E2H A;  1ERO A;  5AQ7 A;  1L0G A;  4BJP A;  4DE2 A;  2HDR A;  3WRT A;  2RL3 A;  3BFC A;  4WMC A;  3VP1 A;  3ZCZ A;  4DDS A;  4E3I A;  3PBR A;  4LV0 A;  3PBT A;  2V2F F;  4X68 A;  5AQ9 A;  3ZG9 B;  5GHY A;  4OP8 A;  4UA7 A;  5CGX A;  1KDW A;  3WS2 A;  5DF7 A;  2Q9M A;  5TR7 A;  2ZMA A;  3UDI A;  3Q81 A;  1IYP A;  1PW8 A;  4KG2 A;  3WS1 A;  3N6I A;  4OP5 A;  3MZE A;  3G34 A;  3UPP A;  1ES3 A;  4YFM A;  5FQK A;  5GL9 A;  4WZ5 C;  3BFE A;  1YLT A;  5FQQ A;  1RGZ A;  5TFQ A;  1MKI A;  3CJM A;  4KQO A;  4EUZ A;  1KE3 A;  1BUL A;  5EVI D;  1K57 A;  4JLF A;  3MFD A;  1MXO A;  3SH7 A;  2JC7 A;  4OQ0 A;  3HUM A;  1M40 A;  2EX8 A;  2OSU A;  4GD8 A;  3HLG A;  1QME A;  2PU2 A;  3IH8 A;  3ZVT A;  5M1A A;  2J9P A;  1ONG A;  5CXW A;  4JBF A;  1JWV A;  3IWQ A;  3VP2 A;  5CED A;  5CHU A;  5CER A;  4GKU A;  2XEP A;  3ZG7 B;  1C3B A;  1FSW A;  3WRZ A;  3B3X A;  5EUA A;  1WYB A;  5HAI A;  4K0X A;  4E3N A;  4RVA A;  4LV1 A;  3HRE A;  4JXW A;  4OLG A;  1PWC A;  2HP6 A;  2IWB A;  1W79 A;  5CGW A;  1XXM A;  4R1G A;  4MBH A;  2HDQ A;  2WYX A;  1WYC A;  4LV2 A;  4N92 A;  5FQI A;  4B4X A;  3MKF A;  1TDG A;  1YQS A;  3OPH A;  1ES4 A;  1XGI A;  2H5S A;  4WZ5 A;  5DF9 A;  5EPH A;  3VP0 A;  1O7E A;  2Y2I A;  2XDM A;  2J8Y A;  4OKP A;  5AQB A;  4OPQ A;  3MZF A;  1K25 A;  4HBT A;  4P85 A;  1FSY A;  4WEK A;  3LO7 A;  5GHZ A;  3UE3 A;  2FFF B;  1JWZ A;  3ZDJ A;  5FAO A;  4C75 A;  4KZ9 A;  5M18 A;  2JBF A;  2X02 A;  1FCO A;  1HVB A;  2WAE A;  3SS4 A;  3LY3 A;  3SH8 A;  3IXB A;  2G2U A;  4Y7P A;  1MWR A;  2ZM2 A;  2OV5 A;  2WKH A;  3C4P A;  4WZ4 A;  5CHJ A;  4GDB A;  2Y2P A;  5FQ9 A;  3SS5 A;  1BT5 A;  1GCE A;  2QZ6 A;  3IXG A;  1YLJ A;  3O88 A;  5HAP A;  1ALQ A;  2EFU A;  5HX9 A;  3VSK A;  4MLL A;  4N9L A;  1KDS A;  2BG1 A;  4R4R A;  1ZC2 A;  4ZDX A;  3MXS A;  3HBR A;  4KZ6 A;  4RX3 A;  2XK1 A;  3UN7 A;  5E2F A;  3C7U A;  3HLE A;  1O07 A;  2Y2M A;  2Y4A A;  5G18 A;  1SKF A;  4WBG A;  5A93 A;  1KE0 A;  5GHX A;  4QY5 A;  3VOY A;  3IT9 A;  5EVL A;  4JF4 A;  4MNR A;  5EOO A;  1H5X A;  1YMX A;  1GHM A;  5FAQ A;  4OQI A;  3V3R A;  1S0W A;  1S6R A;  5EVI B;  1U60 A;  5JYO A;  4EWF A;  4OPZ A;  4U0T A;  4N9K A;  1ERM A;  4QY6 A;  5CTN A;  3BYD A;  4S2M A;  4ZAM A;  1N9B A;  1N4O A;  4N1X A;  3QNB A;  2OLV A;  3NIA A;  3ITA A;  1PYY A;  4R0Q A;  4DE1 A;  4Q8I A;  3MKE A;  1XX2 A;  4KZB A;  2UWX A;  4WM9 A;  1NZO A;  4RYE A;  4S2N A;  5F1G A;  3UDF A;  3VMA A;  2Y59 A;  2FFY A;  5FAT A;  4S2P A;  4EQI A;  1Z6F A;  2Z2M B;  3CMZ A;  3IWI A;  4C3Q A;  4OPR A;  1H8Y A;  4S2O A;  2Y2G A;  3SOI A;  3ZFZ A;  3W4O A;  3IXD A;  1JVJ A;  2ZLY A;  4X69 A;  3UNW A;  4GOG A;  2H10 A;  1PWD A;  1PIO A;  3LY4 A;  1LL5 A;  3GVB A;  1MPL A;  3UDX A;  4S2K A;  4Y0T A;  3C7V A;  3QHY A;  4BQM A;  2ZJ9 A;  2EX6 A;  3UY6 A;  3WS0 A;  4GN2 A;  5E2G A;  4DRT A;  1YLY A;  1ESU A;  1G68 A;  4U3T A;  2IWD A;  1SDN A;  3P09 A;  2ZQA A;  1W5D A;  4NET A;  4ZJ1 A;  4E3O A;  3Q1F A;  2XLN A;  4JPM A;  1K6R A;  4QJG A;  1K56 A;  2IWC A;  4ZBE A;  1ONH A;  2ZM0 A;  1GA9 A;  4QU3 A;  4DXB A;  3RXW A;  2VGJ A;  3IF6 B;  1XP4 A;  1K4F A;  5L2F A;  5HL1 A;  4S2N C;  5DTT A;  1XA1 A;  4K91 A;  3IHA A;  1K55 A;  4R3B A;  4QB8 A;  4DE3 A;  5GLA A;  4LV3 A;  3IF6 C;  1VQQ A;  2Y55 A;  3BFF A;  1YLP A;  3G2Z A;  1IYS A;  2V20 A;  3Q7V A;  3E2L A;  4RA7 A;  2ZC4 B;  5DF8 A;  5KZH A;  3VFH A;  3Q7Z A;  3FV7 A;  2ZD8 A;  1DY6 A;  3LEZ A;  4DDY A;  3S4X A;  4FH2 A;  1GHI A;  1KGE A;  3AGF A;  3PBS A;  3AGE A;  3NC8 A;  1RGY A;  4PM6 A;  5U47 A;  4CJN A;  5A90 A;  1OME A;  1PZP A;  5KSH A;  3FZC A;  1FQG A;  1HD8 A;  3BRM A;  5EEC A;  2QMI A;  5FDH A;  4NK3 A;  4S2I A;  4E3M A;  1E3U A;  1W7F A;  4Y0O A;  1VM1 A;  2DCF A;  2P9V A;  1K54 C;  2X71 A;  5F1F A;  1LL9 A;  2J7V A;  4LCM A;  3BM6 A;  3ZHH A;  1FCN A;  4R3J A;  1NJ4 A;  4N1H A;  3CG5 A;  1HTZ A;  1I5Q A;  4K0W A;  2EXA A;  2ZC5 B;  1IEM A;  2ZC6 B;  1YLW A;  4UA6 A;  2Y2N A;  3UE0 A;  1LHY A;  4JXG A;  3AGD A;  1AXB A;  3ZG0 A;  4ZTK A;  2GDN A;  4XXR A;  1H8Z A;  3W4P A;  3ZVW A;  1CEF A;  4BD1 A;  3NCK A;  1QMF A;  1XGJ A;  4H8R A;  2DNS A;  1BLH A;  5FAP A;  4CPK A;  2HP5 A;  3N8S A;  3DWZ A;  1TEM A;  2EXB A;  2A3U A;  3DW0 A;  3O3V A;  2XD5 A;  2Z2L B;  2P74 A;  4JF6 A;  4RX2 A;  2R9W A;  3DWK A;  1I2W A;  2EFX A;  3HLW A;  4M3K A;  2XFT A;  4OH0 A;  2J9O A;  4X6T A;  1MBL A;  1YMS A;  4MBK A;  3BFD A;  3G35 A;  2VGK A;  4F94 A;  2PU4 A;  1IEL A;  1FOF A;  4KQQ A;  3HLC A;  3VOZ A;  1PI4 A;  4P0M A;  4A5R A;  4XUZ A;  3VP4 A;  5DTK A;  4O7D A;  3O87 A;  3UO9 A;  3PAG A;  1Q2P A;  1SCW A;  4KEN B;  1PW1 A;  2I72 A;  1LI0 A;  1DJB A;  3A3J A;  3UPO A;  1XPB A;  4P87 A;  2RCX A;  1E25 A;  3NBL A;  3IXH A;  4L0L A;  3ITB A;  1BSG A;  3BEB A;  3OZH A;  3PBN A;  4R4S A;  4KZ3 A;  3C4O A;  1BLP A;  5A92 A;  3OPP A;  3UPN A;  2WKI A;  1ES2 A;  2Y2O A;  5KMW A;  4UA9 A;  3N8L A;  3QNC A;  4U0X A;  2WGW A;  3VP3 A;  1KVL A;  1NY0 A;  1E3U D;  2PBY A;  2XF3 A;  4ZJ2 A;  4JXS A;  2P9V B;  5FI7 A;  4OPY A;  4PM7 A;  3V5M A;  5CHM A;  4KZ4 A;  2R9X A;  5IHV A;  1CI8 A;  4X56 A;  2WGI A;  3M2J A;  2ZQ7 A;  4QD4 A;  2EX2 A;  4R23 A;  4WEL A;  1MWU A;  5E43 A;  4ZJ3 A;  3I7J A;  3G4P A;  2Y2H A;  1MY8 A;  3MXR A;  4DF6 A;  1IKI A;  3G31 A;  3ZGA B;  5HW3 A;  3OPL A;  1L0E A;  3HLB A;  3BLS A;  2Y91 A;  1K57 C;  2HDU A;  4WYY A;  4WEJ A;  2WUQ A;  2WAF A;  4HEF A;  1E4D A;  3P98 A;  4B88 A;  3N7W A;  3UE1 A;  4BL3 A;  4XUX A;  1BLC A;  4DKI A;  2B5R A;  4GNU A;  3ZG8 B;  2H0T A;  1L0D A;  3N4I A;  5AQA A;  3FYZ A;  4PM8 A;  5D3O A;  1MWT A;  3RJU A;  2CC1 A;  3NI9 A;  2ZQD A;  5HAQ A;  5FI6 A;  2G2W A;  1HZO A;  1PWG A;  1Y54 A;  2V1Z A;  5A91 A;  4FH4 A;  2X01 A;  1BZA A;  4X55 A;  1NRF A;  1RCJ A;  4C6Y A;  5HFO A;  4DXC A;  3EQV A;  4Z9Q A;  3G32 A;  3IQA A;  1NYM A;  1YT4 A;  1DJC A;  4EBL A;  4FSF A;  1EI5 A;  3BFG A;  3OCL A;  5CEC A;  3HVF A;  2Y2J A;  3Q82 A;  4IBR A;  5JYP A;  4LCL A;  2H0Y A;  5GLC A;  3C5A A;  3E2K A;  3EQU A;  3OCN A;  3DTM A;  4MBF A;  5GLD A;  1KE4 A;  1ZG4 A;  2XD1 A;  3HLF A;  2WGW B;  2BLS A;  3A3F A;  1CK3 A;  1IYO A;  1ZG6 A;  2WZX A;  4JKT A;  4KZ8 A;  3OPR A;  3D4F A;  1GHP A;  4PM5 A;  4EV4 A;  4IVI A;  4OQH A;  1YLZ A;  3GRJ A;  4UAA A;  4IVK A;  3FKW A;  2WZZ A;  3IF5 A;  1K54 A;  1L0F A;  4OQG A;  4BEN A;  1YM1 A;  5CTM A;  3MZD A;  3PBQ A;  3V3S A;  1XA7 A;  3GSG A;  4GZB A;  3N8R A;  5FQJ A;  3V50 A;  3WS5 A;  3IHB A;  3FWL A;  1K56 D;  5DTS A;  1M6K A;  4S2J A;  4BL2 A;  5DVA A;  3NDG A;  1KGG A;  3A3I A;  3JYI A;  5EVI C;  1TVF A;  1PI5 A;  2XFS A;  2JCH A;  1CEG A;  3G30 A;  3CZD A;  2XGN A;  3NY4 A;  1LI9 A;  1LLB A;  2XR0 A;  3FKV A;  1KVM A;  2ZQC A;  1ESI A;  1G6A A;  3G2Y A;  3O86 A;  4S2L A;  3TSG A;  4FD8 A;  4OOY A;  1J9M A;  4QHC A;  3IWO A;  2A49 A;  1NYY A;  3GV9 A;  2C5W B;  4IBX A;  3ZNT A;  5FA7 A;  3WWX A;  1IKG A;  4Y0U A;  3GMW A;  3LCE A;  3MBZ A;  3BEC A;  2XH9 A;  1EWZ A;  2E8I A;  1K6S A;  3V39 A;  4DE0 A;  1ERQ A;  3HLD A;  4D2O A;  3SH9 A;  2WAD A;  4KZA A;  1DJA A;  4HBU A;  1SDE A;  4OOL A;  1W8Y A;  4GDN A;  4PPR A;  4JF5 A;  5F83 A;  4EBP A;  3VFF A;  3PTE A;  3GTC A;  4OOM A;  2JE5 A;  3ISG A;  3Q7V B;  4WMC D;  1JTG A;  2EX9 A;  3ZG5 A;  2OLU A;  3S1Y A;  4E6X A;  3A3D A;  3PAE A;  4GD6 A;  5E2E A;  4KQR A;  2HP9 A;  4KZ7 A;  4PMA A;  3VSL A;  3BLM A;  2Y2K A;  4GB7 A;  4YIN A;  3GQZ A;  5FAS A;  3IF6 A;  1RP5 A;  5EE8 A;  2ZC3 B;  4B4Z A;  5HAR A;  4E6W A;  1I2S A;  5J8X A;  1FR6 A;  5KSC A;  1K55 C;  1IYQ A;  4KG5 A;  4OON A;  2WGV A;  3NDE A;  2WK0 A;  3S22 A;  2ZM8 A;  5CEB A;  3ZNY A;  5M19 A;  2HDS A;  2C6W B;  5F82 A;  5GLB A;  4P6B A;  5CRF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...