1KGFA

Structure of beta-lactamase asn 170 gln mutant
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
257
structure length
257
Chain Sequence
KELNDLEKKYNAHIGVYALDTKSGKEVKFNSDKRFAYASTSKAINSAILLEQVPYNKLNKKVHINKDDIVAYSPILEKYVGKDITLKALIEASMTYSDNTANNKIIKEIGGIKKVKQRLKELGDKVTNPVRYEIELQYYSPKSKKDTSTPAAFGKTLNKLIANGKLSKENKKFLLDLMLNNKSGDTLIKDGVPKDYKVADKSGQAITYASRNDVAFVYPKGQSEPIVLVIFTNKDNKSDKPNDKLISETAKSVMKEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-LACTAMASE
publication title Elimination of the hydrolytic water molecule in a class A beta-lactamase mutant: crystal structure and kinetics.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 87
structure length 257
sequence length 257
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 1996-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1kgfA00
3SS3A 1L0EA 1BLPA 3S1YA 1ONHA 2P9VB 4P87A 2ZC6B 5EUAA 1Q2PA 1XP4A 4K0WA 4N1XA 2X02A 4BLMA 3ZHHA 3PBTA 3MXSA 1SCWA 1CK3A 4KQOA 1PYYA 5G18A 4DF6A 2R9WA 4OVDA 3DWKA 5J8XA 3V39A 4E3OA 2V20A 4N9KA 4UA9A 2EX2A 1IYOA 4PMAA 4X6TA 2QZ6A 1KVMA 2DNSA 3Q07A 4S2JA 5CEDA 1J9MA 1GHPA 2XF3A 5D3OA 1IEMA 3MZEA 5CECA 1FOFA 2IWCA 3NY4A 2XR0A 4LCLA 1L0DA 2WKHA 4R4SA 4X53A 4KG6A 3ZDJA 3A3DA 3BLMA 3OC2A 4N1HA 5F1GA 4RX3A 4X55A 4S2OA 3IH9A 3IH8A 2ZQAA 3A3JA 4B4XA 4E3NA 4FH2A 4X56A 1K56A 1YQSA 4NK3A 4OQGA 5I94A 1SDNA 3M2JA 2WZZA 1K57C 3JYIA 4P6BA 4OPZA 4Q8IA 2ZM0A 4BQMA 2OSUA 1BUEA 4PM8A 5GLCA 1PI5A 3MBZA 2XK1A 1XPBA 5A90A 5FDHA 5FQ9A 2Q9MA 3E2KA 1YLJA 3GSGA 1BT5A 4DE0A 4KZ3A 3HLCA 1PI4A 1PWDA 3HLFA 1EI5A 2PBYA 4KZ9A 4X69A 3ZG8B 1FCOA 4JF5A 5GLDA 5CTNA 4QB8A 2JC7A 3PBQA 2EX8A 4RVAA 2Y4AA 3M2KA 3V50A 1ES2A 3IHBA 1GHMA 4S2NC 2CC1A 1PW8A 4CJNA 1XGJA 4KG2A 2H0YA 5FA7A 1FQGA 1JWPA 3IT9A 1K6RA 4E3KA 2P74A 1BSGA 4GOGA 2Y2IA 4DE1A 4Y0TA 1KGEA 2ZQDA 2Y2JA 3UPNA 1W7FA 1YLYA 4D2OA 4R1GA 2DCFA 4DXBA 2V1ZA 3Q1FA 3Q7VB 1K55A 5CEBA 4L0LA 3GTCA 1LLBA 1IKGA 2EX6A 5A93A 1NZUA 4OLDA 2JCHA 5HARA 4JF4A 5CGSA 2WADA 2XD5A 3WWXA 1L0GA 3RJUA 5TFQA 3G4PA 5EECA 5EVIC 2ZQ7A 3VP4A 2ZQ9A 5EVID 1U60A 4EQIA 1Y54A 1YLWA 1TDLA 4UAAA 5EOOA 3HLGA 1MXOA 3ZFZA 3GV9A 5FI2A 3UO9A 3BFGA 3IWQA 3W4PA 3IF5A 3IXDA 2IWBA 3VSKA 4GDBA 3UE1A 4ZDXA 2J9OA 4KZAA 3WS2A 3VFFA 3HLDA 3M6HA 5EVIB 5GLBA 4B4ZA 4BD0A 4EBLA 1IYQA 3ITAA 4OOYA 5DTTA 5JYPA 2HPBA 3BFCA 2XQZA 2WUQA 2ZMAA 4GZBA 4R23A 5AQAA 4R4RA 1GHIA 4F94A 4WELA 3CZDA 1LI0A 5EVLA 4KZBA 3TG9A 1JWZA 2Z2MB 3NBLA 5FQQA 1G68A 1K25A 3G31A 3ISGA 4EBPA 3ZNTA 5KSCA 2EXAA 4UA6A 3IXGA 2RL3A 2P9VA 1ALQA 1OMEA 3I7JA 3IF6C 4C6YA 3VMAA 4R3BA 5DTKA 4XUXA 1XA1A 3A3IA 3G2ZA 4DE3A 3ZG0A 1NJ4A 3PAGA 4MBHA 3NIAA 2Y59A 3P98A 3SS4A 5CTMA 3N7WA 3BYDA 2Y2KA 5A92A 1I2WA 4KZ5A 1SDEA 4BL3A 4PM9A 1ZKJA 3C4OA 3IXHA 2HDSA 2OV5A 4WZ5C 5L2FA 4JXGA 2HP6A 3IQAA 3WS4A 3IF6B 1QMEA 4OOMA 1YLTA 1HVBA 1TVFA 1ESUA 1PW1A 1XA7A 2WAFA 3UN7A 1RP5A 4S2KA 3N8LA 3BFDA 3FZCA 2WKEA 1HTZA 1W8QA 2J8YA 2I72A 4KQQA 3WS5A 3CJMA 3FYZA 1DJAA 3PBRA 4Z9QA 4KZ7A 4IBRA 3CG5A 3WRZA 2OLVA 5U47A 4PM7A 3V5MA 3FKVA 3SH7A 4KZ4A 3UPOA 3BFEA 2B5RA 2Y2NA 4HBUA 1WYCA 2WGWB 4U0TA 3DW0A 2DRWA 2JE5A 1FSYA 1ZG6A 4JXWA 1M6KA 2A3UA 4H8RA 5E2EA 2PU2A 1N9BA 5AQ7A 3V3RA 3AGFA 3O88A 5HAIA 1KDWA 1E25A 1K57A 1SHVA 4WZ4A 2QPNA 2FFFB 5CERA 4WYYA 2EFUA 1DJCA 3IHAA 4ZJ1A 2Y2LA 3N8SA 4MBKA 3BLSA 3UNWA 2G2UA 1KE4A 3VP3A 4LV2A 5HFOA 3UE0A 2ZC7A 5M1AA 1E3UD 4FCFA 5TR7A 4EWFA 2FFYA 4QU3A 5HL1A 1YMSA 3C5AA 1FR6A 4C3QA 2XDMA 4WM9A 3S22A 2WGVA 3Q7VA 1PZOA 3C4PA 1NRFA 4MLLA 5GHZA 4S2NA 1WYBA 3ZVTA 3P09A 4QD4A 1ESIA 4OQ0A 5HAPA 1H8YA 1NZOA 1O07A 1JTDA 1YM1A 1BTLA 1IELA 3G32A 3EQUA 1MWSA 2EXBA 2BLSA 4YINA 3V3SA 1EWZA 2WAEA 2H10A 3BEBA 3PBSA 2ZM2A 4OPRA 2V2FF 1LI9A 4IBXA 1PWGA 1W79A 1VQQA 3IWOA 4DXCA 4BD1A 3D4FA 2A49A 4OLGA 4JXSA 1JTGA 4RA7A 4OOLA 2ZC5B 4P85A 4BJPA 3FWLA 3Q7ZA 4N92A 4JXVA 4DE2A 1IYSA 3QNCA 2H0TA 5FAPA 3S4XA 5EVIA 3WS0A 1BLHA 4UA7A 1TEMA 5DTSA 4B88A 2XLNA 1LL5A 1ONGA 3G34A 1IYPA 5FQJA 1DJBA 4WEKA 1CI9A 2XEPA 2Y2PA 3LCEA 4PPRA 4OH0A 3O3VA 3VP0A 1JWVA 1HD8A 3HLBA 1PWCA 1IKIA 5FATA 4A5RA 4LCMA 5FASA 2QMIA 3FKWA 2J7VA 5AQBA 2UWXA 3HUOA 4GNUA 1K38A 5CGWA 5EE8A 2VGJA 5BOHA 3ZG7B 3UPPA 2Z2LB 4N9LA 1ES5A 1K54A 1MWTA 3C7VA 5AQ9A 3M6BA 5CHUA 3UDXA 4K0XA 3DWZA 2HDUA 3B3XA 3IF6A 2WK0A 3BRMA 5DF9A 4OQHA 4LV3A 1L2SA 3SH9A 3OPPA 3VP2A 4RX2A 4DRTA 4E3IA 1JVJA 1L0FA 3UY6A 3LEZA 1ZG4A 1H8ZA 1KDSA 2XD1A 4LENA 3NDGA 2OLUA 1MWUA 2RCXA 3HREA 4BENA 4ZTKA 3MKFA 2EX9A 2ZC3B 2HP9A 2HDRA 1N4OA 2HP5A 4FSFA 4JBFA 4WEJA 5CXWA 1ES3A 1MKIA 5EOEA 4E3MA 5F1FA 1XGIA 1AXBA 4QY6A 3DTMA 4WZ5A 4M3KA 4FD8A 4K91A 3ZVWA 3SOIA 1ES4A 1GCEA 2Y2GA 4U3TA 5FI7A 4ID4A 3ZG9B 4KZ6A 2WGWA 4EBNA 3O87A 2C5WB 1KVLA 4E6WA 4JF6A 3GVBA 3TOIA 3NI9A 2PU4A 3ZNYA 2Y55A 2XH9A 5HX9A 1I2SA 4QY5A 3PBOA 2ZD8A 5FQMA 3VP1A 1RGYA 3LY3A 2ZM8A 3NCKA 4XUZA 3N8RA 4OPQA 4QJGA 3NC8A 5KSHA 3MFDA 4Y0UA 1WE4A 3GMWA 3IWIA 1K6SA 4IEDA 4X68A 3W4OA 4S2MA 4JKTA 1XKZA 1CI8A 4EV4A 1QMFA 2X71A 1YLZA 2J9PA 3UDFA 3VFHA 5E2GA 4ZJ2A 1RCJA 1S0WA 3RXXA 3PAEA 1NYYA 3HVFA 3N6IA 4OPYA 2IWDA 5FI6A 5CHMA 1PZPA 1BULA 5EPHA 4KENB 5DF7A 5E43A 1KGGA 1PIOA 1YT4A 4S2IA 2WYXA 3Q81A 1C3BA 1NY0A 4OP5A 2C6WB 4NETA 4DKIA 3ZCZA 4S2LA 3IXBA 3HUNA 1G6AA 3MZFA 3W4QA 3AGDA 1VM1A 5M19A 1FCNA 3GRJA 3NDEA 3BFFA 4U0XA 4BL2A 1GA9A 1E3UA 4PM6A 3HBRA 4KG5A 1K56D 4PM5A 3GQZA 1MWRA 4FH4A 3C7UA 2WZXA 3CMZA 3TSGA 3SS5A 1Q2QA 5E2HA 4GB7A 1MPLA 4YFMA 4R0QA 3VOYA 3OPHA 1RGZA 3WRTA 5FAQA 4ZJ3A 5A91A 3A3FA 2EFXA 3A3EA 4S2PA 4WMCA 4WMCD 5FAOA 1YLPA 2H5SA 3O86A 1S6RA 4GD8A 1HZOA 3PBNA 1XX2A 3OZHA 2BG1A 2ZJ9A 3MXRA 4LV1A 2G2WA 3UE3A 3HUMA 5IHVA 4JLFA 1ZC2A 4GD6A 4OONA 3E2LA 2E8IA 4XXRA 5KMWA 1E4DA 4QHCA 1SKFA 2Y2HA 2Y2MA 2HDQA 3G35A 4KQRA 3BM6A 4O7DA 4P0MA 1GA0A 4R3JA 5FQIA 5FSRA 1W8YA 4WBGA 2ZC4B 5CHJA 5F82A 1BLSA 1BLCA 2Y2QA 4OKPA 4UHUA 1FCMA 3RXWA 4KZ8A 2XFTA 5CGXA 1NXYA 1DY6A 1LHYA 3GR2A 3OCNA 4GDNA 3MKEA 4DDYA 4HESA 4E3JA 1CEGA 5GLAA 5JYOA 2Y2OA 1K4EA 2XFSA 3HL9A 5DF8A 1BZAA 3G2YA 3SH8A 4IVIA 1ERQA 1M40A 3PTEA 3Q82A 1K55C 4MBFA 3EQVA 4E6XA 2Y91A 4Y0OA 5GL9A 1I5QA 1Z6FA 2R9XA 1EROA 3OPLA 5GHYA 5KZHA 1MY8A 4HEFA 4JPMA 1LL9A 3UDIA 4ZAMA 3VOZA 1ERMA 1O7EA 3ZGAB 3LO7A 2Q9NA 4Y7PA 4EUZA 3N4IA 1YMXA 1XXMA 2ZQCA 3QHYA 3BECA 2VGKA 4ZBEA 2GDNA 4IVKA 5F83A 3MZDA 3QNBA 4RYEA 5TGFA 5FQKA 3W8KA 3OCLA 4E3LA 1H5XA 5M18A 5DVAA 4DDSA 5GHXA 1NYMA 1W5DA 3LY4A 2ZQ8A 4GN2A 1KE3A 5HAQA 3ITBA 1KGFA 4LV0A 4OP8A 3VSLA 3G30A 2ZLYA 5E2FA 3OPRA 2XGNA 1K54C 4MNRA 1FSWA 2WGIA 3HLWA 1FR1A 2WKIA 3AGEA 4MEZA 3HLEA 4OQIA 1TDGA 3ZG5A 5HW3A 4GKUA 3WS1A 1KE0A 1K4FA 4HBTA 2JBFA 2X01A 4C75A 5CRFA 1CEFA 3FV7A 4CPKA 1MBLA
chains in the Genus database with same CATH superfamily
1UWPX 2P9VB 1Q2PA 2WKRA 4N1XA 3BW6A 3A0VA 1TF1A 1CK3A 3CLOA 4DF6A 2V20A 3LEQA 2EX2A 4PMAA 5CEDA 3JPUA 1IEMA 3MZEA 2IWCA 3NY4A 4HJ6A 3BLMA 3OC2A 4RX3A 4S2OA 3IH9A 2ZQAA 4E3NA 4NK3A 2ZBBA 1SDNA 3M2JA 4L9EA 1Z09A 4ARZB 2WZZA 1K57C 4OPZA 5TBMA 1OJGA 2VV6A 4O01A 4PM8A 1DP9A 1XPBA 2BASA 5FQ9A 1YLJA 5L8MA 1PWDA 2D01A 3LIDA 3HLFA 4KZ9A 3ZG8B 3M2KA 2W3HA 1ES2A 1GHMA 1W63M 4S2NC 1T18A 1K6RA 1V9ZA 3CI6A 4GOGA 4CLCE 1W7FA 1YLYA 4D2OA 4DXBA 3E98A 3GTCA 1NZUA 2JCHA 2WADA 5EM1A 3WWXA 5DJUA 2FH5A 3G4PA 3B42A 5F69A 5EVID 1YLWA 3BFGA 3LIBA 3PYPA 3WS2A 2K7SA 4B4ZA 2QKPA 5DTTA 2WUQA 5AQAA 3B33A 1GHIA 4F94A 4WELA 3CZDA 5HL6A 4H6JA 1K25A 1N9OA 2EXAA 2V1AA 4UA6A 3I7JA 3KYZA 5EVEA 1XA1A 2HJ9C 4YWZA 2FZ0A 5HDSA 3UB6A 5A92A 1I2WA 1SDEA 4DJ2A 4GS9B 3C4OA 3IXHA 2HDSA 5F6AA 4R3AA 2HP6A 4OOMA 1TVFA 1HVBA 3E4PA 3UN7A 5HWVA 1RP5A 3BFDA 3FZCA 2WKEA 4Y5FA 1W8QA 1T19A 3U2AA 4YNRA 2LB9A 4KZ4A 3BFEA 2B5RA 2Y2NA 1FSYA 2L1MA 4JXWA 2XA7S 5E2EA 5EV0A 1N9BA 3AGFA 1KDWA 3VV4A 1OJ5A 3N8SA 3VP3A 2VZWA 2A2LA 2ZC7A 1E3UD 4FCFA 4EWFA 4QU3A 5HL1A 5L09A 1GSWA 4I5SA 3KSHA 3LYXA 1PZOA 3C4PA 1NRFA 4MLLA 3IX8A 3P09A 4Q0HA 4LRYC 1ESIA 4L9FA 3CHWP 3KYQA 3V3SA 1EWZA 2WAEA 2V2FF 1LI9A 4Y2FA 1VQQA 4WL9A 3LFVA 4OOLA 3FWLA 3Q7ZA 1IYSA 3S4XA 4B88A 2XLNA 1DJBA 2W3GA 3T1QB 3CWFA 4Y13A 4LCMA 2J7VA 5AQBA 5CHUA 4K0XA 3IF6A 2WK0A 5HD5A 3EEHA 1LSXA 5AVFA 3UY6A 2W1RA 1H8ZA 2XD1A 3NDGA 3MKFA 2EX9A 2HP9A 2HP5A 1YSPA 4M3KA 5HDDA 2Y2GA 2B02A 3TRCA 3ZG9B 1PRQA 2K2NA 1KVLA 4E6WA 3F1PA 3H7WB 2PU4A 3QP5A 4IUHA 2Z6DA 1I2SA 3PBOA 5FQMA 1WA9A 3N8RA 4OPQA 5FEFA 3GMWA 4X68A 3W4OA 4EV4A 5AVEA 1QMFA 3FG8A 3UDFA 4AFIA 4IJGA 2JKTM 3IX4A 5HD3A 3RXXA 4R38A 1BULA 4KENB 5DF7A 2B95A 1NY0A 4OP5A 3IXBA 3CUEA 3W4QA 1FCNA 3GRJA 2J3TD 1L3LA 4NXBA 4JGRA 3HBRA 4PM5A 2L0WA 2OOLA 3C7UA 2WZXA 3CMZA 4ZRRA 3SS5A 1Q2QA 4BWIA 4JGPA 3WRTA 4S2PA 4WMCD 3O86A 4GD8A 5DJTA 1HZOA 4GLQA 3OZHA 2G2WA 4JLFA 1YPRA 1F9IA 2E8IA 3E2LA 4XXRA 1E4DA 2KOIA 4Y17A 3ICYA 5FQIA 3G35A 5FSRA 4Y15A 4WBGA 1W8YA 2PYPA 2ZC4B 4M4XA 1BLSA 1BLCA 4OKPA 4UHUA 5K5BA 3FPWA 5CGXA 1NXYA 3CPTA 3GR2A 4GDNA 2VX8A 5F68A 2GNXA 5HSQA 2I9VA 3T4QA 1K4EA 5DF8A 4IVIA 4E6XA 1K55C 3EQVA 2Y8HA 3SZTA 5F5YA 2AVXA 2A24A 1EROA 3MR0A 3S7OA 4JPMA 2W3EA 1LL9A 4HHDA 1DP6A 1H0MA 1ERMA 4I3AA 4EUZA 1OT6A 2ZQCA 3ULFA 3EWKA 4ZBEA 5HWWA 3QP2A 3UB8A 2OWHA 4CQHA 1XJ4A 4IVKA 3QP6A 3BQAA 1XJ3A 1VEUB 1KE3A 4LV0A 3G30A 4O8GA 3AGEA 3ZG5A 3F1NA 4GKUA 1KE0A 1K4FA 4HBTA 2X01A 3FV7A 1ONHA 3L9KA 3PBTA 3MXSA 1SCWA 5TJJA 3DWKA 3A0RA 2M1CA 3C30A 3V39A 1SKOA 2W0NA 1J9MA 2XF3A 5D3OA 1FOFA 4LCLA 3A3DA 4N1HA 4X55A 3T4KA 1A0KA 3A3JA 4XT2A 4X56A 2UV0E 4OQGA 1YQSA 4P6BA 4IUKA 2VV8A 4BQMA 5FDHA 2Q9MA 1BT5A 5DFXA 3DTKA 2QJ7A 5CTNA 4QB8A 2MJ6A 3IHBA 2XROA 3D72A 1YSQA 2JKTI 2P74A 1KGEA 2ZQDA 1S67L 4UQIM 2P04A 3VE3A 2DCFA 2V1ZA 3Q1FA 3Q7VB 5CX7A 4GJ4A 1P97A 1IKGA 2EX6A 5A93A 4OLDA 5HARA 2XD5A 1OTAA 3O5YA 1P0ZA 3V67A 5EECA 5EVIC 2ZQ7A 3TW8A 2PD7A 4UAAA 5EOOA 3T4TA 1CQAA 2VKSA 1CJFA 1S4RA 4EESA 3ZFZA 3IF5A 3VSKA 1LSWA 4ZDXA 4GHIA 5EVIB 4EBLA 3H9WA 5JYPA 3BFCA 2XQZA 2CMNA 2ZMAA 3EGDC 4LRXC 4R23A 4R4RA 5EM0A 2NUPC 3NBLA 2JKFA 1FILA 2GX5A 3LIAA 3IXGA 4C6YA 4ETZA 3A3IA 4Y3IA 2VV7A 2QHKA 3P98A 3N7WA 3IBRA 2JHEA 4KUKA 2OV5A 3PR6A 3T1RA 4JXGA 5L2FA 1ESUA 4I3IA 4MN6A 3VE4A 1HTZA 2J8YA 4G3WA 1Y28A 1S1YA 3WS5A 4F3LA 3R7WA 4KZ7A 1KOUA 1F98A 3V5MA 3FKVA 2JN7A 5DKKA 2DRWA 2JE5A 1T1CA 1M6KA 2A3UA 2PU2A 1E25A 4KQDA 1TS7A 2FFFB 3FPVA 4WYYA 2EFUA 4ZJ1A 2Y2LA 4MBKA 4Q0JA 1P9WA 4LV2A 1SKOB 2B18A 2R78A 3H82A 4LRZE 3S22A 3ZVTA 4QD4A 1BTLA 1MWSA 2EXBA 2BLSA 3JVUA 2H10A 2ZM2A 3ZYTA 4IBXA 1P9RA 1W79A 2A49A 4OLGA 5MC7A 2IA2A 4BJPA 4L9GA 3MXQA 4NXFA 3K2NA 1TS6A 5FAPA 4JGOA 5DTSA 4WEKA 5IS1A 2XEPA 3LCEA 2YKHA 2VGLM 4PPRA 4OH0A 3TE8A 4II7A 1JWVA 1FIKA 3JVVA 1HD8A 5DKLA 3LGOA 4A5RA 5FASA 4EQ1A 2OWJA 4GNUA 1T1AA 5CGWA 5EE8A 2VGJA 5AQ9A 2V8FA 3UDXA 2HDUA 2M7UA 5IT5A 3BRMA 4EERA 4O0PA 4LV3A 1L2SA 3SH9A 3VP2A 4RX2A 4DRTA 3EGXC 1JVJA 2PT7A 4BENA 4ZTKA 3NHQA 4JBFA 1ES3A 1AXBA 3DTMA 4WZ5A 4R6LA 4PKYG 3SOIA 3D3OA 1GCEA 4U3TA 4KZ6A 2WGWA 4LLOB 4EBNA 3O87A 2C5WB 3K3DA 5AJGA 3MMHA 3D9YA 3LI8A 2Y55A 1Y4OA 3VP1A 2ZD8A 3C38A 1RGYA 3NC8A 4Y0UA 3IWIA 4RQ9A 4ME4A 4S2MA 1XKZA 2X71A 4FOFA 4NKPA 3VFHA 4ZJ2A 4LFUA 3HVFA 2IWDA 3OOVA 5EPHA 1PNEA 3BY9A 1KGGA 1PIOA 4JGQA 1YT4A 1S4SA 2WYXA 3ZCZA 3HUNA 4EU0A 2J3TC 3RTYA 1VB6A 4BL2A 1MWRA 4BBVA 2W1TA 5E2HA 4GB7A 4DN0A 1X0OA 4R0QA 3VOYA 4UQIS 5A91A 2EFXA 2QJ5A 1YLPA 2H5SA 1S6RA 2O9AA 3PBNA 2ZJ9A 3HUMA 2KX6A 5TBMB 4WF0A 1ZC2A 5KMWA 2W3DA 3RFBA 2Y2HA 2HDQA 3UNWA 4KQRA 1VHMA 5F82A 2WKPA 2Y2QA 1FCMA 2V1BA 4KZ8A 2XFTA 4BMWA 1OT9A 3MKEA 4E3JA 1ACFA 4PHTA 1YKDA 5A90A 5J4EA 1IOUA 3PTEA 1M40A 2K31A 1XJ6A 4GCZA 5GL9A 3MQQA 3C8CA 1I5QA 1Z6FA 5FDSA 5GHYA 3T12B 3HCYA 1MY8A 4HEFA 3UDIA 1D06A 4ZAMA 3VOZA 1O7EA 3VOLA 1YMXA 1DRMA 3QHYA 3BECA 3LR3A 2VGKA 2GDNA 1VETA 3KX0X 2JKGA 4HP4A 4PKYA 5F83A 3MZDA 3QNBA 5TGFA 3EOIA 2J3WA 1H5XA 4CLCA 4DDSA 5GHXA 1NYMA 1W5DA 5HAQA 1KGFA 3VSLA 4FTXA 2XGNA 3IS2A 1FR1A 3HLEA 2ZOHA 2O9CA 4H6JB 4C75A 1S66L 1CEFA 3MFXA 1L0EA 4P87A 2PR6A 2ZC6B 4K0WA 2VEAA 5FL3A 4BLMA 1NRJA 1PYYA 1IYOA 2QZ6A 3Q07A 3U4LP 4WN5A 2XR0A 3T50A 3SW1A 1L0DA 2WKHA 4R4SA 4X53A 3ZDJA 5F1GA 3UE6A 4FH2A 3OBFA 5I94A 3JYIA 2OSUA 5GLCA 1PI5A 3MBZA 4DJ3A 3GSGA 4DE0A 2INWA 3DTEA 1EI5A 2PBYA 4X69A 1FCOA 4JF5A 2JC7A 2Y4AA 4HP9A 4KUOA 3V50A 3W2ZA 4CJNA 1PW8A 1XGJA 4KG2A 1NLYA 2H0YA 5FA7A 1JWPA 3IT9A 2VGLS 1BSGA 5HDCA 4EETB 2W1TB 3UPNA 5CEBA 4L0LA 5HZHA 4JF4A 5CGSA 4QWOA 5TFQA 1JNUA 2GZAA 2ZQ9A 4HJ4A 1U60A 2ZL1A 1TDLA 3HLGA 1D7EA 3FC7A 5FI2A 3IWQA 3W4PA 3IXDA 4I3JA 3LR5A 2J9OA 4EXOA 3VFFA 3M6HA 1IYQA 4OOYA 1ODVA 1LI0A 2Z2MB 1G68A 3ISGA 4EBPA 1GSXA 2Y79A 2P9VA 3IF6C 4DE3A 3G2ZA 1NJ4A 4MBHA 5CTMA 4E04A 4BL3A 4PM9A 1ZKJA 2G7UA 1VETB 3IF6B 1QMEA 1XA7A 3QP8A 4S2KA 3N8LA 4CLCB 3CJMA 3IX3A 3FYZA 3PBRA 2Z6CA 5L10A 2VLGA 3CG5A 3WRZA 4UEYA 3MJQA 5U47A 4ARZA 4PM7A 2HZ5A 3IS2B 3T4LA 3SH7A 1OTBA 3DW0A 1N9LA 3F1PB 4I38A 4H8RA 5HAIA 4DMZA 1K57A 4WZ4A 3CUEC 1KE4A 4YOFA 5HFOA 5M1AA 3S7NA 5TR7A 2FFYA 3NECA 1OTDA 1FR6A 4WM9A 2WGVA 5GHZA 1NWZA 4S2NA 1WYBA 2HV1A 4OQ0A 1H8YA 1O07A 1JTDA 1S1ZA 1YM1A 3G32A 2DMWA 3PBSA 4OPRA 2V0UA 4LPZA 3D4FA 2PDRA 3G6OA 4JXSA 1JTGA 2ZC5B 4P85A 2PYRA 3QNCA 2H0TA 4P6ZM 2LB5A 3HJKA 4UA7A 1TEMA 4NXGA 1ONGA 3G34A 4MCWA 3LI9A 2H28A 3CPTB 3VP0A 3HLBA 1PWCA 4Q0IA 2UWXA 3HUOA 2A24B 1K38A 5BOHA 2VA0A 1G5UA 5LBRA 4GS9A 3UPPA 2Z2LB 4N9LA 1ES5A 1K54A 1NLZA 1CF0A 3B3XA 3E0YA 2ZL1B 2W3FA 4D60A 4CLCD 3DBAA 4X25A 1ZG4A 1KDSA 2OLUA 1MWUA 2RCXA 3LR4A 4GW9A 4HIAA 4FSFA 2O99A 2HDRA 1N4OA 4I39A 5F1FA 5CXWA 1MKIA 5EOEA 4QY6A 3BY8A 4FD8A 3ZVWA 1ES4A 5FI7A 4JF6A 2NUTC 3T1XA 2PD8A 3ZNYA 5HX9A 4QY5A 3LY3A 2HF6A 2ZM8A 5HPFA 4PAUA 2ZMFA 4QJGA 5KSHA 4EEPA 3MFDA 1WE4A 1K6SA 4IEDA 5FEGA 3F1NB 2VK3A 1YLZA 3NOUC 5E2GA 1RCJA 2PAVP 4WUJA 3N6IA 5FI6A 1PZPA 5E43A 3Q81A 2C6WB 4NETA 4S2LA 1G6AA 4BBTA 3AGDA 3NDEA 3BFFA 2PRFA 1GA9A 4KG5A 3GQZA 3T4JA 1STZA 4FH4A 3TSGA 4YFMA 3GDIA 3OPHA 1RGZA 1BYWA 3A3FA 3A3EA 4WMCA 5FAOA 3F1OA 4XT2B 3UMEA 4LV1A 1OTIA 1V9YA 2V0WA 1N9NA 4GD6A 2JKRM 4NXEA 3RJUA 4O7DA 2Y2MA 4G3KA 4C3QA 3BM6A 1GA0A 3LIFA 3RXWA 1H8MA 1DY6A 1LHYA 1G28A 3KSIA 4DDYA 4HESA 1CEGA 5GLAA 2EWWA 2W27A 2XFSA 3SH8A 1ERQA 4MBFA 3Q82A 2Y91A 3OLOA 4EUVA 5A8BA 3OPLA 1TD5A 3ZGAB 2ACGA 3B47A 1GSVA 3EEAA 2PHYA 3W8KA 2L4RA 4E3LA 1OPXA 3L7HA 5M18A 3LY4A 3KSGA 3ITBA 5HWTA 3H7WA 2ZLYA 4GHIB 5E2FA 3OPRA 2ZMVA 1K54C 4IHQA 3HLWA 2WKIA 3KSFA 5HW3A 4HI4A 3P01A 3IH8A 4CPKA 1MBLA 3SS3A 1BLPA 3S1YA 1OTEA 5EUAA 1XP4A 3MF0A 2X02A 3DTIA 3ZHHA 4KQOA 5G18A 4HY8A 2R9WA 4HOIA 4OVDA 5J8XA 4E3OA 4N9KA 4EEUA 4UA9A 4X6TA 1KVMA 2DNSA 4S2JA 1GHPA 4HH2A 5CECA 2KDKA 1UWNX 3NOPC 4KG6A 5G4ZA 4B4XA 4F3LB 2BTFP 3R7WB 1K56A 4Q8IA 2ZM0A 1BUEA 2XK1A 4MDZA 3E2KA 4KZ3A 3HLCA 3IBJA 1PI4A 4MN7A 5GLDA 5C5KA 3PBQA 2EX8A 4RVAA 2HJEA 3A0SA 4P6ZS 2CC1A 1K0KA 2Q0OA 1FQGA 2PBDP 4E3KA 2XSSA 1D1JA 2Y2IA 4DE1A 4Y0TA 3H82B 2Y2JA 4R1GA 1IFQA 1K55A 1LLBA 3F1OB 1L0GA 3MQ0A 3VP4A 1VEUA 4EQIA 1Y54A 1MXOA 3QP4A 3GV9A 3UO9A 2IWBA 4GDBA 3UE1A 1TS0A 4KZAA 1DP8A 1YAXA 3UMDA 3HLDA 5GLBA 4BD0A 1UGUA 3ITAA 2HPBA 4B93A 4GZBA 3T4OA 5HPIA 1LT0A 2JKRI 4Z1WA 1MKMA 5I5LA 5EVLA 1MZUA 5IU1A 4KZBA 3TG9A 1JWZA 5FQQA 3G31A 5KSCA 2V8CA 3ZNTA 2RL3A 4G3VA 1ALQA 1OMEA 3VMAA 4R3BA 5DTKA 4XUXA 4HNBA 1ZHHB 3ZG0A 3PAGA 3NIAA 2Y59A 3QP1A 3SS4A 3BYDA 2Y2KA 4KZ5A 3UB7A 4HQAA 1SZVA 4WZ5C 3CAXA 2J80A 3IQAA 3WS4A 1XFNA 1YLTA 1PW1A 2WAFA 2QYBA 5L07A 2I72A 4KQQA 1DJAA 2QWSA 4Z9QA 4IBRA 1PFLA 2OLVA 3CITA 3E4QA 3UPOA 4HBUA 1WYCA 2WGWB 4U0TA 1ZG6A 5EFWA 5AQ7A 3V3RA 3O88A 1SHVA 2QPNA 5CERA 1DJCA 3IHAA 3LR0A 2HGVA 2ZOIA 2G2UA 3BLSA 1XFQA 2EA9A 3RH8B 3UE0A 5G4YA 1YMSA 3C5AA 2XDMA 1LL8A 4NG2A 3Q7VA 3LICA 3LUQA 3LIEA 5HAPA 3NJAA 1NZOA 1IELA 3EQUA 4YINA 4B9OA 1W63Q 3BEBA 1F2KA 2VJWA 1PWGA 3C2WA 5DFYA 3IWOA 5KIZA 2E8JA 4DXCA 4BD1A 1AWIA 4RA7A 4X1LA 4N92A 4DE2A 4JXVA 1T1BA 2PR5A 5EVIA 3NOTC 3WS0A 2O0YA 4R70A 1BLHA 1LL5A 4ESPA 1IYPA 5FQJA 3T4SA 1CI9A 2Y2PA 4NEED 4QPRA 4X1MA 3O3VA 3MQOA 3R4KA 4K08A 1IKIA 5FATA 2V9AA 3K3CA 2QMIA 3FKWA 3ZG7B 4MMNA 1MWTA 3C7VA 3M6BA 3TJZC 1J3WA 3DWZA 5DF9A 4LGWA 4OQHA 3OPPA 4CLCC 1H3QA 4E3IA 3UB5P 1L0FA 3LEZA 2KLIA 4LENA 3HREA 3PXPA 2ZC3B 4WEJA 2P08A 4E3MA 1XGIA 2O9BA 4K91A 2WKQA 4ID4A 3S7PA 2YKFA 3GVBA 3TOIA 3NI9A 5J3WA 2XH9A 2OAQ1 2XRNA 3KO6A 3NCKA 4XUZA 4HH3A 3MSHA 3DAVA 1HLUP 2D02A 4JKTA 1CI8A 3S7QA 4EW7A 2J9PA 1S0WA 3PAEA 1NYYA 3KYEA 4OPYA 5CHMA 4S2IA 4ETXA 4BBUA 1C3BA 4DKIA 3E4OA 2EWVA 3PHYA 3MZFA 1VM1A 5M19A 4U0XA 4PM6A 1E3UA 3GECA 1ZTUA 1K56D 4FUWA 3UB9A 1MPLA 3T1SA 5FAQA 2XA7M 3BJNA 4ZJ3A 4MN5A 1G6OA 1XX2A 2BG1A 3MXRA 3UE3A 5IHVA 2P7JA 1MC0A 4OONA 1F5MA 1EW0A 4QHCA 1SKFA 3P7NA 4P0MA 4R3JA 5CHJA 3OCNA 4HJ3A 5JYOA 2Y2OA 2GJ3A 3HL9A 4WLAA 1BZAA 3G2YA 1LSVA 4Y0OA 2OAP1 3BQ8A 2R9XA 5KZHA 3ZQ5A 3HJIA 3BWLA 3MS6A 5J7EA 3LO7A 2Q9NA 2M7VA 4Y7PA 3N4IA 1XXMA 1TS8A 4RYEA 5FQKA 3OCLA 5DVAA 2ZQ8A 4GN2A 4OP8A 3NULA 4MNRA 1FSWA 2WGIA 4MEZA 4OQIA 1TDGA 3WS1A 1XJ2A 2JBFA 5CRFA
chains in the Genus database with same CATH topology
3SS3A 1L0EA 1BLPA 3S1YA 1ONHA 2P9VB 4P87A 2ZC6B 5EUAA 1Q2PA 1XP4A 4K0WA 4N1XA 2X02A 4BLMA 3ZHHA 3PBTA 3MXSA 1SCWA 1CK3A 4KQOA 1PYYA 5G18A 4DF6A 2R9WA 4OVDA 3DWKA 5J8XA 3V39A 4E3OA 2V20A 4N9KA 4UA9A 2EX2A 1IYOA 4PMAA 4X6TA 2QZ6A 1KVMA 2DNSA 3Q07A 4S2JA 5CEDA 1J9MA 1GHPA 2XF3A 5D3OA 1IEMA 3MZEA 5CECA 1FOFA 2IWCA 3NY4A 2XR0A 4LCLA 1L0DA 2WKHA 4R4SA 4X53A 4KG6A 3ZDJA 3A3DA 3BLMA 3OC2A 4N1HA 5F1GA 4RX3A 4X55A 4S2OA 3IH9A 3IH8A 2ZQAA 3A3JA 4B4XA 4E3NA 4FH2A 4X56A 1K56A 1YQSA 4NK3A 4OQGA 5I94A 1SDNA 3M2JA 2WZZA 1K57C 3JYIA 4P6BA 4OPZA 4Q8IA 2ZM0A 4BQMA 2OSUA 1BUEA 4PM8A 5GLCA 1PI5A 3MBZA 2XK1A 1XPBA 5A90A 5FDHA 5FQ9A 2Q9MA 3E2KA 1YLJA 3GSGA 1BT5A 4DE0A 4KZ3A 3HLCA 1PI4A 1PWDA 3HLFA 1EI5A 2PBYA 4KZ9A 4X69A 3ZG8B 1FCOA 4JF5A 5GLDA 5CTNA 4QB8A 2JC7A 3PBQA 2EX8A 4RVAA 2Y4AA 3M2KA 3V50A 1ES2A 3IHBA 1GHMA 4S2NC 2CC1A 1PW8A 4CJNA 1XGJA 4KG2A 2H0YA 5FA7A 1FQGA 1JWPA 3IT9A 1K6RA 4E3KA 2P74A 1BSGA 4GOGA 2Y2IA 4DE1A 4Y0TA 1KGEA 2ZQDA 2Y2JA 3UPNA 1W7FA 1YLYA 4D2OA 4R1GA 2DCFA 4DXBA 2V1ZA 3Q1FA 3Q7VB 1K55A 5CEBA 4L0LA 3GTCA 1LLBA 1IKGA 2EX6A 5A93A 1NZUA 4OLDA 2JCHA 5HARA 4JF4A 5CGSA 2WADA 2XD5A 3WWXA 1L0GA 3RJUA 5TFQA 3G4PA 5EECA 5EVIC 2ZQ7A 3VP4A 2ZQ9A 5EVID 1U60A 4EQIA 1Y54A 1YLWA 1TDLA 4UAAA 5EOOA 3HLGA 1MXOA 3ZFZA 3GV9A 5FI2A 3UO9A 3BFGA 3IWQA 3W4PA 3IF5A 3IXDA 2IWBA 3VSKA 4GDBA 3UE1A 4ZDXA 2J9OA 4KZAA 3WS2A 3VFFA 3HLDA 3M6HA 5EVIB 5GLBA 4B4ZA 4BD0A 4EBLA 1IYQA 3ITAA 4OOYA 5DTTA 5JYPA 2HPBA 3BFCA 2XQZA 2WUQA 2ZMAA 4GZBA 4R23A 5AQAA 4R4RA 1GHIA 4F94A 4WELA 3CZDA 1LI0A 5EVLA 4KZBA 3TG9A 1JWZA 2Z2MB 3NBLA 5FQQA 1G68A 1K25A 3G31A 3ISGA 4EBPA 3ZNTA 5KSCA 2EXAA 4UA6A 3IXGA 2RL3A 2P9VA 1ALQA 1OMEA 3I7JA 3IF6C 4C6YA 3VMAA 4R3BA 5DTKA 4XUXA 1XA1A 3A3IA 3G2ZA 4DE3A 3ZG0A 1NJ4A 3PAGA 4MBHA 3NIAA 2Y59A 3P98A 3SS4A 5CTMA 3N7WA 3BYDA 2Y2KA 5A92A 1I2WA 4KZ5A 1SDEA 4BL3A 4PM9A 1ZKJA 3C4OA 3IXHA 2HDSA 2OV5A 4WZ5C 5L2FA 4JXGA 2HP6A 3IQAA 3WS4A 3IF6B 1QMEA 4OOMA 1YLTA 1HVBA 1TVFA 1ESUA 1PW1A 1XA7A 2WAFA 3UN7A 1RP5A 4S2KA 3N8LA 3BFDA 3FZCA 2WKEA 1HTZA 1W8QA 2J8YA 2I72A 4KQQA 3WS5A 3CJMA 3FYZA 1DJAA 3PBRA 4Z9QA 4KZ7A 4IBRA 3CG5A 3WRZA 2OLVA 5U47A 4PM7A 3V5MA 3FKVA 3SH7A 4KZ4A 3UPOA 3BFEA 2B5RA 2Y2NA 4HBUA 1WYCA 2WGWB 4U0TA 3DW0A 2DRWA 2JE5A 1FSYA 1ZG6A 4JXWA 1M6KA 2A3UA 4H8RA 5E2EA 2PU2A 1N9BA 5AQ7A 3V3RA 3AGFA 3O88A 5HAIA 1KDWA 1E25A 1K57A 1SHVA 4WZ4A 2QPNA 2FFFB 5CERA 4WYYA 2EFUA 1DJCA 3IHAA 4ZJ1A 2Y2LA 3N8SA 4MBKA 3BLSA 3UNWA 2G2UA 1KE4A 3VP3A 4LV2A 5HFOA 3UE0A 2ZC7A 5M1AA 1E3UD 4FCFA 5TR7A 4EWFA 2FFYA 4QU3A 5HL1A 1YMSA 3C5AA 1FR6A 4C3QA 2XDMA 4WM9A 3S22A 2WGVA 3Q7VA 1PZOA 3C4PA 1NRFA 4MLLA 5GHZA 4S2NA 1WYBA 3ZVTA 3P09A 4QD4A 1ESIA 4OQ0A 5HAPA 1H8YA 1NZOA 1O07A 1JTDA 1YM1A 1BTLA 1IELA 3G32A 3EQUA 1MWSA 2EXBA 2BLSA 4YINA 3V3SA 1EWZA 2WAEA 2H10A 3BEBA 3PBSA 2ZM2A 4OPRA 2V2FF 1LI9A 4IBXA 1PWGA 1W79A 1VQQA 3IWOA 4DXCA 4BD1A 3D4FA 2A49A 4OLGA 4JXSA 1JTGA 4RA7A 4OOLA 2ZC5B 4P85A 4BJPA 3FWLA 3Q7ZA 4N92A 4JXVA 4DE2A 1IYSA 3QNCA 2H0TA 5FAPA 3S4XA 5EVIA 3WS0A 1BLHA 4UA7A 1TEMA 5DTSA 4B88A 2XLNA 1LL5A 1ONGA 3G34A 1IYPA 5FQJA 1DJBA 4WEKA 1CI9A 2XEPA 2Y2PA 3LCEA 4PPRA 4OH0A 3O3VA 3VP0A 1JWVA 1HD8A 3HLBA 1PWCA 1IKIA 5FATA 4A5RA 4LCMA 5FASA 2QMIA 3FKWA 2J7VA 5AQBA 2UWXA 3HUOA 4GNUA 1K38A 5CGWA 5EE8A 2VGJA 5BOHA 3ZG7B 3UPPA 2Z2LB 4N9LA 1ES5A 1K54A 1MWTA 3C7VA 5AQ9A 3M6BA 5CHUA 3UDXA 4K0XA 3DWZA 2HDUA 3B3XA 3IF6A 2WK0A 3BRMA 5DF9A 4OQHA 4LV3A 1L2SA 3SH9A 3OPPA 3VP2A 4RX2A 4DRTA 4E3IA 1JVJA 1L0FA 3UY6A 3LEZA 1ZG4A 1H8ZA 1KDSA 2XD1A 4LENA 3NDGA 2OLUA 1MWUA 2RCXA 3HREA 4BENA 4ZTKA 3MKFA 2EX9A 2ZC3B 2HP9A 2HDRA 1N4OA 2HP5A 4FSFA 4JBFA 4WEJA 5CXWA 1ES3A 1MKIA 5EOEA 4E3MA 5F1FA 1XGIA 1AXBA 4QY6A 3DTMA 4WZ5A 4M3KA 4FD8A 4K91A 3ZVWA 3SOIA 1ES4A 1GCEA 2Y2GA 4U3TA 5FI7A 4ID4A 3ZG9B 4KZ6A 2WGWA 4EBNA 3O87A 2C5WB 1KVLA 4E6WA 4JF6A 3GVBA 3TOIA 3NI9A 2PU4A 3ZNYA 2Y55A 2XH9A 5HX9A 1I2SA 4QY5A 3PBOA 2ZD8A 5FQMA 3VP1A 1RGYA 3LY3A 2ZM8A 3NCKA 4XUZA 3N8RA 4OPQA 4QJGA 3NC8A 5KSHA 3MFDA 4Y0UA 1WE4A 3GMWA 3IWIA 1K6SA 4IEDA 4X68A 3W4OA 4S2MA 4JKTA 1XKZA 1CI8A 4EV4A 1QMFA 2X71A 1YLZA 2J9PA 3UDFA 3VFHA 5E2GA 4ZJ2A 1RCJA 1S0WA 3RXXA 3PAEA 1NYYA 3HVFA 3N6IA 4OPYA 2IWDA 5FI6A 5CHMA 1PZPA 1BULA 5EPHA 4KENB 5DF7A 5E43A 1KGGA 1PIOA 1YT4A 4S2IA 2WYXA 3Q81A 1C3BA 1NY0A 4OP5A 2C6WB 4NETA 4DKIA 3ZCZA 4S2LA 3IXBA 3HUNA 1G6AA 3MZFA 3W4QA 3AGDA 1VM1A 5M19A 1FCNA 3GRJA 3NDEA 3BFFA 4U0XA 4BL2A 1GA9A 1E3UA 4PM6A 3HBRA 4KG5A 1K56D 4PM5A 3GQZA 1MWRA 4FH4A 3C7UA 2WZXA 3CMZA 3TSGA 3SS5A 1Q2QA 5E2HA 4GB7A 1MPLA 4YFMA 4R0QA 3VOYA 3OPHA 1RGZA 3WRTA 5FAQA 4ZJ3A 5A91A 3A3FA 2EFXA 3A3EA 4S2PA 4WMCA 4WMCD 5FAOA 1YLPA 2H5SA 3O86A 1S6RA 4GD8A 1HZOA 3PBNA 1XX2A 3OZHA 2BG1A 2ZJ9A 3MXRA 4LV1A 2G2WA 3UE3A 3HUMA 5IHVA 4JLFA 1ZC2A 4GD6A 4OONA 3E2LA 2E8IA 4XXRA 5KMWA 1E4DA 4QHCA 1SKFA 2Y2HA 2Y2MA 2HDQA 3G35A 4KQRA 3BM6A 4O7DA 4P0MA 1GA0A 4R3JA 5FQIA 5FSRA 1W8YA 4WBGA 2ZC4B 5CHJA 5F82A 1BLSA 1BLCA 2Y2QA 4OKPA 4UHUA 1FCMA 3RXWA 4KZ8A 2XFTA 5CGXA 1NXYA 1DY6A 1LHYA 3GR2A 3OCNA 4GDNA 3MKEA 4DDYA 4HESA 4E3JA 1CEGA 5GLAA 5JYOA 2Y2OA 1K4EA 2XFSA 3HL9A 5DF8A 1BZAA 3G2YA 3SH8A 4IVIA 1ERQA 1M40A 3PTEA 3Q82A 1K55C 4MBFA 3EQVA 4E6XA 2Y91A 4Y0OA 5GL9A 1I5QA 1Z6FA 2R9XA 1EROA 3OPLA 5GHYA 5KZHA 1MY8A 4HEFA 4JPMA 1LL9A 3UDIA 4ZAMA 3VOZA 1ERMA 1O7EA 3ZGAB 3LO7A 2Q9NA 4Y7PA 4EUZA 3N4IA 1YMXA 1XXMA 2ZQCA 3QHYA 3BECA 2VGKA 4ZBEA 2GDNA 4IVKA 5F83A 3MZDA 3QNBA 4RYEA 5TGFA 5FQKA 3W8KA 3OCLA 4E3LA 1H5XA 5M18A 5DVAA 4DDSA 5GHXA 1NYMA 1W5DA 3LY4A 2ZQ8A 4GN2A 1KE3A 5HAQA 3ITBA 1KGFA 4LV0A 4OP8A 3VSLA 3G30A 2ZLYA 5E2FA 3OPRA 2XGNA 1K54C 4MNRA 1FSWA 2WGIA 3HLWA 1FR1A 2WKIA 3AGEA 4MEZA 3HLEA 4OQIA 1TDGA 3ZG5A 5HW3A 4GKUA 3WS1A 1KE0A 1K4FA 4HBTA 2JBFA 2X01A 4C75A 5CRFA 1CEFA 3FV7A 4CPKA 1MBLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SS3 A;  1L0E A;  1BLP A;  3S1Y A;  1ONH A;  2P9V B;  4P87 A;  2ZC6 B;  5EUA A;  1Q2P A;  1XP4 A;  4K0W A;  4N1X A;  2X02 A;  4BLM A;  3ZHH A;  3PBT A;  3MXS A;  1SCW A;  1CK3 A;  4KQO A;  1PYY A;  5G18 A;  4DF6 A;  2R9W A;  4OVD A;  3DWK A;  5J8X A;  3V39 A;  4E3O A;  2V20 A;  4N9K A;  4UA9 A;  2EX2 A;  1IYO A;  4PMA A;  4X6T A;  2QZ6 A;  1KVM A;  2DNS A;  3Q07 A;  4S2J A;  5CED A;  1J9M A;  1GHP A;  2XF3 A;  5D3O A;  1IEM A;  3MZE A;  5CEC A;  1FOF A;  2IWC A;  3NY4 A;  2XR0 A;  4LCL A;  1L0D A;  2WKH A;  4R4S A;  4X53 A;  4KG6 A;  3ZDJ A;  3A3D A;  3BLM A;  3OC2 A;  4N1H A;  5F1G A;  4RX3 A;  4X55 A;  4S2O A;  3IH9 A;  3IH8 A;  2ZQA A;  3A3J A;  4B4X A;  4E3N A;  4FH2 A;  4X56 A;  1K56 A;  1YQS A;  4NK3 A;  4OQG A;  5I94 A;  1SDN A;  3M2J A;  2WZZ A;  1K57 C;  3JYI A;  4P6B A;  4OPZ A;  4Q8I A;  2ZM0 A;  4BQM A;  2OSU A;  1BUE A;  4PM8 A;  5GLC A;  1PI5 A;  3MBZ A;  2XK1 A;  1XPB A;  5A90 A;  5FDH A;  5FQ9 A;  2Q9M A;  3E2K A;  1YLJ A;  3GSG A;  1BT5 A;  4DE0 A;  4KZ3 A;  3HLC A;  1PI4 A;  1PWD A;  3HLF A;  1EI5 A;  2PBY A;  4KZ9 A;  4X69 A;  3ZG8 B;  1FCO A;  4JF5 A;  5GLD A;  5CTN A;  4QB8 A;  2JC7 A;  3PBQ A;  2EX8 A;  4RVA A;  2Y4A A;  3M2K A;  3V50 A;  1ES2 A;  3IHB A;  1GHM A;  4S2N C;  2CC1 A;  1PW8 A;  4CJN A;  1XGJ A;  4KG2 A;  2H0Y A;  5FA7 A;  1FQG A;  1JWP A;  3IT9 A;  1K6R A;  4E3K A;  2P74 A;  1BSG A;  4GOG A;  2Y2I A;  4DE1 A;  4Y0T A;  1KGE A;  2ZQD A;  2Y2J A;  3UPN A;  1W7F A;  1YLY A;  4D2O A;  4R1G A;  2DCF A;  4DXB A;  2V1Z A;  3Q1F A;  3Q7V B;  1K55 A;  5CEB A;  4L0L A;  3GTC A;  1LLB A;  1IKG A;  2EX6 A;  5A93 A;  1NZU A;  4OLD A;  2JCH A;  5HAR A;  4JF4 A;  5CGS A;  2WAD A;  2XD5 A;  3WWX A;  1L0G A;  3RJU A;  5TFQ A;  3G4P A;  5EEC A;  5EVI C;  2ZQ7 A;  3VP4 A;  2ZQ9 A;  5EVI D;  1U60 A;  4EQI A;  1Y54 A;  1YLW A;  1TDL A;  4UAA A;  5EOO A;  3HLG A;  1MXO A;  3ZFZ A;  3GV9 A;  5FI2 A;  3UO9 A;  3BFG A;  3IWQ A;  3W4P A;  3IF5 A;  3IXD A;  2IWB A;  3VSK A;  4GDB A;  3UE1 A;  4ZDX A;  2J9O A;  4KZA A;  3WS2 A;  3VFF A;  3HLD A;  3M6H A;  5EVI B;  5GLB A;  4B4Z A;  4BD0 A;  4EBL A;  1IYQ A;  3ITA A;  4OOY A;  5DTT A;  5JYP A;  2HPB A;  3BFC A;  2XQZ A;  2WUQ A;  2ZMA A;  4GZB A;  4R23 A;  5AQA A;  4R4R A;  1GHI A;  4F94 A;  4WEL A;  3CZD A;  1LI0 A;  5EVL A;  4KZB A;  3TG9 A;  1JWZ A;  2Z2M B;  3NBL A;  5FQQ A;  1G68 A;  1K25 A;  3G31 A;  3ISG A;  4EBP A;  3ZNT A;  5KSC A;  2EXA A;  4UA6 A;  3IXG A;  2RL3 A;  2P9V A;  1ALQ A;  1OME A;  3I7J A;  3IF6 C;  4C6Y A;  3VMA A;  4R3B A;  5DTK A;  4XUX A;  1XA1 A;  3A3I A;  3G2Z A;  4DE3 A;  3ZG0 A;  1NJ4 A;  3PAG A;  4MBH A;  3NIA A;  2Y59 A;  3P98 A;  3SS4 A;  5CTM A;  3N7W A;  3BYD A;  2Y2K A;  5A92 A;  1I2W A;  4KZ5 A;  1SDE A;  4BL3 A;  4PM9 A;  1ZKJ A;  3C4O A;  3IXH A;  2HDS A;  2OV5 A;  4WZ5 C;  5L2F A;  4JXG A;  2HP6 A;  3IQA A;  3WS4 A;  3IF6 B;  1QME A;  4OOM A;  1YLT A;  1HVB A;  1TVF A;  1ESU A;  1PW1 A;  1XA7 A;  2WAF A;  3UN7 A;  1RP5 A;  4S2K A;  3N8L A;  3BFD A;  3FZC A;  2WKE A;  1HTZ A;  1W8Q A;  2J8Y A;  2I72 A;  4KQQ A;  3WS5 A;  3CJM A;  3FYZ A;  1DJA A;  3PBR A;  4Z9Q A;  4KZ7 A;  4IBR A;  3CG5 A;  3WRZ A;  2OLV A;  5U47 A;  4PM7 A;  3V5M A;  3FKV A;  3SH7 A;  4KZ4 A;  3UPO A;  3BFE A;  2B5R A;  2Y2N A;  4HBU A;  1WYC A;  2WGW B;  4U0T A;  3DW0 A;  2DRW A;  2JE5 A;  1FSY A;  1ZG6 A;  4JXW A;  1M6K A;  2A3U A;  4H8R A;  5E2E A;  2PU2 A;  1N9B A;  5AQ7 A;  3V3R A;  3AGF A;  3O88 A;  5HAI A;  1KDW A;  1E25 A;  1K57 A;  1SHV A;  4WZ4 A;  2QPN A;  2FFF B;  5CER A;  4WYY A;  2EFU A;  1DJC A;  3IHA A;  4ZJ1 A;  2Y2L A;  3N8S A;  4MBK A;  3BLS A;  3UNW A;  2G2U A;  1KE4 A;  3VP3 A;  4LV2 A;  5HFO A;  3UE0 A;  2ZC7 A;  5M1A A;  1E3U D;  4FCF A;  5TR7 A;  4EWF A;  2FFY A;  4QU3 A;  5HL1 A;  1YMS A;  3C5A A;  1FR6 A;  4C3Q A;  2XDM A;  4WM9 A;  3S22 A;  2WGV A;  3Q7V A;  1PZO A;  3C4P A;  1NRF A;  4MLL A;  5GHZ A;  4S2N A;  1WYB A;  3ZVT A;  3P09 A;  4QD4 A;  1ESI A;  4OQ0 A;  5HAP A;  1H8Y A;  1NZO A;  1O07 A;  1JTD A;  1YM1 A;  1BTL A;  1IEL A;  3G32 A;  3EQU A;  1MWS A;  2EXB A;  2BLS A;  4YIN A;  3V3S A;  1EWZ A;  2WAE A;  2H10 A;  3BEB A;  3PBS A;  2ZM2 A;  4OPR A;  2V2F F;  1LI9 A;  4IBX A;  1PWG A;  1W79 A;  1VQQ A;  3IWO A;  4DXC A;  4BD1 A;  3D4F A;  2A49 A;  4OLG A;  4JXS A;  1JTG A;  4RA7 A;  4OOL A;  2ZC5 B;  4P85 A;  4BJP A;  3FWL A;  3Q7Z A;  4N92 A;  4JXV A;  4DE2 A;  1IYS A;  3QNC A;  2H0T A;  5FAP A;  3S4X A;  5EVI A;  3WS0 A;  1BLH A;  4UA7 A;  1TEM A;  5DTS A;  4B88 A;  2XLN A;  1LL5 A;  1ONG A;  3G34 A;  1IYP A;  5FQJ A;  1DJB A;  4WEK A;  1CI9 A;  2XEP A;  2Y2P A;  3LCE A;  4PPR A;  4OH0 A;  3O3V A;  3VP0 A;  1JWV A;  1HD8 A;  3HLB A;  1PWC A;  1IKI A;  5FAT A;  4A5R A;  4LCM A;  5FAS A;  2QMI A;  3FKW A;  2J7V A;  5AQB A;  2UWX A;  3HUO A;  4GNU A;  1K38 A;  5CGW A;  5EE8 A;  2VGJ A;  5BOH A;  3ZG7 B;  3UPP A;  2Z2L B;  4N9L A;  1ES5 A;  1K54 A;  1MWT A;  3C7V A;  5AQ9 A;  3M6B A;  5CHU A;  3UDX A;  4K0X A;  3DWZ A;  2HDU A;  3B3X A;  3IF6 A;  2WK0 A;  3BRM A;  5DF9 A;  4OQH A;  4LV3 A;  1L2S A;  3SH9 A;  3OPP A;  3VP2 A;  4RX2 A;  4DRT A;  4E3I A;  1JVJ A;  1L0F A;  3UY6 A;  3LEZ A;  1ZG4 A;  1H8Z A;  1KDS A;  2XD1 A;  4LEN A;  3NDG A;  2OLU A;  1MWU A;  2RCX A;  3HRE A;  4BEN A;  4ZTK A;  3MKF A;  2EX9 A;  2ZC3 B;  2HP9 A;  2HDR A;  1N4O A;  2HP5 A;  4FSF A;  4JBF A;  4WEJ A;  5CXW A;  1ES3 A;  1MKI A;  5EOE A;  4E3M A;  5F1F A;  1XGI A;  1AXB A;  4QY6 A;  3DTM A;  4WZ5 A;  4M3K A;  4FD8 A;  4K91 A;  3ZVW A;  3SOI A;  1ES4 A;  1GCE A;  2Y2G A;  4U3T A;  5FI7 A;  4ID4 A;  3ZG9 B;  4KZ6 A;  2WGW A;  4EBN A;  3O87 A;  2C5W B;  1KVL A;  4E6W A;  4JF6 A;  3GVB A;  3TOI A;  3NI9 A;  2PU4 A;  3ZNY A;  2Y55 A;  2XH9 A;  5HX9 A;  1I2S A;  4QY5 A;  3PBO A;  2ZD8 A;  5FQM A;  3VP1 A;  1RGY A;  3LY3 A;  2ZM8 A;  3NCK A;  4XUZ A;  3N8R A;  4OPQ A;  4QJG A;  3NC8 A;  5KSH A;  3MFD A;  4Y0U A;  1WE4 A;  3GMW A;  3IWI A;  1K6S A;  4IED A;  4X68 A;  3W4O A;  4S2M A;  4JKT A;  1XKZ A;  1CI8 A;  4EV4 A;  1QMF A;  2X71 A;  1YLZ A;  2J9P A;  3UDF A;  3VFH A;  5E2G A;  4ZJ2 A;  1RCJ A;  1S0W A;  3RXX A;  3PAE A;  1NYY A;  3HVF A;  3N6I A;  4OPY A;  2IWD A;  5FI6 A;  5CHM A;  1PZP A;  1BUL A;  5EPH A;  4KEN B;  5DF7 A;  5E43 A;  1KGG A;  1PIO A;  1YT4 A;  4S2I A;  2WYX A;  3Q81 A;  1C3B A;  1NY0 A;  4OP5 A;  2C6W B;  4NET A;  4DKI A;  3ZCZ A;  4S2L A;  3IXB A;  3HUN A;  1G6A A;  3MZF A;  3W4Q A;  3AGD A;  1VM1 A;  5M19 A;  1FCN A;  3GRJ A;  3NDE A;  3BFF A;  4U0X A;  4BL2 A;  1GA9 A;  1E3U A;  4PM6 A;  3HBR A;  4KG5 A;  1K56 D;  4PM5 A;  3GQZ A;  1MWR A;  4FH4 A;  3C7U A;  2WZX A;  3CMZ A;  3TSG A;  3SS5 A;  1Q2Q A;  5E2H A;  4GB7 A;  1MPL A;  4YFM A;  4R0Q A;  3VOY A;  3OPH A;  1RGZ A;  3WRT A;  5FAQ A;  4ZJ3 A;  5A91 A;  3A3F A;  2EFX A;  3A3E A;  4S2P A;  4WMC A;  4WMC D;  5FAO A;  1YLP A;  2H5S A;  3O86 A;  1S6R A;  4GD8 A;  1HZO A;  3PBN A;  1XX2 A;  3OZH A;  2BG1 A;  2ZJ9 A;  3MXR A;  4LV1 A;  2G2W A;  3UE3 A;  3HUM A;  5IHV A;  4JLF A;  1ZC2 A;  4GD6 A;  4OON A;  3E2L A;  2E8I A;  4XXR A;  5KMW A;  1E4D A;  4QHC A;  1SKF A;  2Y2H A;  2Y2M A;  2HDQ A;  3G35 A;  4KQR A;  3BM6 A;  4O7D A;  4P0M A;  1GA0 A;  4R3J A;  5FQI A;  5FSR A;  1W8Y A;  4WBG A;  2ZC4 B;  5CHJ A;  5F82 A;  1BLS A;  1BLC A;  2Y2Q A;  4OKP A;  4UHU A;  1FCM A;  3RXW A;  4KZ8 A;  2XFT A;  5CGX A;  1NXY A;  1DY6 A;  1LHY A;  3GR2 A;  3OCN A;  4GDN A;  3MKE A;  4DDY A;  4HES A;  4E3J A;  1CEG A;  5GLA A;  5JYO A;  2Y2O A;  1K4E A;  2XFS A;  3HL9 A;  5DF8 A;  1BZA A;  3G2Y A;  3SH8 A;  4IVI A;  1ERQ A;  1M40 A;  3PTE A;  3Q82 A;  1K55 C;  4MBF A;  3EQV A;  4E6X A;  2Y91 A;  4Y0O A;  5GL9 A;  1I5Q A;  1Z6F A;  2R9X A;  1ERO A;  3OPL A;  5GHY A;  5KZH A;  1MY8 A;  4HEF A;  4JPM A;  1LL9 A;  3UDI A;  4ZAM A;  3VOZ A;  1ERM A;  1O7E A;  3ZGA B;  3LO7 A;  2Q9N A;  4Y7P A;  4EUZ A;  3N4I A;  1YMX A;  1XXM A;  2ZQC A;  3QHY A;  3BEC A;  2VGK A;  4ZBE A;  2GDN A;  4IVK A;  5F83 A;  3MZD A;  3QNB A;  4RYE A;  5TGF A;  5FQK A;  3W8K A;  3OCL A;  4E3L A;  1H5X A;  5M18 A;  5DVA A;  4DDS A;  5GHX A;  1NYM A;  1W5D A;  3LY4 A;  2ZQ8 A;  4GN2 A;  1KE3 A;  5HAQ A;  3ITB A;  1KGF A;  4LV0 A;  4OP8 A;  3VSL A;  3G30 A;  2ZLY A;  5E2F A;  3OPR A;  2XGN A;  1K54 C;  4MNR A;  1FSW A;  2WGI A;  3HLW A;  1FR1 A;  2WKI A;  3AGE A;  4MEZ A;  3HLE A;  4OQI A;  1TDG A;  3ZG5 A;  5HW3 A;  4GKU A;  3WS1 A;  1KE0 A;  1K4F A;  4HBT A;  2JBF A;  2X01 A;  4C75 A;  5CRF A;  1CEF A;  3FV7 A;  4CPK A;  1MBL A; 
#chains in the Genus database with same CATH topology
 1UWP X;  2P9V B;  1Q2P A;  2WKR A;  4N1X A;  3BW6 A;  3A0V A;  1TF1 A;  1CK3 A;  3CLO A;  4DF6 A;  2V20 A;  3LEQ A;  2EX2 A;  4PMA A;  5CED A;  3JPU A;  1IEM A;  3MZE A;  2IWC A;  3NY4 A;  4HJ6 A;  3BLM A;  3OC2 A;  4RX3 A;  4S2O A;  3IH9 A;  2ZQA A;  4E3N A;  4NK3 A;  2ZBB A;  1SDN A;  3M2J A;  4L9E A;  1Z09 A;  4ARZ B;  2WZZ A;  1K57 C;  4OPZ A;  5TBM A;  1OJG A;  2VV6 A;  4O01 A;  4PM8 A;  1DP9 A;  1XPB A;  2BAS A;  5FQ9 A;  1YLJ A;  5L8M A;  1PWD A;  2D01 A;  3LID A;  3HLF A;  4KZ9 A;  3ZG8 B;  3M2K A;  2W3H A;  1ES2 A;  1GHM A;  1W63 M;  4S2N C;  1T18 A;  1K6R A;  1V9Z A;  3CI6 A;  4GOG A;  4CLC E;  1W7F A;  1YLY A;  4D2O A;  4DXB A;  3E98 A;  3GTC A;  1NZU A;  2JCH A;  2WAD A;  5EM1 A;  3WWX A;  5DJU A;  2FH5 A;  3G4P A;  3B42 A;  5F69 A;  5EVI D;  1YLW A;  3BFG A;  3LIB A;  3PYP A;  3WS2 A;  2K7S A;  4B4Z A;  2QKP A;  5DTT A;  2WUQ A;  5AQA A;  3B33 A;  1GHI A;  4F94 A;  4WEL A;  3CZD A;  5HL6 A;  4H6J A;  1K25 A;  1N9O A;  2EXA A;  2V1A A;  4UA6 A;  3I7J A;  3KYZ A;  5EVE A;  1XA1 A;  2HJ9 C;  4YWZ A;  2FZ0 A;  5HDS A;  3UB6 A;  5A92 A;  1I2W A;  1SDE A;  4DJ2 A;  4GS9 B;  3C4O A;  3IXH A;  2HDS A;  5F6A A;  4R3A A;  2HP6 A;  4OOM A;  1TVF A;  1HVB A;  3E4P A;  3UN7 A;  5HWV A;  1RP5 A;  3BFD A;  3FZC A;  2WKE A;  4Y5F A;  1W8Q A;  1T19 A;  3U2A A;  4YNR A;  2LB9 A;  4KZ4 A;  3BFE A;  2B5R A;  2Y2N A;  1FSY A;  2L1M A;  4JXW A;  2XA7 S;  5E2E A;  5EV0 A;  1N9B A;  3AGF A;  1KDW A;  3VV4 A;  1OJ5 A;  3N8S A;  3VP3 A;  2VZW A;  2A2L A;  2ZC7 A;  1E3U D;  4FCF A;  4EWF A;  4QU3 A;  5HL1 A;  5L09 A;  1GSW A;  4I5S A;  3KSH A;  3LYX A;  1PZO A;  3C4P A;  1NRF A;  4MLL A;  3IX8 A;  3P09 A;  4Q0H A;  4LRY C;  1ESI A;  4L9F A;  3CHW P;  3KYQ A;  3V3S A;  1EWZ A;  2WAE A;  2V2F F;  1LI9 A;  4Y2F A;  1VQQ A;  4WL9 A;  3LFV A;  4OOL A;  3FWL A;  3Q7Z A;  1IYS A;  3S4X A;  4B88 A;  2XLN A;  1DJB A;  2W3G A;  3T1Q B;  3CWF A;  4Y13 A;  4LCM A;  2J7V A;  5AQB A;  5CHU A;  4K0X A;  3IF6 A;  2WK0 A;  5HD5 A;  3EEH A;  1LSX A;  5AVF A;  3UY6 A;  2W1R A;  1H8Z A;  2XD1 A;  3NDG A;  3MKF A;  2EX9 A;  2HP9 A;  2HP5 A;  1YSP A;  4M3K A;  5HDD A;  2Y2G A;  2B02 A;  3TRC A;  3ZG9 B;  1PRQ A;  2K2N A;  1KVL A;  4E6W A;  3F1P A;  3H7W B;  2PU4 A;  3QP5 A;  4IUH A;  2Z6D A;  1I2S A;  3PBO A;  5FQM A;  1WA9 A;  3N8R A;  4OPQ A;  5FEF A;  3GMW A;  4X68 A;  3W4O A;  4EV4 A;  5AVE A;  1QMF A;  3FG8 A;  3UDF A;  4AFI A;  4IJG A;  2JKT M;  3IX4 A;  5HD3 A;  3RXX A;  4R38 A;  1BUL A;  4KEN B;  5DF7 A;  2B95 A;  1NY0 A;  4OP5 A;  3IXB A;  3CUE A;  3W4Q A;  1FCN A;  3GRJ A;  2J3T D;  1L3L A;  4NXB A;  4JGR A;  3HBR A;  4PM5 A;  2L0W A;  2OOL A;  3C7U A;  2WZX A;  3CMZ A;  4ZRR A;  3SS5 A;  1Q2Q A;  4BWI A;  4JGP A;  3WRT A;  4S2P A;  4WMC D;  3O86 A;  4GD8 A;  5DJT A;  1HZO A;  4GLQ A;  3OZH A;  2G2W A;  4JLF A;  1YPR A;  1F9I A;  2E8I A;  3E2L A;  4XXR A;  1E4D A;  2KOI A;  4Y17 A;  3ICY A;  5FQI A;  3G35 A;  5FSR A;  4Y15 A;  4WBG A;  1W8Y A;  2PYP A;  2ZC4 B;  4M4X A;  1BLS A;  1BLC A;  4OKP A;  4UHU A;  5K5B A;  3FPW A;  5CGX A;  1NXY A;  3CPT A;  3GR2 A;  4GDN A;  2VX8 A;  5F68 A;  2GNX A;  5HSQ A;  2I9V A;  3T4Q A;  1K4E A;  5DF8 A;  4IVI A;  4E6X A;  1K55 C;  3EQV A;  2Y8H A;  3SZT A;  5F5Y A;  2AVX A;  2A24 A;  1ERO A;  3MR0 A;  3S7O A;  4JPM A;  2W3E A;  1LL9 A;  4HHD A;  1DP6 A;  1H0M A;  1ERM A;  4I3A A;  4EUZ A;  1OT6 A;  2ZQC A;  3ULF A;  3EWK A;  4ZBE A;  5HWW A;  3QP2 A;  3UB8 A;  2OWH A;  4CQH A;  1XJ4 A;  4IVK A;  3QP6 A;  3BQA A;  1XJ3 A;  1VEU B;  1KE3 A;  4LV0 A;  3G30 A;  4O8G A;  3AGE A;  3ZG5 A;  3F1N A;  4GKU A;  1KE0 A;  1K4F A;  4HBT A;  2X01 A;  3FV7 A;  1ONH A;  3L9K A;  3PBT A;  3MXS A;  1SCW A;  5TJJ A;  3DWK A;  3A0R A;  2M1C A;  3C30 A;  3V39 A;  1SKO A;  2W0N A;  1J9M A;  2XF3 A;  5D3O A;  1FOF A;  4LCL A;  3A3D A;  4N1H A;  4X55 A;  3T4K A;  1A0K A;  3A3J A;  4XT2 A;  4X56 A;  2UV0 E;  4OQG A;  1YQS A;  4P6B A;  4IUK A;  2VV8 A;  4BQM A;  5FDH A;  2Q9M A;  1BT5 A;  5DFX A;  3DTK A;  2QJ7 A;  5CTN A;  4QB8 A;  2MJ6 A;  3IHB A;  2XRO A;  3D72 A;  1YSQ A;  2JKT I;  2P74 A;  1KGE A;  2ZQD A;  1S67 L;  4UQI M;  2P04 A;  3VE3 A;  2DCF A;  2V1Z A;  3Q1F A;  3Q7V B;  5CX7 A;  4GJ4 A;  1P97 A;  1IKG A;  2EX6 A;  5A93 A;  4OLD A;  5HAR A;  2XD5 A;  1OTA A;  3O5Y A;  1P0Z A;  3V67 A;  5EEC A;  5EVI C;  2ZQ7 A;  3TW8 A;  2PD7 A;  4UAA A;  5EOO A;  3T4T A;  1CQA A;  2VKS A;  1CJF A;  1S4R A;  4EES A;  3ZFZ A;  3IF5 A;  3VSK A;  1LSW A;  4ZDX A;  4GHI A;  5EVI B;  4EBL A;  3H9W A;  5JYP A;  3BFC A;  2XQZ A;  2CMN A;  2ZMA A;  3EGD C;  4LRX C;  4R23 A;  4R4R A;  5EM0 A;  2NUP C;  3NBL A;  2JKF A;  1FIL A;  2GX5 A;  3LIA A;  3IXG A;  4C6Y A;  4ETZ A;  3A3I A;  4Y3I A;  2VV7 A;  2QHK A;  3P98 A;  3N7W A;  3IBR A;  2JHE A;  4KUK A;  2OV5 A;  3PR6 A;  3T1R A;  4JXG A;  5L2F A;  1ESU A;  4I3I A;  4MN6 A;  3VE4 A;  1HTZ A;  2J8Y A;  4G3W A;  1Y28 A;  1S1Y A;  3WS5 A;  4F3L A;  3R7W A;  4KZ7 A;  1KOU A;  1F98 A;  3V5M A;  3FKV A;  2JN7 A;  5DKK A;  2DRW A;  2JE5 A;  1T1C A;  1M6K A;  2A3U A;  2PU2 A;  1E25 A;  4KQD A;  1TS7 A;  2FFF B;  3FPV A;  4WYY A;  2EFU A;  4ZJ1 A;  2Y2L A;  4MBK A;  4Q0J A;  1P9W A;  4LV2 A;  1SKO B;  2B18 A;  2R78 A;  3H82 A;  4LRZ E;  3S22 A;  3ZVT A;  4QD4 A;  1BTL A;  1MWS A;  2EXB A;  2BLS A;  3JVU A;  2H10 A;  2ZM2 A;  3ZYT A;  4IBX A;  1P9R A;  1W79 A;  2A49 A;  4OLG A;  5MC7 A;  2IA2 A;  4BJP A;  4L9G A;  3MXQ A;  4NXF A;  3K2N A;  1TS6 A;  5FAP A;  4JGO A;  5DTS A;  4WEK A;  5IS1 A;  2XEP A;  3LCE A;  2YKH A;  2VGL M;  4PPR A;  4OH0 A;  3TE8 A;  4II7 A;  1JWV A;  1FIK A;  3JVV A;  1HD8 A;  5DKL A;  3LGO A;  4A5R A;  5FAS A;  4EQ1 A;  2OWJ A;  4GNU A;  1T1A A;  5CGW A;  5EE8 A;  2VGJ A;  5AQ9 A;  2V8F A;  3UDX A;  2HDU A;  2M7U A;  5IT5 A;  3BRM A;  4EER A;  4O0P A;  4LV3 A;  1L2S A;  3SH9 A;  3VP2 A;  4RX2 A;  4DRT A;  3EGX C;  1JVJ A;  2PT7 A;  4BEN A;  4ZTK A;  3NHQ A;  4JBF A;  1ES3 A;  1AXB A;  3DTM A;  4WZ5 A;  4R6L A;  4PKY G;  3SOI A;  3D3O A;  1GCE A;  4U3T A;  4KZ6 A;  2WGW A;  4LLO B;  4EBN A;  3O87 A;  2C5W B;  3K3D A;  5AJG A;  3MMH A;  3D9Y A;  3LI8 A;  2Y55 A;  1Y4O A;  3VP1 A;  2ZD8 A;  3C38 A;  1RGY A;  3NC8 A;  4Y0U A;  3IWI A;  4RQ9 A;  4ME4 A;  4S2M A;  1XKZ A;  2X71 A;  4FOF A;  4NKP A;  3VFH A;  4ZJ2 A;  4LFU A;  3HVF A;  2IWD A;  3OOV A;  5EPH A;  1PNE A;  3BY9 A;  1KGG A;  1PIO A;  4JGQ A;  1YT4 A;  1S4S A;  2WYX A;  3ZCZ A;  3HUN A;  4EU0 A;  2J3T C;  3RTY A;  1VB6 A;  4BL2 A;  1MWR A;  4BBV A;  2W1T A;  5E2H A;  4GB7 A;  4DN0 A;  1X0O A;  4R0Q A;  3VOY A;  4UQI S;  5A91 A;  2EFX A;  2QJ5 A;  1YLP A;  2H5S A;  1S6R A;  2O9A A;  3PBN A;  2ZJ9 A;  3HUM A;  2KX6 A;  5TBM B;  4WF0 A;  1ZC2 A;  5KMW A;  2W3D A;  3RFB A;  2Y2H A;  2HDQ A;  3UNW A;  4KQR A;  1VHM A;  5F82 A;  2WKP A;  2Y2Q A;  1FCM A;  2V1B A;  4KZ8 A;  2XFT A;  4BMW A;  1OT9 A;  3MKE A;  4E3J A;  1ACF A;  4PHT A;  1YKD A;  5A90 A;  5J4E A;  1IOU A;  3PTE A;  1M40 A;  2K31 A;  1XJ6 A;  4GCZ A;  5GL9 A;  3MQQ A;  3C8C A;  1I5Q A;  1Z6F A;  5FDS A;  5GHY A;  3T12 B;  3HCY A;  1MY8 A;  4HEF A;  3UDI A;  1D06 A;  4ZAM A;  3VOZ A;  1O7E A;  3VOL A;  1YMX A;  1DRM A;  3QHY A;  3BEC A;  3LR3 A;  2VGK A;  2GDN A;  1VET A;  3KX0 X;  2JKG A;  4HP4 A;  4PKY A;  5F83 A;  3MZD A;  3QNB A;  5TGF A;  3EOI A;  2J3W A;  1H5X A;  4CLC A;  4DDS A;  5GHX A;  1NYM A;  1W5D A;  5HAQ A;  1KGF A;  3VSL A;  4FTX A;  2XGN A;  3IS2 A;  1FR1 A;  3HLE A;  2ZOH A;  2O9C A;  4H6J B;  4C75 A;  1S66 L;  1CEF A;  3MFX A;  1L0E A;  4P87 A;  2PR6 A;  2ZC6 B;  4K0W A;  2VEA A;  5FL3 A;  4BLM A;  1NRJ A;  1PYY A;  1IYO A;  2QZ6 A;  3Q07 A;  3U4L P;  4WN5 A;  2XR0 A;  3T50 A;  3SW1 A;  1L0D A;  2WKH A;  4R4S A;  4X53 A;  3ZDJ A;  5F1G A;  3UE6 A;  4FH2 A;  3OBF A;  5I94 A;  3JYI A;  2OSU A;  5GLC A;  1PI5 A;  3MBZ A;  4DJ3 A;  3GSG A;  4DE0 A;  2INW A;  3DTE A;  1EI5 A;  2PBY A;  4X69 A;  1FCO A;  4JF5 A;  2JC7 A;  2Y4A A;  4HP9 A;  4KUO A;  3V50 A;  3W2Z A;  4CJN A;  1PW8 A;  1XGJ A;  4KG2 A;  1NLY A;  2H0Y A;  5FA7 A;  1JWP A;  3IT9 A;  2VGL S;  1BSG A;  5HDC A;  4EET B;  2W1T B;  3UPN A;  5CEB A;  4L0L A;  5HZH A;  4JF4 A;  5CGS A;  4QWO A;  5TFQ A;  1JNU A;  2GZA A;  2ZQ9 A;  4HJ4 A;  1U60 A;  2ZL1 A;  1TDL A;  3HLG A;  1D7E A;  3FC7 A;  5FI2 A;  3IWQ A;  3W4P A;  3IXD A;  4I3J A;  3LR5 A;  2J9O A;  4EXO A;  3VFF A;  3M6H A;  1IYQ A;  4OOY A;  1ODV A;  1LI0 A;  2Z2M B;  1G68 A;  3ISG A;  4EBP A;  1GSX A;  2Y79 A;  2P9V A;  3IF6 C;  4DE3 A;  3G2Z A;  1NJ4 A;  4MBH A;  5CTM A;  4E04 A;  4BL3 A;  4PM9 A;  1ZKJ A;  2G7U A;  1VET B;  3IF6 B;  1QME A;  1XA7 A;  3QP8 A;  4S2K A;  3N8L A;  4CLC B;  3CJM A;  3IX3 A;  3FYZ A;  3PBR A;  2Z6C A;  5L10 A;  2VLG A;  3CG5 A;  3WRZ A;  4UEY A;  3MJQ A;  5U47 A;  4ARZ A;  4PM7 A;  2HZ5 A;  3IS2 B;  3T4L A;  3SH7 A;  1OTB A;  3DW0 A;  1N9L A;  3F1P B;  4I38 A;  4H8R A;  5HAI A;  4DMZ A;  1K57 A;  4WZ4 A;  3CUE C;  1KE4 A;  4YOF A;  5HFO A;  5M1A A;  3S7N A;  5TR7 A;  2FFY A;  3NEC A;  1OTD A;  1FR6 A;  4WM9 A;  2WGV A;  5GHZ A;  1NWZ A;  4S2N A;  1WYB A;  2HV1 A;  4OQ0 A;  1H8Y A;  1O07 A;  1JTD A;  1S1Z A;  1YM1 A;  3G32 A;  2DMW A;  3PBS A;  4OPR A;  2V0U A;  4LPZ A;  3D4F A;  2PDR A;  3G6O A;  4JXS A;  1JTG A;  2ZC5 B;  4P85 A;  2PYR A;  3QNC A;  2H0T A;  4P6Z M;  2LB5 A;  3HJK A;  4UA7 A;  1TEM A;  4NXG A;  1ONG A;  3G34 A;  4MCW A;  3LI9 A;  2H28 A;  3CPT B;  3VP0 A;  3HLB A;  1PWC A;  4Q0I A;  2UWX A;  3HUO A;  2A24 B;  1K38 A;  5BOH A;  2VA0 A;  1G5U A;  5LBR A;  4GS9 A;  3UPP A;  2Z2L B;  4N9L A;  1ES5 A;  1K54 A;  1NLZ A;  1CF0 A;  3B3X A;  3E0Y A;  2ZL1 B;  2W3F A;  4D60 A;  4CLC D;  3DBA A;  4X25 A;  1ZG4 A;  1KDS A;  2OLU A;  1MWU A;  2RCX A;  3LR4 A;  4GW9 A;  4HIA A;  4FSF A;  2O99 A;  2HDR A;  1N4O A;  4I39 A;  5F1F A;  5CXW A;  1MKI A;  5EOE A;  4QY6 A;  3BY8 A;  4FD8 A;  3ZVW A;  1ES4 A;  5FI7 A;  4JF6 A;  2NUT C;  3T1X A;  2PD8 A;  3ZNY A;  5HX9 A;  4QY5 A;  3LY3 A;  2HF6 A;  2ZM8 A;  5HPF A;  4PAU A;  2ZMF A;  4QJG A;  5KSH A;  4EEP A;  3MFD A;  1WE4 A;  1K6S A;  4IED A;  5FEG A;  3F1N B;  2VK3 A;  1YLZ A;  3NOU C;  5E2G A;  1RCJ A;  2PAV P;  4WUJ A;  3N6I A;  5FI6 A;  1PZP A;  5E43 A;  3Q81 A;  2C6W B;  4NET A;  4S2L A;  1G6A A;  4BBT A;  3AGD A;  3NDE A;  3BFF A;  2PRF A;  1GA9 A;  4KG5 A;  3GQZ A;  3T4J A;  1STZ A;  4FH4 A;  3TSG A;  4YFM A;  3GDI A;  3OPH A;  1RGZ A;  1BYW A;  3A3F A;  3A3E A;  4WMC A;  5FAO A;  3F1O A;  4XT2 B;  3UME A;  4LV1 A;  1OTI A;  1V9Y A;  2V0W A;  1N9N A;  4GD6 A;  2JKR M;  4NXE A;  3RJU A;  4O7D A;  2Y2M A;  4G3K A;  4C3Q A;  3BM6 A;  1GA0 A;  3LIF A;  3RXW A;  1H8M A;  1DY6 A;  1LHY A;  1G28 A;  3KSI A;  4DDY A;  4HES A;  1CEG A;  5GLA A;  2EWW A;  2W27 A;  2XFS A;  3SH8 A;  1ERQ A;  4MBF A;  3Q82 A;  2Y91 A;  3OLO A;  4EUV A;  5A8B A;  3OPL A;  1TD5 A;  3ZGA B;  2ACG A;  3B47 A;  1GSV A;  3EEA A;  2PHY A;  3W8K A;  2L4R A;  4E3L A;  1OPX A;  3L7H A;  5M18 A;  3LY4 A;  3KSG A;  3ITB A;  5HWT A;  3H7W A;  2ZLY A;  4GHI B;  5E2F A;  3OPR A;  2ZMV A;  1K54 C;  4IHQ A;  3HLW A;  2WKI A;  3KSF A;  5HW3 A;  4HI4 A;  3P01 A;  3IH8 A;  4CPK A;  1MBL A;  3SS3 A;  1BLP A;  3S1Y A;  1OTE A;  5EUA A;  1XP4 A;  3MF0 A;  2X02 A;  3DTI A;  3ZHH A;  4KQO A;  5G18 A;  4HY8 A;  2R9W A;  4HOI A;  4OVD A;  5J8X A;  4E3O A;  4N9K A;  4EEU A;  4UA9 A;  4X6T A;  1KVM A;  2DNS A;  4S2J A;  1GHP A;  4HH2 A;  5CEC A;  2KDK A;  1UWN X;  3NOP C;  4KG6 A;  5G4Z A;  4B4X A;  4F3L B;  2BTF P;  3R7W B;  1K56 A;  4Q8I A;  2ZM0 A;  1BUE A;  2XK1 A;  4MDZ A;  3E2K A;  4KZ3 A;  3HLC A;  3IBJ A;  1PI4 A;  4MN7 A;  5GLD A;  5C5K A;  3PBQ A;  2EX8 A;  4RVA A;  2HJE A;  3A0S A;  4P6Z S;  2CC1 A;  1K0K A;  2Q0O A;  1FQG A;  2PBD P;  4E3K A;  2XSS A;  1D1J A;  2Y2I A;  4DE1 A;  4Y0T A;  3H82 B;  2Y2J A;  4R1G A;  1IFQ A;  1K55 A;  1LLB A;  3F1O B;  1L0G A;  3MQ0 A;  3VP4 A;  1VEU A;  4EQI A;  1Y54 A;  1MXO A;  3QP4 A;  3GV9 A;  3UO9 A;  2IWB A;  4GDB A;  3UE1 A;  1TS0 A;  4KZA A;  1DP8 A;  1YAX A;  3UMD A;  3HLD A;  5GLB A;  4BD0 A;  1UGU A;  3ITA A;  2HPB A;  4B93 A;  4GZB A;  3T4O A;  5HPI A;  1LT0 A;  2JKR I;  4Z1W A;  1MKM A;  5I5L A;  5EVL A;  1MZU A;  5IU1 A;  4KZB A;  3TG9 A;  1JWZ A;  5FQQ A;  3G31 A;  5KSC A;  2V8C A;  3ZNT A;  2RL3 A;  4G3V A;  1ALQ A;  1OME A;  3VMA A;  4R3B A;  5DTK A;  4XUX A;  4HNB A;  1ZHH B;  3ZG0 A;  3PAG A;  3NIA A;  2Y59 A;  3QP1 A;  3SS4 A;  3BYD A;  2Y2K A;  4KZ5 A;  3UB7 A;  4HQA A;  1SZV A;  4WZ5 C;  3CAX A;  2J80 A;  3IQA A;  3WS4 A;  1XFN A;  1YLT A;  1PW1 A;  2WAF A;  2QYB A;  5L07 A;  2I72 A;  4KQQ A;  1DJA A;  2QWS A;  4Z9Q A;  4IBR A;  1PFL A;  2OLV A;  3CIT A;  3E4Q A;  3UPO A;  4HBU A;  1WYC A;  2WGW B;  4U0T A;  1ZG6 A;  5EFW A;  5AQ7 A;  3V3R A;  3O88 A;  1SHV A;  2QPN A;  5CER A;  1DJC A;  3IHA A;  3LR0 A;  2HGV A;  2ZOI A;  2G2U A;  3BLS A;  1XFQ A;  2EA9 A;  3RH8 B;  3UE0 A;  5G4Y A;  1YMS A;  3C5A A;  2XDM A;  1LL8 A;  4NG2 A;  3Q7V A;  3LIC A;  3LUQ A;  3LIE A;  5HAP A;  3NJA A;  1NZO A;  1IEL A;  3EQU A;  4YIN A;  4B9O A;  1W63 Q;  3BEB A;  1F2K A;  2VJW A;  1PWG A;  3C2W A;  5DFY A;  3IWO A;  5KIZ A;  2E8J A;  4DXC A;  4BD1 A;  1AWI A;  4RA7 A;  4X1L A;  4N92 A;  4DE2 A;  4JXV A;  1T1B A;  2PR5 A;  5EVI A;  3NOT C;  3WS0 A;  2O0Y A;  4R70 A;  1BLH A;  1LL5 A;  4ESP A;  1IYP A;  5FQJ A;  3T4S A;  1CI9 A;  2Y2P A;  4NEE D;  4QPR A;  4X1M A;  3O3V A;  3MQO A;  3R4K A;  4K08 A;  1IKI A;  5FAT A;  2V9A A;  3K3C A;  2QMI A;  3FKW A;  3ZG7 B;  4MMN A;  1MWT A;  3C7V A;  3M6B A;  3TJZ C;  1J3W A;  3DWZ A;  5DF9 A;  4LGW A;  4OQH A;  3OPP A;  4CLC C;  1H3Q A;  4E3I A;  3UB5 P;  1L0F A;  3LEZ A;  2KLI A;  4LEN A;  3HRE A;  3PXP A;  2ZC3 B;  4WEJ A;  2P08 A;  4E3M A;  1XGI A;  2O9B A;  4K91 A;  2WKQ A;  4ID4 A;  3S7P A;  2YKF A;  3GVB A;  3TOI A;  3NI9 A;  5J3W A;  2XH9 A;  2OAQ 1;  2XRN A;  3KO6 A;  3NCK A;  4XUZ A;  4HH3 A;  3MSH A;  3DAV A;  1HLU P;  2D02 A;  4JKT A;  1CI8 A;  3S7Q A;  4EW7 A;  2J9P A;  1S0W A;  3PAE A;  1NYY A;  3KYE A;  4OPY A;  5CHM A;  4S2I A;  4ETX A;  4BBU A;  1C3B A;  4DKI A;  3E4O A;  2EWV A;  3PHY A;  3MZF A;  1VM1 A;  5M19 A;  4U0X A;  4PM6 A;  1E3U A;  3GEC A;  1ZTU A;  1K56 D;  4FUW A;  3UB9 A;  1MPL A;  3T1S A;  5FAQ A;  2XA7 M;  3BJN A;  4ZJ3 A;  4MN5 A;  1G6O A;  1XX2 A;  2BG1 A;  3MXR A;  3UE3 A;  5IHV A;  2P7J A;  1MC0 A;  4OON A;  1F5M A;  1EW0 A;  4QHC A;  1SKF A;  3P7N A;  4P0M A;  4R3J A;  5CHJ A;  3OCN A;  4HJ3 A;  5JYO A;  2Y2O A;  2GJ3 A;  3HL9 A;  4WLA A;  1BZA A;  3G2Y A;  1LSV A;  4Y0O A;  2OAP 1;  3BQ8 A;  2R9X A;  5KZH A;  3ZQ5 A;  3HJI A;  3BWL A;  3MS6 A;  5J7E A;  3LO7 A;  2Q9N A;  2M7V A;  4Y7P A;  3N4I A;  1XXM A;  1TS8 A;  4RYE A;  5FQK A;  3OCL A;  5DVA A;  2ZQ8 A;  4GN2 A;  4OP8 A;  3NUL A;  4MNR A;  1FSW A;  2WGI A;  4MEZ A;  4OQI A;  1TDG A;  3WS1 A;  1XJ2 A;  2JBF A;  5CRF A; 
#chains in the Genus database with same CATH homology
 3SS3 A;  1L0E A;  1BLP A;  3S1Y A;  1ONH A;  2P9V B;  4P87 A;  2ZC6 B;  5EUA A;  1Q2P A;  1XP4 A;  4K0W A;  4N1X A;  2X02 A;  4BLM A;  3ZHH A;  3PBT A;  3MXS A;  1SCW A;  1CK3 A;  4KQO A;  1PYY A;  5G18 A;  4DF6 A;  2R9W A;  4OVD A;  3DWK A;  5J8X A;  3V39 A;  4E3O A;  2V20 A;  4N9K A;  4UA9 A;  2EX2 A;  1IYO A;  4PMA A;  4X6T A;  2QZ6 A;  1KVM A;  2DNS A;  3Q07 A;  4S2J A;  5CED A;  1J9M A;  1GHP A;  2XF3 A;  5D3O A;  1IEM A;  3MZE A;  5CEC A;  1FOF A;  2IWC A;  3NY4 A;  2XR0 A;  4LCL A;  1L0D A;  2WKH A;  4R4S A;  4X53 A;  4KG6 A;  3ZDJ A;  3A3D A;  3BLM A;  3OC2 A;  4N1H A;  5F1G A;  4RX3 A;  4X55 A;  4S2O A;  3IH9 A;  3IH8 A;  2ZQA A;  3A3J A;  4B4X A;  4E3N A;  4FH2 A;  4X56 A;  1K56 A;  1YQS A;  4NK3 A;  4OQG A;  5I94 A;  1SDN A;  3M2J A;  2WZZ A;  1K57 C;  3JYI A;  4P6B A;  4OPZ A;  4Q8I A;  2ZM0 A;  4BQM A;  2OSU A;  1BUE A;  4PM8 A;  5GLC A;  1PI5 A;  3MBZ A;  2XK1 A;  1XPB A;  5A90 A;  5FDH A;  5FQ9 A;  2Q9M A;  3E2K A;  1YLJ A;  3GSG A;  1BT5 A;  4DE0 A;  4KZ3 A;  3HLC A;  1PI4 A;  1PWD A;  3HLF A;  1EI5 A;  2PBY A;  4KZ9 A;  4X69 A;  3ZG8 B;  1FCO A;  4JF5 A;  5GLD A;  5CTN A;  4QB8 A;  2JC7 A;  3PBQ A;  2EX8 A;  4RVA A;  2Y4A A;  3M2K A;  3V50 A;  1ES2 A;  3IHB A;  1GHM A;  4S2N C;  2CC1 A;  1PW8 A;  4CJN A;  1XGJ A;  4KG2 A;  2H0Y A;  5FA7 A;  1FQG A;  1JWP A;  3IT9 A;  1K6R A;  4E3K A;  2P74 A;  1BSG A;  4GOG A;  2Y2I A;  4DE1 A;  4Y0T A;  1KGE A;  2ZQD A;  2Y2J A;  3UPN A;  1W7F A;  1YLY A;  4D2O A;  4R1G A;  2DCF A;  4DXB A;  2V1Z A;  3Q1F A;  3Q7V B;  1K55 A;  5CEB A;  4L0L A;  3GTC A;  1LLB A;  1IKG A;  2EX6 A;  5A93 A;  1NZU A;  4OLD A;  2JCH A;  5HAR A;  4JF4 A;  5CGS A;  2WAD A;  2XD5 A;  3WWX A;  1L0G A;  3RJU A;  5TFQ A;  3G4P A;  5EEC A;  5EVI C;  2ZQ7 A;  3VP4 A;  2ZQ9 A;  5EVI D;  1U60 A;  4EQI A;  1Y54 A;  1YLW A;  1TDL A;  4UAA A;  5EOO A;  3HLG A;  1MXO A;  3ZFZ A;  3GV9 A;  5FI2 A;  3UO9 A;  3BFG A;  3IWQ A;  3W4P A;  3IF5 A;  3IXD A;  2IWB A;  3VSK A;  4GDB A;  3UE1 A;  4ZDX A;  2J9O A;  4KZA A;  3WS2 A;  3VFF A;  3HLD A;  3M6H A;  5EVI B;  5GLB A;  4B4Z A;  4BD0 A;  4EBL A;  1IYQ A;  3ITA A;  4OOY A;  5DTT A;  5JYP A;  2HPB A;  3BFC A;  2XQZ A;  2WUQ A;  2ZMA A;  4GZB A;  4R23 A;  5AQA A;  4R4R A;  1GHI A;  4F94 A;  4WEL A;  3CZD A;  1LI0 A;  5EVL A;  4KZB A;  3TG9 A;  1JWZ A;  2Z2M B;  3NBL A;  5FQQ A;  1G68 A;  1K25 A;  3G31 A;  3ISG A;  4EBP A;  3ZNT A;  5KSC A;  2EXA A;  4UA6 A;  3IXG A;  2RL3 A;  2P9V A;  1ALQ A;  1OME A;  3I7J A;  3IF6 C;  4C6Y A;  3VMA A;  4R3B A;  5DTK A;  4XUX A;  1XA1 A;  3A3I A;  3G2Z A;  4DE3 A;  3ZG0 A;  1NJ4 A;  3PAG A;  4MBH A;  3NIA A;  2Y59 A;  3P98 A;  3SS4 A;  5CTM A;  3N7W A;  3BYD A;  2Y2K A;  5A92 A;  1I2W A;  4KZ5 A;  1SDE A;  4BL3 A;  4PM9 A;  1ZKJ A;  3C4O A;  3IXH A;  2HDS A;  2OV5 A;  4WZ5 C;  5L2F A;  4JXG A;  2HP6 A;  3IQA A;  3WS4 A;  3IF6 B;  1QME A;  4OOM A;  1YLT A;  1HVB A;  1TVF A;  1ESU A;  1PW1 A;  1XA7 A;  2WAF A;  3UN7 A;  1RP5 A;  4S2K A;  3N8L A;  3BFD A;  3FZC A;  2WKE A;  1HTZ A;  1W8Q A;  2J8Y A;  2I72 A;  4KQQ A;  3WS5 A;  3CJM A;  3FYZ A;  1DJA A;  3PBR A;  4Z9Q A;  4KZ7 A;  4IBR A;  3CG5 A;  3WRZ A;  2OLV A;  5U47 A;  4PM7 A;  3V5M A;  3FKV A;  3SH7 A;  4KZ4 A;  3UPO A;  3BFE A;  2B5R A;  2Y2N A;  4HBU A;  1WYC A;  2WGW B;  4U0T A;  3DW0 A;  2DRW A;  2JE5 A;  1FSY A;  1ZG6 A;  4JXW A;  1M6K A;  2A3U A;  4H8R A;  5E2E A;  2PU2 A;  1N9B A;  5AQ7 A;  3V3R A;  3AGF A;  3O88 A;  5HAI A;  1KDW A;  1E25 A;  1K57 A;  1SHV A;  4WZ4 A;  2QPN A;  2FFF B;  5CER A;  4WYY A;  2EFU A;  1DJC A;  3IHA A;  4ZJ1 A;  2Y2L A;  3N8S A;  4MBK A;  3BLS A;  3UNW A;  2G2U A;  1KE4 A;  3VP3 A;  4LV2 A;  5HFO A;  3UE0 A;  2ZC7 A;  5M1A A;  1E3U D;  4FCF A;  5TR7 A;  4EWF A;  2FFY A;  4QU3 A;  5HL1 A;  1YMS A;  3C5A A;  1FR6 A;  4C3Q A;  2XDM A;  4WM9 A;  3S22 A;  2WGV A;  3Q7V A;  1PZO A;  3C4P A;  1NRF A;  4MLL A;  5GHZ A;  4S2N A;  1WYB A;  3ZVT A;  3P09 A;  4QD4 A;  1ESI A;  4OQ0 A;  5HAP A;  1H8Y A;  1NZO A;  1O07 A;  1JTD A;  1YM1 A;  1BTL A;  1IEL A;  3G32 A;  3EQU A;  1MWS A;  2EXB A;  2BLS A;  4YIN A;  3V3S A;  1EWZ A;  2WAE A;  2H10 A;  3BEB A;  3PBS A;  2ZM2 A;  4OPR A;  2V2F F;  1LI9 A;  4IBX A;  1PWG A;  1W79 A;  1VQQ A;  3IWO A;  4DXC A;  4BD1 A;  3D4F A;  2A49 A;  4OLG A;  4JXS A;  1JTG A;  4RA7 A;  4OOL A;  2ZC5 B;  4P85 A;  4BJP A;  3FWL A;  3Q7Z A;  4N92 A;  4JXV A;  4DE2 A;  1IYS A;  3QNC A;  2H0T A;  5FAP A;  3S4X A;  5EVI A;  3WS0 A;  1BLH A;  4UA7 A;  1TEM A;  5DTS A;  4B88 A;  2XLN A;  1LL5 A;  1ONG A;  3G34 A;  1IYP A;  5FQJ A;  1DJB A;  4WEK A;  1CI9 A;  2XEP A;  2Y2P A;  3LCE A;  4PPR A;  4OH0 A;  3O3V A;  3VP0 A;  1JWV A;  1HD8 A;  3HLB A;  1PWC A;  1IKI A;  5FAT A;  4A5R A;  4LCM A;  5FAS A;  2QMI A;  3FKW A;  2J7V A;  5AQB A;  2UWX A;  3HUO A;  4GNU A;  1K38 A;  5CGW A;  5EE8 A;  2VGJ A;  5BOH A;  3ZG7 B;  3UPP A;  2Z2L B;  4N9L A;  1ES5 A;  1K54 A;  1MWT A;  3C7V A;  5AQ9 A;  3M6B A;  5CHU A;  3UDX A;  4K0X A;  3DWZ A;  2HDU A;  3B3X A;  3IF6 A;  2WK0 A;  3BRM A;  5DF9 A;  4OQH A;  4LV3 A;  1L2S A;  3SH9 A;  3OPP A;  3VP2 A;  4RX2 A;  4DRT A;  4E3I A;  1JVJ A;  1L0F A;  3UY6 A;  3LEZ A;  1ZG4 A;  1H8Z A;  1KDS A;  2XD1 A;  4LEN A;  3NDG A;  2OLU A;  1MWU A;  2RCX A;  3HRE A;  4BEN A;  4ZTK A;  3MKF A;  2EX9 A;  2ZC3 B;  2HP9 A;  2HDR A;  1N4O A;  2HP5 A;  4FSF A;  4JBF A;  4WEJ A;  5CXW A;  1ES3 A;  1MKI A;  5EOE A;  4E3M A;  5F1F A;  1XGI A;  1AXB A;  4QY6 A;  3DTM A;  4WZ5 A;  4M3K A;  4FD8 A;  4K91 A;  3ZVW A;  3SOI A;  1ES4 A;  1GCE A;  2Y2G A;  4U3T A;  5FI7 A;  4ID4 A;  3ZG9 B;  4KZ6 A;  2WGW A;  4EBN A;  3O87 A;  2C5W B;  1KVL A;  4E6W A;  4JF6 A;  3GVB A;  3TOI A;  3NI9 A;  2PU4 A;  3ZNY A;  2Y55 A;  2XH9 A;  5HX9 A;  1I2S A;  4QY5 A;  3PBO A;  2ZD8 A;  5FQM A;  3VP1 A;  1RGY A;  3LY3 A;  2ZM8 A;  3NCK A;  4XUZ A;  3N8R A;  4OPQ A;  4QJG A;  3NC8 A;  5KSH A;  3MFD A;  4Y0U A;  1WE4 A;  3GMW A;  3IWI A;  1K6S A;  4IED A;  4X68 A;  3W4O A;  4S2M A;  4JKT A;  1XKZ A;  1CI8 A;  4EV4 A;  1QMF A;  2X71 A;  1YLZ A;  2J9P A;  3UDF A;  3VFH A;  5E2G A;  4ZJ2 A;  1RCJ A;  1S0W A;  3RXX A;  3PAE A;  1NYY A;  3HVF A;  3N6I A;  4OPY A;  2IWD A;  5FI6 A;  5CHM A;  1PZP A;  1BUL A;  5EPH A;  4KEN B;  5DF7 A;  5E43 A;  1KGG A;  1PIO A;  1YT4 A;  4S2I A;  2WYX A;  3Q81 A;  1C3B A;  1NY0 A;  4OP5 A;  2C6W B;  4NET A;  4DKI A;  3ZCZ A;  4S2L A;  3IXB A;  3HUN A;  1G6A A;  3MZF A;  3W4Q A;  3AGD A;  1VM1 A;  5M19 A;  1FCN A;  3GRJ A;  3NDE A;  3BFF A;  4U0X A;  4BL2 A;  1GA9 A;  1E3U A;  4PM6 A;  3HBR A;  4KG5 A;  1K56 D;  4PM5 A;  3GQZ A;  1MWR A;  4FH4 A;  3C7U A;  2WZX A;  3CMZ A;  3TSG A;  3SS5 A;  1Q2Q A;  5E2H A;  4GB7 A;  1MPL A;  4YFM A;  4R0Q A;  3VOY A;  3OPH A;  1RGZ A;  3WRT A;  5FAQ A;  4ZJ3 A;  5A91 A;  3A3F A;  2EFX A;  3A3E A;  4S2P A;  4WMC A;  4WMC D;  5FAO A;  1YLP A;  2H5S A;  3O86 A;  1S6R A;  4GD8 A;  1HZO A;  3PBN A;  1XX2 A;  3OZH A;  2BG1 A;  2ZJ9 A;  3MXR A;  4LV1 A;  2G2W A;  3UE3 A;  3HUM A;  5IHV A;  4JLF A;  1ZC2 A;  4GD6 A;  4OON A;  3E2L A;  2E8I A;  4XXR A;  5KMW A;  1E4D A;  4QHC A;  1SKF A;  2Y2H A;  2Y2M A;  2HDQ A;  3G35 A;  4KQR A;  3BM6 A;  4O7D A;  4P0M A;  1GA0 A;  4R3J A;  5FQI A;  5FSR A;  1W8Y A;  4WBG A;  2ZC4 B;  5CHJ A;  5F82 A;  1BLS A;  1BLC A;  2Y2Q A;  4OKP A;  4UHU A;  1FCM A;  3RXW A;  4KZ8 A;  2XFT A;  5CGX A;  1NXY A;  1DY6 A;  1LHY A;  3GR2 A;  3OCN A;  4GDN A;  3MKE A;  4DDY A;  4HES A;  4E3J A;  1CEG A;  5GLA A;  5JYO A;  2Y2O A;  1K4E A;  2XFS A;  3HL9 A;  5DF8 A;  1BZA A;  3G2Y A;  3SH8 A;  4IVI A;  1ERQ A;  1M40 A;  3PTE A;  3Q82 A;  1K55 C;  4MBF A;  3EQV A;  4E6X A;  2Y91 A;  4Y0O A;  5GL9 A;  1I5Q A;  1Z6F A;  2R9X A;  1ERO A;  3OPL A;  5GHY A;  5KZH A;  1MY8 A;  4HEF A;  4JPM A;  1LL9 A;  3UDI A;  4ZAM A;  3VOZ A;  1ERM A;  1O7E A;  3ZGA B;  3LO7 A;  2Q9N A;  4Y7P A;  4EUZ A;  3N4I A;  1YMX A;  1XXM A;  2ZQC A;  3QHY A;  3BEC A;  2VGK A;  4ZBE A;  2GDN A;  4IVK A;  5F83 A;  3MZD A;  3QNB A;  4RYE A;  5TGF A;  5FQK A;  3W8K A;  3OCL A;  4E3L A;  1H5X A;  5M18 A;  5DVA A;  4DDS A;  5GHX A;  1NYM A;  1W5D A;  3LY4 A;  2ZQ8 A;  4GN2 A;  1KE3 A;  5HAQ A;  3ITB A;  1KGF A;  4LV0 A;  4OP8 A;  3VSL A;  3G30 A;  2ZLY A;  5E2F A;  3OPR A;  2XGN A;  1K54 C;  4MNR A;  1FSW A;  2WGI A;  3HLW A;  1FR1 A;  2WKI A;  3AGE A;  4MEZ A;  3HLE A;  4OQI A;  1TDG A;  3ZG5 A;  5HW3 A;  4GKU A;  3WS1 A;  1KE0 A;  1K4F A;  4HBT A;  2JBF A;  2X01 A;  4C75 A;  5CRF A;  1CEF A;  3FV7 A;  4CPK A;  1MBL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...