1KGIA

Rat transthyretin (also called prealbumin) complex with 3,3',5,5'-tetraiodothyroacetic acid (t4ac)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
120
structure length
120
Chain Sequence
b'SKCPLMVKVLDAVRGSPAVDVAVKVFKKTADGSWEPFASGKTAESGELHGLTTDEKFTEGVYRVELDTKSYWKALGISPFHEYAEVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSTHYRETIN
publication title Complex of rat transthyretin with tetraiodothyroacetic acid refined at 2.1 and 1.8 A resolution.
pubmed rcsb
molecule tags Transport protein
total genus 28
structure length 120
sequence length 120
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 1kgiA00
5CN3A 1Z7JA 4N87A 4TQIA 5CM1A 1FHNA 4Y9FA 1THCA 3DK0A 4L1TA 3IWUA 3IMTA 3P3RA 4HJUA 4PVNA 5CLXA 2TRYA 5FO2A 1ZCRA 5AYTA 1QABA 1TYRA 1SN0A 4ABWA 5JIMA 2QGBA 4WO0A 2F7IA 3IPEA 4PWKA 1ETA1 3BSZA 3IMRA 4TM9A 3IMVA 4WNSA 4N86A 3CBRA 3P3SA 1TSHA 1F86A 2B14A 1GKEA 2QPFA 4HJSA 4TLSA 5FW6A 2QGDA 1TTBA 1TT6A 5EN3A 3OZKA 2F8IA 4IK7A 4ANKA 4AC4A 1TLMA 1DVXA 3NEEA 4PMEA 3TCTA 3GS7A 5AKSA 3CN0A 1SN2A 4TL5A 1E3FA 3D2TA 4TLUA 5K1NA 2G2PA 4I85A 4MASA 2TRHA 3HJ0A 1DVZA 2ROYA 3A4EA 4HJTA 3IMUA 2H1XA 5L4IA 3GLZA 3I9IA 3A4FA 2QGEA 1TTAA 1IJNA 1BMZA 2G3XA 3DIDA 3GRGA 3SSGA 4ABVA 5IHHA 5L4FA 5CNHA 2B9AA 4ABUA 3QVAA 4PWJA 1IIKA 2GABA 2QGCA 4TLKA 4DESA 2FLMA 3I9PA 3KGUA 3CFNA 3CN4A 4TL4A 5CR1A 1ETB1 1ICTA 3Q1EA 4HISA 3CFMA 2PABA 5CLZA 5BOJA 4IKIA 2G2NA 5L4JA 4AC2A 3FC8A 4Y9EA 1SN5A 3IPBA 4FI6A 4TNFA 4Y9BA 1BZEA 1E5AA 5DEJA 4TLTA 1X7SA 4TKWA 1RLBA 2NOYA 1DVTA 1DVSA 3DO4A 3P3TA 3I9AA 1TZ8A 4QYAA 4QXVA 3ESPA 3GS0A 2H4EA 5K1JA 3U2IA 2WQAA 4TQPA 2B15A 1QWHA 4I89A 5L4MA 3GRBA 1SOKA 1TFPA 4PM1A 3IMSA 1KGIA 3ESOA 2H0JA 1THAA 3DGDA 1ZD6A 3KGTA 3M1OA 1U21A 4PWGA 4QRFA 1KGJA 5AL0A 3TFBA 3DJSA 5JIDA 1IE4A 1E4HA 4IKLA 2QELA 2GPZA 4MRCA 3D7PA 2FBRA 3NEOA 3P3UA 4WNJA 5EZPA 5DWPA 1G1OA 4D7BA 2ROXA 5AKVA 4Y9GA 4PWIA 4N85A 2G3ZA 4DERA 3CXFA 3NG5A 3GS4A 4IIZA 5AKTA 3IMWA 4FI7A 1DVUA 1Y1DA 3BT0A 3IWVA 4FI8A 3CN2A 4PWFA 4YDNA 5AL8A 4I87A 1TTRA 3NESA 2IGLA 3ESNA 4L1SA 4TQ8A 5E23A 3NEXA 3CN1A 4TQHA 4ABQA 3CN3A 3FCBA 3B56A 1X7TA 4DEWA 2H0EA 4HIQA 4IKJA 4PVMA 4ACTA 1GKOA 4IK6A 2H6UA 3CFTA 3DJZA 4IKKA 4TNGA 1DVYA 3KGSA 5FW7A 4DEUA 5A6IA 2H0FA 3OZLA 4Q14A 5TTRA 1SOQA 2G4GA 1F41A 1BM7A 1TTCA 2B77A 3DK2A 3DJRA 4Y9CA 5E4OA 3W3BA 4PWHA 1DVQA 4KY2A 4PMFA 4TNEA 5JIQA 1BZDA 1IIIA 1OO2A 2B16A 4MRBA 1FH2A 4PWEA 3CFQA 4DETA 5E4AA 2G5UA 4YDMA 3GPSA 5CLYA 2G4EA 2G9KA 3DJTA 4PVLA 3A4DA 5FW8A 5HJGA 3U2JA 1BZ8A
chains in the Genus database with same CATH superfamily
2PYEA 3W57A 2A38A 5L2KE 5EORL 1BLNB 2Y6TE 2Z3FA 2X89D 1RIHL 4PJGA 1FAIL 4F3FA 2AK4E 2OMXA 1MHCA 1JCKA 4KI5F 3F00A 3L6FB 1DBMH 3QUZD 4M1CC 2C1PA 1J9RA 4HIEB 4TSCL 4LKXB 5KSBA 2EDQA 2GJ6A 3AMLA 5IVXE 3VFOB 1TSHA 2GEEA 3CC5A 1NAML 4LGRB 5G5DB 4DO5A 5ANME 5BOPA 4WI6A 4M5YL 4NP9A 1XR9A 5JR1H 5DQJA 2PKDA 2XZQH 1A66A 3KPOB 4G9FA 4B9JA 4HIJB 1FC1A 2CNZA 4ZTPH 3CHSA 3STLB 1BF5A 2N1TE 3RVUC 4X4ZA 5AOMA 4XH2B 4PJ5B 5TPWL 1GC1L 1QFWL 4PRID 2G3XA 5DJ8A 2GAZA 2F5BH 2A0LD 3HE7D 3MGOA 2WNKA 4OF3A 4DFHA 1RURH 1B9KA 4DESA 1DBAL 1A65A 4HHAA 1L4IA 4R90H 4DF9A 3NN8B 1I7TB 2JV6A 3UCRA 4XP9L 4G8IB 1EAPA 4BELD 5DRWB 1K2DA 1JK9B 4PS8A 1KIPB 4K3JH 4Z7QB 4TKWA 3BP4A 3ARSA 5BRQA 4ZMOA 3DVNB 9CGTA 3TFKD 2EE2A 3EYOA 2AZAA 3CLEH 3OSVA 1HQRB 3NJGA 2AV1A 3V7AE 3PWUA 2VLLB 3EBAA 2VDNH 2WW8A 4DKDC 5BS0A 1E2VA 2VIRB 2UY7B 1YDPB 1TZHB 2QSTA 1NIBA 1FFPB 2WKGA 4XPAL 1YEIH 1CFSB 1XHHA 2EDMA 5DYFA 5L88H 2BIOA 3ARED 4UT7L 4D7BA 5D7LD 3TO4A 2CDFA 1FJ1A 5C2BL 4OLYL 3HRPA 2VL5A 3OLDA 4PRDB 5BZWA 5FYKD 2BC4A 3NIGE 4PJDF 4XTRD 5JOFA 1YVLA 5AL8A 1A14H 1OE2A 1OTUD 2BZCA 3KPMB 4UT9H 2O6CA 2Y06L 4WTZG 1E6JH 3FQYA 1KGXA 1Z3GH 3IVKB 2HJLA 3U9WA 1T7ZA 4NQDE 1P2CB 3HMWH 2AABH 5IQ9A 4EUPB 1T7WA 4F7PB 3VXMB 1PGRB 3QWRA 3SODB 1M6OA 1OXYA 1TJHH 4HCIA 1WBYA 4HKXB 4LPCA 4LSPL 3ZSSA 1KPRA 2IDSA 4G42B 4PW4A 1NPUA 2EDEA 5I6NA 1HS6A 3SCMC 4PVLA 1AKJB 4O4YL 2FTAA 5LQBL 2IWGA 1PS3A 4FA6A 4TULL 1YUKB 5LAXB 1U8HB 1XT5A 3GMRA 1IBYA 3N3EA 4LBEA 4X6CA 5D96C 5I23A 1REIA 1BYOA 4U6HB 2I7SA 2VM9A 5HGHA 4AKPA 4LLMB 3ECUA 4I1NB 4F2EA 3ZR6A 5T3ZD 1GJIA 2FL5B 1BG9A 4P4KB 4MQXD 2PR9A 3QRBA 2IOIA 2WIIA 1A6TA 3VI3A 2BY3A 3IBOA 4MWFA 4X7TB 4XCNA 4PY7A 3C5JA 4YPGA 1G94A 4UMSA 2Q7NA 3MRJB 2FEEL 4KUCD 3MBWA 4HC1H 4ELKA 5DA0B 3FULA 3QEQE 5DHMC 3ZGHA 2VXVL 1L7IH 2XYBA 4BFBD 4OR1A 3UOAB 2V3EA 1CO1A 4WV1C 5E4EB 4TVUA 5F88B 2Q8AH 5CKGA 1L3NA 3HS0A 4J5VA 3G5VA 3TCLA 2E6QA 3D9AH 3UBXI 5CIPB 4LLWA 4TNVK 4GSDL 3OKDB 1DQVA 3O2VL 4L3AA 1WHPA 2HMID 3VFTB 1WEJH 1I3RA 1M7IA 4M6OH 4LCWD 3FC8A 3V7AG 2ZXBA 1FCCA 1T21B 1JDAA 1MDAA 1E5AA 2CJ3A 1SUJA 3S36X 3OHXB 2QTVA 5K9QG 1JPFB 1SF3A 2ZJSL 4LQ1A 2H32B 3GJEA 3TN0D 4D2NA 2BWIA 1C5BH 1JWMA 1IGCH 4PM1A 4MCZA 1HX0A 2K6ZA 1XD0A 4PP2B 4QXUL 5D2LA 1GGIL 3BMVA 4JRFA 3DJSA 1TVHA 1GAFH 5K59E 1DO5A 1TEGA 3RVTD 3RKDD 5ALBH 3TO4C 3QCVL 4X6EA 2F53B 4AEHL 5KBLA 2GFBA 3QB7C 4PJXB 2X87A 1LD9B 1P9MA 1Q38A 4JPQA 3U2SB 4OZFG 4MNHB 2MH4A 4BFGA 3L4TA 4PJ9D 1C5DA 4XCEA 3K6IA 3DSNB 4I5BB 3ZHFA 1MF2L 4WLCA 1A64A 1PU0A 3T1FB 2YXWA 3HVNA 1LWRA 4PVMA 2C5DC 2CD0A 3JQOB 2H6UA 35C8H 2UZXA 1F11A 3LN5A 4X99B 2CXKA 4C56B 3FF8A 1FGVL 4P3WA 4XXCA 3RNKA 2B3IA 4YHIB 3TYFA 2L7JA 1XSJA 3HAEB 4OGQC 4OGAD 1QPXA 4YNYA 1BVKA 5J1TC 5F6HI 2WBJD 3RWHA 3IT8D 1WLHA 3FZUC 3HUJB 3IXTB 5FGBA 1DQTA 1RUML 3L45A 4AM0Q 1B4TA 1PLGH 5CLXA 1LM8V 4MX7B 5DUML 3WHE1 1IKOP 2X6UA 5EA0H 2OXGB 3SPJA 1WUZA 4AKOA 3P2TA 4E9XA 2ITCA 4K15A 3K2IA 2EO9A 2XZAH 3US1A 2CAKA 4QMEA 3C5ZA 1UT2A 1EAJA 4XBEH 1JD7A 3X13B 1OCWL 2Z4TA 4BFFA 3V9FA 5I1EH 4JO4H 1MI5A 3K2KA 3GXMA 1KBPA 1RZKH 5EFIB 2ADGB 2K4WA 2YPLE 3FTGB 1LEIA 4UIMB 1NLDL 3DX7A 2Q7YB 4JG0L 3P77B 1SLXA 5I0DA 1G7MB 3LS4L 5EOQL 1L9OA 4KI5C 2DQUH 1U0QA 5HD8D 5ISZB 2NY6B 4UQEA 5L6YL 1H3WM 4P2AA 1AHKA 3CE1A 1NCJA 1BWWA 2OP4L 2ALAA 2OMZB 5KOMC 5JDSA 2HH0L 1V7ML 4R96A 4BZ2L 2VDOH 1I1AC 2A6KB 1II4E 5GSRA 2HFFB 4Y9BA 2GI0A 5ABZA 2X1OA 1PAMA 2LVCA 3WIHA 3IDXL 4XP6H 4HWBH 2IO5A 1MIEH 5IB4B 1A6PA 1KPVB 4JO3L 1ANUA 1Z0MA 3FQWB 4HPOL 4ZD3L 3AXLB 2V7HB 4RAUB 5IJKC 2R69L 3NCXA 1AHWA 2BSCA 4LLQA 1Y07A 4JY6A 3GHPA 4NUMA 4QXTB 3GSQB 1EJFA 1MXGA 3ZE2B 1J5CA 1FNSL 7FABL 4YC2B 2VDKB 5J12C 1I1FB 1FVEA 3BKML 3UZVB 3C8KA 1T1WB 3NCJH 4F24A 5ILTL 2HLEB 3BX7C 3VMPA 3FN3A 3W9DB 4QRRE 2YPKA 2ZKWA 3MRDA 4HDIB 4N8VG 2Y7QB 3RY4A 3UTZB 2YEVB 1XCTB 3X3GH 1CXFA 2LU5A 2D4DA 4XN4A 3OXSB 3GSWB 3L3KA 4DKFH 5AW6B 2IWEA 4PEEA 1GKOA 3TP4A 2HPTA 4YSAA 2NTFA 3DMMB 1ZE3C 1C1EH 4XXCC 3FT4A 1HHJB 2DQHL 4GP4B 4GP8B 3F7VA 2WZAA 3IRCA 5DJCA 4JO2H 1O7SA 2YD2A 5J1SC 3X11A 4Z8FH 4RISL 5JIQA 1YMHA 2V3DA 4XB8A 3OR6B 1PDKB 5CLYA 3J7HA 3LHPH 5FGBC 3NPZB 3V4PB 2VDKL 4ZZFA 3E6FB 5AW2B 1FZJA 2HTLD 3D69B 4OZHB 4HWEH 1ZIAA 3T77A 5CCGE 4FDWA 5FM4A 1ZT1B 1V10A 3S5LA 1E5YA 1GY2A 1UWGL 2MFNA 1AD9A 3MRLA 2IXQA 3BSZA 1E50A 3F64A 3FFCB 4L3EB 2A99A 1E9PA 3C5ZC 3ZTNL 5FB8B 3U4BL 3RL2A 4OAWB 1WFOA 1YEKH 3BESR 2R2HA 1C5CH 2OMUB 4RRPA 5JHMA 4K4KA 5DZNA 1VACB 4S1DC 3HIZA 5JW4R 3L5XL 2A9NH 1MLCB 3UTTE 4U4IA 3VH8G 5AW1B 1CVSC 4OD2A 3BLBA 4YXHL 1T7YA 4K2UH 1YMME 4HIXL 4QGTA 4QRPD 5FOBA 5TQ0H 3V4PL 3PWJA 4BQ9A 3A4FA 1SBSH 1T0NB 3ZRSA 2Z31B 1G4RA 3IGKA 4DO6A 3GNML 3H3BC 3G6JB 2G0LA 5JHLL 1CICD 1AMXA 4Y9EA 3MUGA 3IGAA 4P9MH 1AFVH 4PRPA 4QHPA 2W0LA 3EJSA 1LP9E 2VLRD 3L3HA 5KYUA 4LAQL 3NCMA 3CH8A 2AI0L 5T1DL 3KBFA 3MCLH 1AI1L 4N3UA 1SXBA 5KVFE 3K72A 3SDDD 3PFUA 5A40E 3MRBB 2AQSA 1HSAB 2YAHA 4UINH 3DOIA 4GUCA 4M43H 2PTTB 1FG2A 1IC7H 1NBYB 5E5LA 3FB5B 3AWEA 4PCYA 1KCUL 3L4ZA 4Y19A 1IBGH 4MD0B 3WXWL 4KXDA 1QFUH 3ILPA 4XB3A 3QDGE 4TUKL 1F8TH 2XPGA 2I24N 3APNA 5DVNA 1R3IH 4PP1D 3C6EA 4PRAB 1BFOB 1F6FB 2GITA 1Q9WB 1E4WL 2NY1C 2BSRB 2UXGA 4W9HC 3KPRB 1ZT7A 3FONB 1I7UA 1PL3A 4MXVF 1CE1L 2MPAH 4M9PA 5CZRA 3M07A 1JUFB 2UY6B 3LIZL 5ES4B 3B9DA 5I8OH 1G4MA 2I9LA 1HJBC 2ODHA 4TNEA 1DANU 1BSIA 3MRIB 2HCZX 5DGRA 3RUGF 1JGEA 1HOCB 3WAKA 4IGBB 5DZOA 3K8LA 4HZ1A 2YJQA 1WHOA 3DHJA 2FJHA 1PZDA 1N10A 2APXA 4BK4A 4PJ8D 1KB5B 4DQOH 5I82A 4B53A 1NCBL 5C70A 5EC2A 2H26A 3H1ZA 5HGAA 4EI5A 2XRAH 3EFDH 1CVRA 2MQ3A 3P3SA 1D5IL 3QPQD 4ATTA 3BJLA 1N7ML 4UDTA 5I8EA 5E0FA 2ED8A 1NQBA 4GRMA 2WWOA 1CYXA 1KPUB 4L3CA 3WFHA 4XNQB 2CIKB 4U05A 1QBAA 1T4KB 2VR5A 4Z7UB 3QH3A 3QGVA 3SGDH 3HW7A 2H2SC 5L2JA 2Y1ZA 1DL7H 3QUZB 4U4BA 3IJ7A 4RDBA 2V2WA 2C9UA 5JXED 3LKNB 3QQ4A 3TS8A 5L4FA 3IKCB 4L4TD 2ZP9A 5D7IA 3P1VA 4E41D 2C9SA 4U1GC 5GJSH 1KB5L 1WH0A 3P11H 1BQKA 5DD6B 3TEXA 1M42A 1U8OB 2R23B 3HCVA 1H5BA 4HIHA 2RALA 2OMNA 4L0PB 1AQKH 5FKPB 1EHXA 4IDJL 3SD5A 2V7NA 1JNHB 1TITA 1PF3A 4OLXH 2BNRE 3A67L 4NWUH 5DURD 3F7QA 5IESH 3AITA 4GINA 5D1ZD 4KNSA 1CFBA 3ZKNC 1HWHB 4BV1A 2GJZA 4ZFGH 3HPLB 4ZYKA 4KMTH 3HE7B 1ID5I 1FFRA 5JMOC 2D03L 2APWA 2K3HA 3ULVH 5L0QC 4NO0D 3FSWA 2R7EB 2GPZA 3N1QC 3T08A 2WQUA 5D70H 3FFDA 3RVXC 4OFKA 1WP6A 2Q3AA 1BJMA 2EEAA 2G3ZA 3EOAA 3TF7C 3NJHA 4FOMA 5KS9E 4I87A 1KIUB 1KDJA 4NKOB 2QV2A 2EQDA 1IAKA 4LE8A 3MYZA 1F1AA 1X7TA 4P9HH 5F3HA 3ZO0A 5A2CA 3IE9A 3ILDA 3CG8A 4X7DC 3ZL2A 1Q72L 4NNYA 3WUWG 1HEHC 3Q6GH 5IFJB 1HH6B 4FN0A 5JUEH 4HHGA 1MCQA 2CA4A 3VXQB 3AREB 4BRVA 2WYIA 3OQRA 4XWGL 5D7LB 5IBTL 1MFCH 5LWYL 2O4EA 4NXKA 1DN2A 5E2VH 1M1SA 3BFWA 5F7FA 3R06A 4QO1B 4YGVB 2OYPA 2DQJL 3MX0A 3MRQB 1I53A 3PWNA 2G4EA 5CN3A 2VN7A 2X4QB 3L7FA 4XRCA 4EUPG 1H3UA 1NCGA 3MRHB 1XDTT 4JFEA 2R29H 2VWEC 4XODA 5CJOL 4N9OB 4QTHA 1ZA6A 1NGQH 4JKPL 4R6UA 4Z7NE 1W8EA 2GCYB 4NOBA 2WQXA 2ED6A 1DLHB 1TLMA 3VXPA 4C56E 2PLTA 3P02A 5FOJA 1IEBB 3FQRA 4ES9A 3RUGA 1S5HB 4E5XB 4Y16A 4KJQD 4DJMA 5AZ2L 3V4UL 1BMGA 4JZNA 4JO1L 4QRUA 5FYKL 5BO1L 3ZT6A 2J5LB 4EXPX 4IOIA 3ULUD 2WINB 4C4KT 3HUJE 5EZIL 3W0WB 1NC4D 1RULL 2JKIS 2Y7NA 4S0TD 4MYWB 4JMXA 1H5BC 4P06A 2DIEA 4U1LA 3SHSA 4QF1B 2NNCA 1G7LA 2E47A 3RGVD 4FI6A 2DAVA 4HEMA 5E1GA 3SGEH 5C0BB 3QFJD 3NA9H 4YBQC 3GUTB 1ZA3B 2ZOLB 3MREB 1WCBB 5CCJA 4QYAA 2DQGH 2B0SH 4CN4A 5I6PA 4FNLL 4HXBL 2QFRA 4EI0A 3U0PA 3JV4B 3NIDB 4I89A 4A2LA 4O9HH 4E42A 1RHHA 4PJ7E 5HPMB 2NUTA 1WFMA 4PJBB 3SE6A 1N9PA 2ISDA 3MLWL 1DP0A 4KVCH 1G7IB 3WJLA 2QHLA 4J2QA 1JZIA 4LCWB 5T3ZL 4TRPL 5CR8A 4D0CB 1UQSA 1UH3A 1IAMA 4JM0A 3O3BB 4QRRD 2YFNA 3LV3B 4P23A 3W5NA 2KS0A 1KJ3H 1EEYA 1BXUA 5K9OB 4Y5VA 3IGLA 4ANUA 4O2CA 2UWEB 3TN0B 2Y7SA 3GUFA 3TWCH 3V0VB 4FF9A 5E70A 4HIIB 1HDMA 1LO2H 1A4BA 2G9HB 3D39D 1RP8A 2C1OB 5GGQH 1QVOB 1QLFA 4I77H 1JK8B 3KE0A 4N1CA 1J8KA 3LRMA 3U4EA 1ETJA 2CRZA 4P5MB 1PZSA 3NH7H 1PG7H 4I0PD 3VB8A 2VRKA 2YK1L 1GYCA 3FT3A 4GMTL 4XCFL 5DJ6B 3QRFM 1VFBA 2VDQH 4MAYA 2VXSH 1Z5YD 3ZN6A 1G6RA 2IH8A 1U8KB 3DK0A 4FNSA 2P5WA 3M88A 3W11D 4EAEA 3TBVA 1CDCA 3HE6D 5FM5O 4KJYA 2P5EB 5AYTA 3QXTA 4FADA 4ZMLA 1KMGA 5E7BA 3WJMB 1GMEA 4O00A 1C08B 5TGBB 3QG6B 4U1JA 4ZXBD 1L9MA 4JZOA 2CALA 3O6LL 3WHE0 2K8QA 2WOBA 1P4LB 2F8IA 3KWVA 1YEDB 4Y16C 3PDGA 1XEDA 2G2RA 3L1FA 4R7DA 4PBWD 2OW6A 4AK1A 1OOAA 1NDGA 2XN1A 1GJUA 5KAQF 3ATBA 4RX4D 1ZKAA 3AB0C 3MBEB 5GS2H 3QR2A 3QUMA 3ZE0F 1QMUA 1CK0H 4RAVB 4A04A 1RZFH 1PZAA 3WKNA 1BD2D 2YD5A 4G9DA 4PJCF 4APXB 2B9AA 5CEZD 4ZDHA 1IIKA 4ZFFB 4KO9A 2ZCLH 5CEXA 3TPUB 1O7VA 4MAUL 4CVUA 4LDCA 2FJGA 1VCAA 4Y4FA 5I0ZA 4L3EE 1AGFB 5ADPH 4H8HA 4FQ2L 1JF1B 3GMMB 3QIUD 1AR1B 1IE5A 4FKKA 1UUSA 2VSDA 5HVGB 3BN3B 1XGQB 4FYQA 1VPOL 4BSVB 4KZEH 2GTZA 2IAMD 2PCYA 4X2UA 5EV7A 1CLZL 1KCWA 2WSDA 3EYQD 1OF2A 4AVHA 5IR1A 3WJLC 3UTSD 3UTPE 2X41A 2ERJC 4J4PA 4ZJ9A 2OQJB 5FYLE 1EDYA 3AUVA 3BYTA 2ZXEB 4M7JL 4Y5VC 4FI8A 5AW0B 3ZDYB 5I71C 3NJFA 4NQCA 1L6PA 4JRLA 2XU9A 5HYIA 4U0RC 5T1LD 3WO4B 2WVTA 4JL1A 1QEWA 2HVKB 1CD0A 3GDBA 3PL6C 5GS1A 1YN7B 2VZ1A 4P5SA 2XIBA 1VFUA 2CLZB 2P24B 2FX9L 2HN7B 3DRTA 4QT5A 4DK5A 1BIIB 3QFDB 2YKLH 2PWGA 4OH2A 2X9WA 3O81A 3UBHA 3T8XB 4IRZL 4LDEB 4NHCH 3HB3C 4F5CA 5MENE 3S3BB 4MAYC 1JBJA 2X70B 3OLIA 3I6KA 2BJMH 1ZPUA 1F4YH 3MLZL 2AMUA 3FRUA 4G2AA 4B27A 4OTXL 2ZSVB 2HLFC 3VSQA 4EQ2A 2PPFA 2XA3A 5EU5A 1WBXB 4DKAA 3OR7B 3MV8D 4MMZB 3CMGA 1CGSL 3DDGA 3V6FA 2IEPA 4JKWA 3FTYA 2YC1A 2EC8A 2XQYK 5D7KE 3SY0A 2NSMA 1F86A 2DI8A 2W0FB 4M7KL 5KVEH 5JO5A 2A6DB 3N44F 1QBLL 1HYSC 2OV0A 2F54D 4Q9BA 5AVTB 2OL3A 1RVFH 3PJLA 4NDMB 1E4XL 4KX9A 1GPOL 3HVDA 1OIOA 4MD5B 2DQCL 1BQHA 1WAAF 4Y2DD 1S7XB 5FO9A 2CUHA 3II1A 5D7JD 5EMYA 2MOQA 3UC2A 5IMMB 1BXXA 4MA8H 3LPPA 1CFTB 3QXAB 2Q10A 4Z78B 5LXGH 4AW4A 2ITFA 2P46B 1A7RH 2VAAB 4X4ME 3TEYA 3I9IA 4Z7WE 2R2EB 4YGAB 4NN5B 5C7XL 5F1NB 2J1YA 3I02A 3A23A 4G5ZH 5D7HA 1OWWA 2IANB 4WI8A 2J8OA 3NK3A 1KJ2L 5C92A 3DO7B 2PABA 4NIKB 2IDCA 1DJHA 5TE6H 4MJHA 4CU8A 5GRUL 1F90L 1J9QA 2ZKHL 4OKDA 2JELH 1AO7E 4F7TB 1G9ML 4QRPB 2NYZA 1PAZA 5KSVA 2RB8A 1O9WA 3L48A 1EGJH 1YN6B 4N2FA 4N5ED 2H0JA 1XIWA 4FQPA 2DQDL 4HMDA 1Y1UA 1O6VA 4J4PC 4P4RA 4JGMA 2Y6SC 4JN2B 4WCYH 3SGDI 2K9UA 3SQBA 4LSSL 4RGND 1W0YT 2DPKA 1YEGH 2DBJA 2VLRB 5IOPA 1A2YA 1ES0A 3FUHA 3VFSA 3TO2B 1WF5A 3LVEA 5IB1B 4XVUC 1A9EB 4YXKL 1U8PB 3SDDB 2MCMA 1M2OA 4JFUA 5GS1C 3N41B 3RJQB 4IU2A 5B8CB 4PJFB 1KCKA 3BN9C 1QOKA 3UJJH 4OZIE 4BK8A 1EVUA 4RRPM 2VRAA 3CFKB 5E95B 2XTJD 4L1HA 1GGCH 4ONHB 4RFEA 2RIKA 1S7SB 4NKDB 1NKGA 5IFAL 4KKNA 5E9DE 4KY2A 1A9BA 5KG9A 2B20A 5J7CC 1LO3H 2IALB 5E4AA 3N06B 3MLUL 1AD0B 3D30A 1ZTXE 1S9WA 1G9HA 2IPKB 5EORH 4NQXA 3S37X 3RE0A 1RIHH 1FAIH 2WQ8A 2YN5A 3MXWL 4H1LA 3BHBA 1ONQA 2QLVB 4X6BB 4GW5A 5HHPB 2IPUK 4FTVA 2X2YA 3KLHC 2VQTA 2P8LB 3Q9PA 3HC3L 4TSCH 4XMXA 5FK9B 4G8GA 4JRYA 3PHQB 3WFBL 1PD1A 1NAMH 1QTYT 1FVDA 2BVEA 1TT6A 3SPVB 3NFPA 1PYWB 3NACL 4M5YH 4Z7VF 4KX8A 4ORZC 3EJZD 1OAYL 2V17L 5AKSA 1UD3A 1WK0A 1NIFA 4HH8A 5HYJD 2J73A 4PJ8B 3P73B 3IF1A 4RA0C 4D3CL 1CPUA 1E9OB 2X6AA 1O7DE 4W9EC 5TPWH 2EYTB 1GC1H 1QFWH 4HUUA 1UB6A 1DHKA 4YDVA 4AEIL 1T0MB 5I26A 3M8OL 5F8RC 5DDHB 1U8NA 1DBAH 4HPHA 4KNTA 2VLKE 2XICA 4JZJB 4P57B 1QO3A 5HDBF 1UCTA 4ZSOB 4YHYC 1UGKA 3CSGA 4ETQA 1TNNA 2I25N 2ZUXA 4J8RA 2BY0A 2ZUQC 1J8HA 4XP9H 3D4YA 1RFDL 1YNLL 4KKZA 5CS7A 1BQLL 2GYSA 5C07A 1JIBA 4KJWD 3P3YA 4KVNL 4Z76B 2ZUUA 2EVJA 4R3SA 3RX5A 2KPNA 3HR5A 3MNZB 4K71C 1XIWC 4M62H 4J3UA 4L4TB 3TTSA 3VWJD 3GRBA 4E41B 2FWOA 4IYKA 5JIDA 3BQVA 5A6MA 4XPAH 1SXSA 2BNQD 4MVBD 3PAVA 3QWQB 1TCRB 3D51A 1FSKB 5DWPA 4BUHA 4UT6L 1TO5A 1XAKA 3W0WE 4OLYH 4CSZA 1IKFL 4IHOA 4HKZA 3GTVA 1Q9LB 2NYYC 3S2CA 2VERA 5DURB 2R0ZL 2A73A 3QYCA 4J23A 4PV8A 4AQ1A 4ORGA 1G7JA 2NY7L 5CP3H 5D1ZB 3VQLA 1N8ZB 1F5WA 2QSCL 1SQ2N 2Y06H 1D7FA 3B3IB 5DRXA 5CGBA 1IGYA 4NPYB 1NCUA 2FBJL 5DJXB 3II2A 1YUHB 4CDHA 1PZ2A 2H3XC 4NO0B 1UEMA 4DN3L 4UTBA 3SGEI 1RZPA 2FIKA 2VN5A 4W9DC 4LLDA 4LSPH 3VXTA 2IADA 4GIPD 2QQQA 4PJBE 5GGRB 5DC4B 5DHEA 1QI3A 5T5FL 3Q8FA 4O4YH 4N9GA 1JDDA 5LQBH 2Z7YA 3PY9A 2Z35A 3RWEA 2QDVA 4TULH 3S3DB 4KKQA 1PKOA 1CR9L 5JOPD 2OMTB 3MNMA 1A7NL 5GXBB 1YHPA 1GZPA 1WWCA 3B6SA 5AOZA 4DP5X 3S48A 3WN6A 2XETA 2Z92B 2UWEE 2H45A 5SWSA 3ZHKA 5F1SA 1Y6MR 3AT9A 3NJMA 4G8FB 1EEZA 3RZCD 3ESVF 3TBYB 4A7UA 4PBDA 4Z7QF 2NW3A 1I9JL 4MDJB 1M2VA 3SGJA 1TZOA 5K9KB 3OJ2C 3I50L 4JHAL 4OT1L 2IV9A 4A6YB 4GS7C 5KUMA 1TTUA 4I9WE 2X6CA 3FU3A 2OPCA 2Z91B 2EABA 2ZUVA 4K7PX 1HXKA 5EO9A 2VXVH 1QHQA 2VE6A 1BXVA 1G7HA 2WVVB 4D0BB 4WNQB 2N7AA 3BP6A 4GRLA 4UAHA 4PRHD 1CCZA 2H2PC 1KYDA 1H3PL 1IGIL 4GSDH 4LHQB 2D4FA 1R5IB 3SBRA 1ICTA 3O2VH 4PGDA 4OBRA 2VM4A 1FZMB 1HEZA 1B88A 3DTUB 4S1SL 1MFDL 4I3GA 1IARB 5DRNB 2C9XA 3MRRB 3QNZA 2XWBA 4FFZA 1H8NA 4PTTB 3F5WB 2CMRL 4N2EA 4GRWE 4OM0L 4K7PY 4AQAA 1RLBA 1Y0LB 2ZJSH 1MWAA 3TOPA 4BFIB 3BIAX 4EVNA 5FCSH 2D7QA 2HT2C 4PV1C 1A3QA 1WWAX 1SJVA 1MHHA 4A6YL 2EKSB 3O41B 7PAZA 1T20A 2AKRA 2XN9D 4P5TA 3O4OC 2OK0L 1MJ7L 4QXUH 1NC4B 3P30L 1GGIH 3P9MB 3WTTA 1EK3A 4QOKA 4AJWA 5D5ME 1ZT4A 5HI3D 3S8GB 2XWCA 3QCVH 3FU0A 4L8SA 4X6FB 4AEHH 3CHOA 5EZPA 2BPBA 1ZS8A 1T5KA 2R4RL 4A2EA 1MFUA 3RGVB 2I60L 2Z64C 2BINA 4AQ1C 2ILLA 2YR3A 4X6DF 1CDJA 5CIPH 3QFJB 3O3AA 3QQ3A 3F7KA 3BWZA 2Y24A 5SV4A 2NNFA 1Z3RA 1MF2H 1QYGL 4N22A 15C8L 1MREL 2Q87A 1MVUB 2FJSA 1EO7A 1RJLB 1T2XA 8CGTA 1QEXA 5DO2D 1ET5A 4DCQB 3H9ZA 1ITBB 3H9HA 3QIBD 1RY7B 1FGVH 2H32H 3ARRA 4M6ML 1SOQA 2CO4A 3ULUL 3SB3A 3VYPA 1MRCL 1UD8A 4GKZB 5C3IA 2C34A 1JPST 5JW5B 1W6WA 4NBYB 5BZZA 1DEEB 5T1MB 5GQBA 1R47A 4UTAL 1UZ8B 3GMLB 3WNLA 4NT6A 1LEGA 4I1RA 5TDPB 2FWSA 5JPMB 3PNWA 1UXMA 5I74B 1WC7A 1RUMH 4MS8D 4XCYB 2Z65C 1NKRA 1WG3A 3KXFE 4C47A 3DYPA 1CGVA 4X5XB 5T1KD 4H7VA 3OD3A 1P5VB 5DUMH 3TBSA 1TYRA 3INUL 4F20A 3GKZA 3EDJA 1XGTA 3SKNA 4X8XA 3BQUA 4G6AC 4NUGL 2WLYA 2H3NA 4NC2B 2XWJB 4I0PB 4R4FL 3OZKA 1OCWH 3CDZA 3UMNA 3EBGA 1Y6NR 1FAKT 4M7ZB 5KJ7E 4UM8B 1S78D 1NLDH 4P99A 2ARWA 4JG0H 1NCOA 3I75A 3LS4H 5EOQH 2X1PA 1CQKA 3GLZA 4MB1A 1Q90A 4XE5B 5L6YH 1HHHA 4ABVA 4ZXBB 1KYUA 4MB5A 1QRKA 2P52A 4N0YL 1BZ7A 4UI2A 2OP4H 5CP3A 2HRHA 3J27A 3SDXB 5HHQB 3FCTB 3RWDB 2CWRA 2HH0H 3AQYA 1V7MH 2MTAA 3K91A 4BZ2H 1QSFE 3CZLA 2EO7A 2ZXAA 3OJDA 5BRZD 3IDXH 4R9HA 1NEZB 2J1WA 3SPIA 4WFGD 1HHKA 4JO3H 2LLNA 2V6HA 3B7TA 4ZD3H 5E8PA 3UO8B 4LEXH 1X5HA 2R69H 1BD2B 3ARUA 3QG7L 2ZE0A 2OSLA 4PR5A 3RDTD 3SBWA 1S8DA 5F7EL 1T6BX 3ARFD 1BP3B 5KJ4A 4GKSA 1FNSH 4JFFA 1KIQB 3X17A 5KBPA 7FABH 1WIOA 4QRAA 3FT2B 3IU3B 4OVVA 4UB0L 3BKMH 5CCKL 1MUJA 4BDVB 5ILTH 4JLRB 3QIUB 2EIBA 2IANE 5EIIA 3Q8CA 4PCKA 3AQZA 1Z9SA 1M3IA 1FL6A 1KN2L 1EFXD 3FB7A 5IF0A 1NCTA 4Z95L 3FBKA 1S9YB 4HD5A 4OQTA 2QBWA 4NZUL 2IAMB 4IIQB 3BFOA 3S3PA 1T89A 3QJFA 4QEGA 4NQQA 4PJIB 1OAKL 4G83A 3LOWA 2DQHH 1UM5L 1VB9A 4N2BA 3UTSB 1M71A 3RAJL 5EO0B 2AW2A 2B77A 5F6IC 4XMPL 4NYLB 4RISH 1U2HA 5CEZL 3G9AB 1KNOA 3MA7B 5C0GA 4ZAKA 4HK0B 4HAKA 2BERA 2A77L 4FC3E 4MB3A 2VXUL 2VDKH 1AIFA 5JW4N 3EUDA 3HKZA 3HLAA 2VLJE 4X6DA 3QDHA 5T1LB 4XNYL 1SYSA 3AU1A 1A7OH 2V4LA 1AGCB 3DIVA 3Q0HA 4N2LA 1QLRA 1G0DA 3F12B 1OKEA 1UWGH 2FECL 3BD3A 4JPKL 5AG9A 1OT4A 5TE7L 2YUVA 3QDAA 3HOGA 3LSOA 3U4BH 3ZTNH 2XACC 3OAYK 3WS6A 2MPVA 1ZLSL 1WWBX 2PP8A 4OZGF 3QIWD 4NQEE 4FX5A 3PQYE 3WJJC 3L5XH 4PHZA 2VABA 2I9TB 4QRBA 5C09E 5DVMA 3VFGL 4L05A 2F8VA 3CPLA 3TBWB 3LPWA 4YXHH 1MELA 2VMDA 4OGXL 4HIXH 3DHMA 1TQCC 3MV8B 4XP5L 1MXDA 2GSIB 3H6AA 1JF6A 4E9YA 4F93B 3B5HA 3V4PH 4JFHE 1Z9NA 2R0KL 4WFHE 2I07B 2SODB 3OKEA 3QWOA 3DV6A 4LCIL 4GI9A 3GNMH 1XTMA 2F54B 3QJSB 3DUSA 1CXLA 4MXWL 5JHLH 1NLBL 2BFVL 3AGVA 3GJFH 3V0EA 4AYDC 2XQYA 4FCAA 4Y2DB 1P0SE 3SPGA 4TVPE 4Z3JA 1GHFL 1UXSA 1XSOA 5T1DH 2AJUL 2RA1A 4LAQH 2AI0H 5E5MA 5LDUA 3UPRB 5F7DB 1AI1H 3ESPA 4JREC 4WJG3 2DWEA 5C0CE 2V5MA 4YR6A 3IPFA 3ZMRA 1MCHA 4WJ5A 4LSUL 3FSVA 1SLUA 4RMQA 5DK0B 1A6WL 1H0DA 4PWGA 4EZMA 1YC8A 2Z93B 2A9AA 1KCUH 43CAB 1DJWA 1PCSA 2LU7A 2ZX7A 3GBNL 2WAHA 4LVHB 3WXWH 1G6VK 3BP7B 3FQTB 1BQRA 2X40A 3C09B 1QFWI 4M1CD 4AENA 1ROWA 4TUKH 1VADA 1EERB 1HXYB 3ZE1F 4G1MA 2CO6A 1Z6JT 2HKFL 1U3HB 3EGDB 1E5BA 2CU9A 1X9RA 3SDAB 1E4WH 1T89C 1KV7A 5I66B 4DPCX 4ACTA 2AERT 1Z0NA 4UM9B 3FT9A 2ZX5A 2BZ7A 4YSRA 2OXHB 3B2XA 5FW7A 2VDLB 4TTDD 1KULA 1CE1H 1VFMA 2J8UA 4M61B 3DXAA 1QHOA 3RVUD 4HCRL 1U92A 1TJMA 4OCRL 4ZAKC 3MLVH 4F7CA 4JQIA 4RGNB 1DJYA 4N20A 4MMXB 2X4NA 2CNYA 4DETA 5I16B 4TV3A 3NJVA 4G7YL 4HJ0C 4WHTA 2CBQA 3MFFA 3MGTA 4NSKA 2WK2A 3IDIB 2HT4C 3JBG7 4FGMA 3RWCB 5I1IL 3MA9L 1QLEB 4XNUL 4HJUA 4NO3B 1NCBH 4L2YA 5IM7B 5FECA 1R24A 3BVWA 2B8OT 2XTJB 4ZO8A 1JXFA 2F2HA 2XVLA 4ZBJA 3HLKA 1ZAGA 2X42A 1D5IH 1B2WL 3QORB 1N7MH 4G43A 4JHVA 5EN3A 4DK3A 3NA4A 4LB8A 2VDLL 4P2CG 4Y4KC 5DXWA 1U8QB 5I1LB 1DQLL 1UURA 3K6OA 1U8IB 2Y22A 1A8ZA 3FH7A 2H6PA 1INQB 3ARQA 3EG9B 2HFEB 1GW0A 1JWUB 3SEPA 5H2BB 2ICWA 2IJ0C 3I3EA 2EICA 4HF5L 4XBGB 3SJVD 1MOEA 4X9BA 4GG6B 1LK2A 3D18B 4RQQA 2O5YL 3NSDA 1KB5H 3QXDA 4YDKL 1QLEL 5FFGA 3O6FA 1LDPL 1N67A 5I76B 3MBXL 5CLZA 3U30B 2UZYA 5A2KH 2ATKA 2F5AH 2X4PA 4IDJH 4DEPB 5HYJB 3BZDA 3IPBA 3BAEL 3MJ9A 4OZGA 5IB5B 5CD3A 3A67H 3Q5YA 2Z1PA 2CH8A 4AZ8B 5I6MA 5EZOH 3RG1C 4YIQA 3Q2WA 2UYLB 1HCZA 2PYED 1QSEB 5EPMA 3VFNB 2YN3A 2D03H 1JZ4A 1SJMA 2FEEI 3LRGA 4Z7OE 1X4YA 4XXDA 4IS6A 3V5HA 5T1JA 4LEOB 1TQWA 3KPPB 3OKMB 2RJMA 2GVYA 1AYRA 3S5YA 2GJ6D 3U9UA 3L7EA 2BS71 2OMBA 3KDMA 3OGCA 5CSBA 3ZMNA 1MCCA 4LPYA 5DHVA 4W9CC 3EJCA 2Z7ZA 4ZQKA 2HXAA 4HULB 3P0VL 2C7UB 3FTVA 4L4VA 1T5WB 3VWJB 2XX0A 4G9FD 3CFJB 1Q72H 2XBTA 3OC5A 5J4MA 3V9CA 4KQ3L 4GUPB 1N5AA 1TR7A 3GD1C 5F2FA 2EUXA 4AYFA 5GRVK 3GSNB 4Q14A 2YARA 4Y4HA 4H5SA 3BJ91 1XF5A 4XWGH 4NP4L 1N0LA 3ARXA 1T1YA 5IBTH 2FO4B 3MV9A 5LWYH 5IK3B 3C5XA 1BJ8A 3CVHA 2DQJH 3CDFA 4PPTA 4GFTB 3BMWA 4B60A 2JI3A 2GIMA 3O9WC 1TZIA 2VR9A 3TASA 5EUKB 1NFKA 3CXHJ 4OV5B 4WU7B 5FGSA 2XOTA 1I7ZB 4QHMB 3UO1L 4Z3GA 5GGUA 5CJOH 4KV5E 4XOCA 5E8OB 3GXFA 4YJZL 5AB1A 4NO5B 4JKPH 3X12A 4PJAE 3MRNA 1Z1WA 1RIVL 3OGOE 4RGOL 1LHZA 1SDDA 3GSNL 5L8JB 1DVFA 2BRRL 1SBBA 2ZX8A 3NJKA 5M95B 2XG5B 1PZ5B 3ZYZA 5AZ2H 3V4UH 5IJCC 3IFOB 3TO4D 4JO1H 4QWWD 5FYKH 5BO1H 2F9BT 5KW9L 1ASOA 4AWJC 3ZDZE 5HJ3A 1HNFA 2BH0A 4MFHA 4MHHI 4XB7A 5L4IA 3THML 2X2JA 4F2MA 3VD4A 4TNWK 3M1BA 1JOIA 3GRWH 5EZIH 3WV0A 1RULH 4YDJA 3RZCB 1VZIA 4TF4A 3DROB 5DEGB 5HHOE 1IGJB 2V2TB 4P2RB 1ETB1 2VQUA 4AGNA 2K3TA 2YAMA 5KVDE 2FEDC 1JYNA 5AW4B 4DZBA 5AVZB 3QWRD 2BWDA 5D1QA 2AJXL 4JW3A 1WA1X 5GRWA 3EYSL 5DEZA 5JPNB 2O30A 3IFPB 1RUKL 4PJHB 1MCNA 4UNTA 4ODWB 2X6BA 4HXBH 4DKTA 1NUFA 5IB3A 1OANA 4J3OF 3KS0J 4JFDA 4PRHB 3ROOB 4K5OA 4FQIL 3FZUD 2VLMD 3GF8A 1I7RB 2XYCA 2COVD 3MLWH 4AE0A 1SEQH 5AYUL 3ZHLA 3CVDA 5CLTA 3MI6A 5EC1A 1T5XA 5T3ZH 4TRPH 4JAMA 1X5XA 5I17A 5ECJE 1XGZA 4L37A 3AADB 3RLSA 5FV2A 1FHGA 1SHSA 2PYFB 5IHZA 5EG6C 2QEJA 4DSYA 2ZKYA 1MHEB 2XN9B 4QHUA 4WTQA 1UHVA 4OD3L 1O6SA 2O5XL 5CBEA 1WYJA 4Y4HC 3NTCL 4N6RB 1W9XA 2G60L 3LIUA 5JXAL 1GGBL 2BOLA 2BNUA 1YAZA 3Q5TA 4AVJA 2V0AA 4KI5D 5D7IE 4HOWA 2YK1H 1FH2A 4GMTH 4XCFH 2VW7A 1PG7W 1W72B 2MWCA 1SFDA 4O51A 4Z3HA 3FO9B 2A2QT 4FHJA 3E1F1 2WLLA 4NBXB 4JEGB 2F6AA 4WUUA 2V5YA 1FHNA 1D5MA 4D0DA 5SWZE 1WJ3A 3KPNB 1PNDA 2HG5B 3L1GA 4WWID 1KT2B 4LQFL 3C6LA 1P7QA 1IKNC 3ILQC 1XF2B 2A6JB 5DS8A 3CBRA 3O6LH 4KUCF 5EU3A 3T4AA 3VM5A 3BIBX 5HDWA 1HCFX 1R4XA 4A7TA 5K9JL 1DVFC 2YBRA 4WTWA 1E8ZA 3MRPB 4U6TA 3RZWA 5EU6A 4F57L 1RJZA 4ANWA 1J9SA 3G04A 4ODXA 5G2NA 5C0ND 1OALA 5EHFA 4K9EL 5T1KB 1FO0L 1RMFL 2KQMA 2WXJA 4AM0A 5B1AB 5HHXL 5DMKA 1LNUA 1S7RB 1W72L 4NQSA 1QSZA 2YQ3A 5IVOA 3WDJA 4A1RA 1JPTL 2NZ1A 4MAUH 3MRFB 4RA3A 2WO4A 2D9QB 2DYPA 1OW0C 2CK0L 1TEFA 2OMWA 1NTDA 5D1QC 3MTXA 3OKNB 4FQ2H 2R2BB 5L8LB 5I2IB 4N2AA 1IFHL 1AQDB 1NCAL 2CCWA 5FWRA 3WENA 1I85A 4J1UB 2IH3B 1MCLA 1S7VA 5H4YA 5K39B 3HG2A 4P48A 1OGSA 1VPOH 2G30A 1R3HB 4Y5XB 5AZUA 3SBQA 1CLZH 4L8DB 2OI9B 3MOQA 1SMAA 1ZD6A 3FU7A 3GSOB 1X7QB 4YFEA 4Y5YA 4XO8A 2KLSA 5EZLA 4JFXA 2MIZA 4HVBA 5I1HL 2IH9A 5BRZB 2YD6A 2OAAA 4M7JH 1DDHB 2PWDA 1L0PA 4ZUUA 2CBOA 3D1MC 3C5ZD 3HS9A 1MCOL 2MOVA 1MCBA 3UPCA 1MI5D 1BGXL 1IB5A 3DUUA 3KWTA 3RDTB 2WLMA 3QK0A 4NFCA 5DZJA 3R18A 5I1AB 5KYYA 1VRSA 5CJXA 1OM3L 4S1DD 3ARFB 3K46A 4WO4A 1T1XB 4HGKC 5E94A 2ARJB 1WS7A 4I8DA 2BP0B 2FX9H 3ZSTA 1JNJA 1B4RA 1AZUA 5MI0B 5I5RA 2EE3A 4EDXB 3BDXA 4G8EB 2NNAB 1KFGA 5ESVB 3L3OB 1Q94B 4IRZH 3V95A 4XPBL 2M1KA 1EFXB 3A3YB 4QY8A 2OMYA 3VYNA 3GRWA 3HN5A 4JFPA 5FDWB 4URKA 3VACA 3W37A 3CVIL 3HZKB 5HYQA 2GC4C 4BSJA 2FUQA 4OTXH 5C3TA 3VJ6B 2WPGA 3MPCA 5JQIB 1IUZA 1W8OA 4PRBA 4QYOB 4OI8A 1X9UA 2WLZA 1SN0A 1CGSH 1UKTA 3BWSA 3T4AC 12E8L 5MP6H 2NRDA 4FZEH 4M7KH 3S2AA 1K8DB 1QBLH 4Y1AA 1PLBA 4H8QA 3CBJB 2ZOKA 1E4XH 5F0JB 1GPOH 4PHXA 5HYFA 1H3VA 2DQCH 1DE4A 2MQ0A 1CFVL 1QD0A 3ZGIA 5MEPB 3ABKB 4RMBA 1KJVB 3BZ4B 5ICXB 4POZD 3GMOB 3PGCA 4JKLA 1XB8A 3H3KA 4Q7DA 4Y8AA 4RGMC 3MJWA 3RX7A 4ZFZA 4U1IB 2VDRB 5C7XH 4FYSA 3CUPA 3HBGA 2FQDA 2PO6C 2KZ1B 2Y9RT 4BINA 1S9XA 4JFOA 4WI2A 4CSSA 1KJ2H 2YEZB 5LCVH 2ZWKA 5TF0A 2NY1D 4GB9A 3NP4A 4PJEE 3QIWB 3ZDYF 2GQHA 4ZUVA 1PY9A 4IRSB 5GRUH 1F90H 3PJSB 2ZKHH 3V5KB 3LVTA 3PDDA 4AGMA 1I8MA 3WY1A 1G9MH 3FCGA 3O6ML 5I75C 4YSPA 2DOCA 4ODHL 2SEBA 2XKUA 4MSWA 3VRJB 1WAPA 4PB0L 2IBZX 5AL0A 4Y5YC 1TMCB 2DQDH 3TFBA 4G6MH 4G7VL 3BWUC 4GMSL 4LHUA 2X3AA 4X8CA 1F1GA 3ZW3A 3CFBB 4CAGA 4LSSH 4FXKA 3G5YA 4Z3IA 2X88A 2C9AA 3QCUL 4ENZA 3DV4A 2PW2B 2Z9TA 4YXKH 5I6LA 4H44C 4HX1B 3P9LB 5H4ZA 4UANA 5CP7A 4QR7A 4M1GL 1XSKA 3Q6FA 2IBZY 2ZX6A 4DUVA 4Z0XA 2A7BA 3REWA 5CSGA 2DQIL 2H2SD 4W1TA 5IFAH 1SJHB 1QSEE 3N1GC 4J3SA 4UOW0 3W3BA 2LE9A 1VA9A 4AQ8A 1JDCA 4PMFA 3ZTJG 1QA9B 1OPGL 3LKSA 4QI3A 2EIDA 3MXVL 5AZEL 5HGDA 2FYYB 3MLUH 3DHUA 1JMXA 5GRZA 3ROLA 3OAWA 3E8UL 1MG2C 3JWOC 5M94B 1NFDB 5IVXF 4AT6B 3MXWH 4LRIA 4O58L 4PRPD 1DQQA 3ZL4L 1VLXA 1A4JB 2MNJB 2TRYA 4BHUA 2P1YA 4OVUA 3F65A 1OB0A 3WFBH 4I2XB 4NZTL 5GRJL 3LN4B 4N2NA 5BZDA 3AWGA 4M02A 3ZKND 4X50A 4BSWA 3UZQB 3NACH 2GY5A 5BVPL 4KJPC 1WQVT 4MB4A 3LEXA 2JCCE 2J6WA 4XE0A 5DD3L 4UAOB 2V17H 1OB1A 3GBLA 4Y19D 1MRDL 3ARVA 3MRGB 2JF1A 2NY2D 2NYKA 4M8UA 4D3CH 5HJDA 2RMNA 3ARBA 1CGWA 4HMCA 4N0RA 1NDTA 4RMUA 2EYSA 4ANXA 4YMPA 2EDDA 4XMKL 4AEIH 4EIBA 3M8OH 4JM2F 3JWNC 3QVAA 1WZAA 4D7PA 5CR1A 2ZYIA 2H47C 4XOAA 4OZFH 4MD4A 3T3ME 4PLNC 4JFYB 5J9PB 1MQKL 2VRQA 1T3FA 1RFDH 1YNLH 1BQLH 2VXQA 4AQEB 3MLPA 4I48A 3N41F 3JWDC 4UUJB 1PZCA 4CUCA 1LQSR 2NQDA 2Q76A 3H2WA 3PV6B 4KVNH 3SJVB 5DQDL 4U1SB 2R0LH 2X38A 3A47A 1SOKA 2A9ML 4TXVB 3PWLB 2VC2L 4LOUC 1E40A 4DGYL 1WT5C 3R0NA 3L1EA 4FFWC 4UT6H 2J6EL 1VAHA 5KOVC 3WLWC 4FXKC 1IKFH 4EI5D 5JORA 3KVPA 4QHLA 4P2RE 2R0ZH 3CXFA 2AMGA 2Q6WA 4CU7A 4LZKA 3FAWA 2NY7H 3QDJA 2ZG2A 5CMAB 2QSCH 3MQIA 4Q0XH 1OP3H 5MEQA 2FZ3B 2PYEB 1ULVA 4PAZA 5F9JA 1JZ2A 2E8YA 2FBJH 5H94A 1A3RL 4JRXA 1L9NA 4U1NA 4XGZA 4PJGB 3EOBA 4F3FB 4HK3N 3L5HA 5E7FA 2OMXB 3IJ8A 4TTGA 2XWTA 1MLBA 5T8IA 4DN3H 1JGDA 1KWKA 4H8UA 5FUZL 5KSBB 4DP7X 6PCYA 4JMNA 3CC5B 4LOVA 3DURA 2WN2A 5T5FH 3ZDXB 4F2FA 4FLHA 2OX5B 1JZEA 3OMAB 1XR9B 4LRIC 3T2LA 1JD9A 5DQJB 5F72S 4G9FB 1CR9H 2VGLM 4GJTB 5LCVA 2WO3B 3SYOA 1FFQA 3T3PB 3X2QB 3RU8L 1A7NH 3LEYL 5DFWH 3KJ6H 2DYRB 2HAZA 1OD9A 3CQQA 4ZTEA 4D9QD 2A83A 4WTZA 5LBSA 4YBQD 2VUOA 5J13B 1CDHA 2WQVA 5DJ8B 1KGCE 2GAZB 5AOKA 3MGOB 4U3HA 1I9JH 1W0VA 4HHAB 2GUOA 4R2GC 1ODUA 4JHAH 3I50H 4OT1H 4CMMB 5L2KA 1MNNA 1QBML 3IM1A 1KJMB 4RLDA 2AK4A 2JH2A 1BW8A 2NY0C 4LVNC 3ARBC 4LMQI 1EAPB 4EN2A 5DYOA 3FSAA 1HZLA 4QHKI 3BP4B 4N0FA 1FC2D 2L4OA 4H88L 5IVXA 1CYWA 1PLCA 3CU1A 4B41A 5ANMA 4X0KA 3X14B 2AV1B 1H3PH 1IGIH 3PWUB 5BS0B 4JHWL 1S4IA 3FMGL 4W9GC 2FHFA 4EF3A 4S1SH 5JIPA 4AE1A 2V3FA 1MFDH 1F6AB 3JVGC 3E9UA 4P8QA 2CDFB 1FJ1B 2CMRH 1OM9A 4OM0H 2VL5B 5BZWB 3WY2A 1KBGL 4P2YA 5JOFB 3ARWA 5LN4A 4LT7A 4A6YH 1TQBC 4MCYB 1CMOA 2OK0H 2WY3B 4K8RC 1C7TA 3WDHA 1MJ7H 4MYPA 3P30H 4URTB 5L4MA 4X5QA 1U30A 1UTDA 4DP2X 2HJLB 3VFRA 4JM2A 2WBWB 1VJSA 4JFED 3TEWA 5D4JA 2XIIA 5IQ9B 1OT2A 1WZKA 2FQFA 2R4RH 3B8YA 3QJQB 3UL4A 2I60H 3AS2A 2B39A 4G8GE 2E75C 5C71A 1WBYB 2V8MA 1KPRB 3FAXA 3QPKA 4MCMA 3ULVC 1R3JA 3LEVL 2YRBA 1QYGH 4JKNA 1MREH 1WZ1L 2C9VA 5IQNA 1RCYA 4Y16D 1NMCB 5F6HJ 5B3JF 3GMRB 4K0OA 2PPDA 4LBEB 1S7WA 2WV3A 3ME0A 4M4RA 4X6CB 4M6MH 5HGHB 5KSUA 3ULUH 3B7SA 1MRCH 4OFIA 3BEVA 2BSDA 3ZZ1A 4XN1A 1UKQA 5A2FA 3I85A 5IW1A 3EYFB 3LH2L 4ILDA 1UOVA 4P9HC 3VXSA 1X6NA 2DW5A 3FRPG 5I8CA 2WIIB 3WTWA 1A6TB 4N90D 4NUQA 5BCAA 4UTAH 1NMAL 1I3GL 4XCNB 4GLRH 5HJGA 3F7PC 4PY7B 4AKQA 3C5JB 3N43F 1EJ8A 1JWSA 4YPGB 5JW4Q 3MVSA 3UAFA 1YY9C 4NQDA 4OZFA 4J8QA 2WQRA 4X8JB 4YHML 2WWKT 2GKIA 5C07E 3INUH 4GXUM 1AGDA 5I73C 3GTTA 1O9VA 2BSBA 4NUGH 3HS0B 1PIFA 3L54A 3G5VB 4R4FH 4R4NC 3TCLB 1TTBA 2ZAGA 2GB2A 3V5DA 4ANKA 3ULUF 1Z9OA 4F58L 1I3RB 1AP2A 2ZYRA 1M7IB 3MO1B 3NSJA 5IMOA 3V52L 3QW9A 2FCBA 2WXRA 1ZHKA 4MASA 3RGHA 5CGTA 5C9KA 4P23D 3DLQR 3AZUA 1FNHA 2BVPA 4N0CC 2L0DA 4D9RD 1IJNA 1ZGLA 4N0YH 3ML8A 1JWMB 3NPSC 4MCZB 1XCQA 4B6ZA 1H6UA 1YPZE 4KH9A 1V3LA 2W95A 2H1PL 4LAJH 1RXLA 4X6EB 5T3XD 3QEQA 1A21A 2OZ4A 2GFBB 4GG8A 5J12B 1BQ5A 5ETUA 4M48L 2QDWA 1A7QL 3HN3A 9PCYA 3T0XA 1T6VN 5C1MB 2P5PA 2P49B 2XVGA 1FF5A 3MN8A 1C5DB 2OKMA 3HHSA 4XCEB 2Y2YA 2LAGB 1ZK9A 3GHEL 3QG7H 4MAYD 4TQPA 3UABA 1E4XI 5F7EH 1CWVA 4O02A 4DTGL 4OCNC 4QJ3B 5KVGE 2XC8A 2P5WD 4B9GA 3HJEA 3NABL 2UZXB 1F11B 4O5LL 3LN5B 5MEOA 5L8KB 4UB0H 5CCKH 3QDME 2O93L 5CBAA 2YO3A 3RNKB 4XC3L 5SWSE 3TYFB 5I1CL 2ICEC 3BCFA 4XI5C 4YDZA 4LU5L 4WWKA 4IIZA 4LP8A 4YNYB 4XBMA 4CN1A 5F7HA 3BGAA 3NJIA 5A2LH 4Z95H 1AC6A 3RWHB 3FHQA 1XGPA 2X4OA 5SX5H 2CUAA 5GGSA 3UC0L 4NZUH 1WS8A 1LJMA 2FRGP 4FQXA 5EH1A 3ETSA 1OAKH 4JK0D 3TBTA 1N59A 2B4CL 1UM5H 2JKNA 5HYSB 1XGRA 4QAWA 4W9JC 3GPEA 4ZUWA 3RAJH 3MV7E 4KZCA 5BXFA 3X1NA 4XMPH 2K6YA 4UBDC 5CEZH 2BVQB 2C4FU 1IIIA 2XT1B 3N50A 3DDFA 3PAUA 1T04A 1P7KA 3KGRA 5K93A 2A77H 3A0OA 3C5ZB 5E1HB 3I3BA 5ESQA 1KZYA 2CJTA 1MI5B 1LL1A 4Y4FD 2VDNB 3DUHA 4XNYH 1U33A 4LNVA 1BHGA 1FNLA 1XTLA 4FP8L 1GYUA 1D9KA 1MKFA 1LEIB 3SDXF 3H53A 5C0JA 5KUKA 2X3BA 2EE6A 4N8VA 4JPKH 4MKTA 4IM8A 3OKLA 1F4XL 5J56B 4X7SH 5IEHA 5DJAA 4WDIA 4PWKA 4Z3FA 4GI6A 1RQ5A 1EDHA 5EF3A 3ERXA 4M1DL 1ZLSH 2RBLA 4X9HA 1M7DA 3EBIA 5JDSB 2MKLC 2BVTA 4UDUA 5DJ0A 1PY4A 1PQZA 1QAWA 4R96B 4J4PD 2NZIA 1RZGA 5GSRB 3VFGH 2CG9X 2Y6SD 1BAFL 4BE6A 4OGXH 4S10A 4XP5H 1USZA 5TQ2L 4IU3A 4NLHA 1ACXA 4L5FE 4LKCA 2WXPA 1SRDA 2R0KH 3VFMA 4NN7B 2PTUA 4NQCD 2VDNL 1TUPA 4LCIH 1NBZA 1AHWB 3FUMA 4LLQB 4JY6B 1T2QL 1N70A 5SV3A 3VXRE 3QQXA 4MXWH 4P2QE 1NLBH 2BFVH 2YPLA 3KYMA 3LKPA 4UIKL 3ZTEA 3G3LA 3EGSA 1KUMA 1FVEB 4X4XA 3C8KB 1GHFH 2FO8A 3EDKA 1NL0L 4AIOA 1CLOL 4DHLA 2AJUH 5AAWA 1HAWA 1V7NL 5LAPA 4GH7B 2YPKB 4Q6IA 3MRDB 1WZMA 3VH8A 3QO1A 1E6JL 1Q1PA 3ALPA 1Z3GL 1F6LL 3NCBB 3RVWC 3BKCL 3L3KB 4KKRA 4YDLC 3Q13A 1A6WH 1QRNE 3C5SB 4XX1E 3WIHL 4LIQL 1IBDA 1N3NA 2NTFB 2XHNA 2NY1B 3LNHA 3FT4B 3GBNH 4MJ6B 4HAGA 4F9PA 1F56A 3F7VB 5T33L 2VTFA 4FXGC 5DJCB 4DKEL 5IFHL 5BVJA 3KLHD 4M5SA 1WE5A 5HBBA 5I6XC 1NGYA 1YMHB 5CUSL 1BM3L 1J0IA 1O6TA 2HKFH 5TFSL 2ESVE 3IDMA 5HI4D 3FO0L 1QP1A 4UZUA 5TJWK 5E99L 1FZJB 3DIFA 1OP5H 3KBPA 2R9HC 3S5LB 3MRLB 4HCRH 4OCRH 1NWPA 2BXYA 3F04A 1MJ8L 2IXQB 5AENA 4JE0A 2GY7B 4XNMA 1H6EA 4F80A 1E9PB 4W9FC 3RL2B 3GGWA 1Y18B 3ECWA 3QO0A 4PYHA 5D4IA 3RFZA 2R2HB 4JDVA 1KYFA 5EEVA 3HZ3A 1B0RA 3A4DA 4YLCA 5I1IH 1Z7JA 4NCC2 2P28B 2IWKA 1OAZL 3GXPA 3MA9H 4XNUH 1WCQA 3QJHA 4OD2B 5AW5B 1OSYA 1WITA 2QZ5A 3DETD 3MR9A 2EDWA 4N0UE 5FOBB 3PWJB 4WKXA 3D06A 5DR5L 1U41A 1B2WH 1OQOA 2Y4SA 1XIWD 2HFTA 3D2UA 1XL6A 2P8MA 2VDLH 1M1XA 4F9LA 4R5XA 3BZEB 3APFA 3IDGA 2X10A 1DQLH 1F0LA 2RTTA 3MLXL 3LRHA 2F7RA 1BZOA 1A0QL 1MY7A 2YGQA 5BNXD 3BSZL 1JVKA 4Y8DC 1HL9A 4JDZA 4PRPB 4TLUA 3ZDXE 2XX1A 2NX5E 5KYUB 2P8PA 4HF5H 2Y2WA 2NYYD 3KYOB 3OXRA 5F44A 4QTIL 1TTAA 3K72B 2O5YH 3T3PE 4YDKH 2XXFA 4Z7IA 4TN9A 1QLEH 2FLMA 1E9QA 1FG2B 1LDPH 3DVGA 3MBXH 5H8DA 3UTTA 2O1AA 1W6LA 2EIMB 1BVZA 3WKYA 4AYGA 3E2HC 5AAWC 5L0QB 1YMMA 2QADC 4XX1G 3BAEH 4Y19B 5D1ZI 2D7TL 1LLAA 4FNTA 2NY2B 4Q6IC 3E3QE 3OX8A 2XPGB 5B38G 1BLNA 3SO3C 1TZ8A 2XA8H 3VU1A 1KGYE 4KI1A 2GITB 2V5TA 2XI9A 4CSPA 4ELME 1GGYA 3FQXB 3UBXG 3V8CA 3EJQA 3TM6A 3QUKA 3QUHA 1ZT7B 4F9PC 4FTVD 4XO9A 3DX9A 5KS9F 1I7UB 5G5DA 2QELA 5DU7A 3TVMC 4MRCA 1LP9A 3CC1A 5C08E 4CSTA 2NSQA 4G8GD 2I9LB 3BT2L 1EXUA 4JRYD 4Y7OC 2APVA 2GSGB 1JGEB 4XAWL 5C0EA 1DUZA 4Y0GA 2JJUA 1E7VA 1YY8A 1EVTC 3KJ4B 3P0VH 4Y1SA 2FJHB 4XH2A 1UM4H 2YOCA 1E65A 4KQ3H 2E5EA 5EA0L 5E6SB 1ORSA 4MNGB 1J88A 2X1WL 2W07A 3PUCA 4HFWA 2W65B 1UWEL 3QDGA 4P2OC 5EC2B 4NP4H 3X1EA 5HGAB 5KANI 4EI5B 5I19L 4XMVA 3MUY1 1KTDB 4R83A 4QHNA 4I18A 4XBEL 2XJKA 2JTYA 2QMKA 3T0EC 5K5YA 3M45A 4UDTB 5DRWA 5I8EB 5I0VA 1JK9A 2H2PD 1YEHL 5DD1L 3KNBA 4GG6F 1JHTA 4G1EA 1J8HD 4L3CB 4PFEA 2FT8A 3WFHB 2WVSA 4I3SL 1OSPH 3OPZL 4QGYA 4LOFA 1KTLA 3QH3B 1DSWA 2MNUA 2TSBA 5C07D 3UO1H 4ZX6A 1ZCRA 5EIQA 5L2JB 3G08A 5DEFA 2HPOA 2XZCL 5J6HB 1YDPA 1TZHA 1E4KA 2V2WB 1FFPA 4AYMC 3QQ4B 2HT2D 4NRXA 3RWFB 4LCCC 3L4VA 3WUWA 4EBQL 5FW6A 4F9LC 5EIIG 1OSZA 4KXAA 1RIVH 4RGOH 4KTDL 5LN8A 4NQVA 3GSNH 2BRRH 2FR4A 3HZMB 3H9SE 3HCVB 4EE2A 2BIPA 2ZUWA 3O8XA 4WUKL 3NCYS 4HUXA 4WJKB 1KCSL 2V7NB 5DVKA 5KW9H 4GBXC 4AEEA 3A4EA 1B0IA 4K23L 2EDYA 4N68A 1TQTA 3MNWA 3THMH 3IJHA 1GY1A 3JV0A 4NZDA 1I8LA 1P6WA 1EX0A 2GJZB 2V8LA 4XP4L 4ZYKB 4EUPA 4GLRI 2ICCA 4F7PA 4MA1C 3VXMA 5TK4A 2FHBA 3OWRA 3UDWA 4PI0A 1IEAA 5H37H 5IV2A 3FFDB 5F89A 4PJ7F 2AJXH 5DZVA 1JV2B 3EYSH 4KKLD 4MZRA 2GUYA 2MMXA 3S4SG 4RNRA 2BVOA 1RUKH 2AEWA 3VWKA 5J89A 2OTUA 2BY1A 1KENL 2NY3C 5DMIL 2IPTH 3CFEA 3LZPA 4XBPA 3VXUE 2OSYA 5F3HB 4FQIH 1KTCA 1FYTE 1C1EL 4OCMC 4EO5A 3T65A 4NNYB 1PG7X 5AYUH 3S37L 1ZEAL 1NAKH 1E4HA 2FBRA 2BNRA 2OA9A 5SWSD 1KCRL 1ZGLP 4A7QA 3NZHL 3ELAT 4G6AD 1ASQA 3D8MA 2J20A 3MX0B 3PHOA 1HH9A 4OJAA 2R8SL 2CUIA 4HWEL 1HKLL 3KCPA 2WGNB 3L7FB 4DEWA 1SYVA 4DGWC 2GIYA 4OD3H 2O5XH 4XRCB 3QI9A 4JFZL 5IIEA 3QR1A 1U36A 3NTCH 4JFEB 5KYNA 4ZS6C 2G60H 2XCMC 3S34L 5JXAH 1GGBH 3KPTA 5C9JA 1BM7A 1DQKA 1KACB 3SQRA 5IQOA 4GRLD 4WSJA 5KS9A 1ZA6B 3T2PA 1CS6A 1GSKA 3PP3K 3HC2A 4M8QA 3KCWA 4LSQL 3VXPB 4XR8C 3VDBA 3QBTB 2WJ7A 3BRGC 1TPXC 3FQRB 4GKOA 3GZPA 3RUGB 4Y16B 5I1JL 1MW3A 2HTKD 3U6RB 3NAAL 2E74C 1Q9KA 4Q6YA 4JZNB 4QRUB 5EB9A 1I8UA 1S46A 1E4KC 2QL1A 3CZNA 2ZXDA 4XZUA 3DPBA 2K0RA 1SBSL 4LQFH 1EZUA 1WVZA 1JHLH 3LKRA 3LZFL 4WO0A 4PJDE 1TTGA 4P5TD 2WXFA 4IJ3C 4RMRA 4DPBX 3R19A 4P05A 5K9JH 4QOKD 5I1DA 2YSSA 1LD9A 3NFNB 3H6JA 4U1LB 5DLML 1J1OL 1AVAA 4F57H 2P80A 3RX8A 2CM5A 3KLKA 1G7LB 2OFQA 5AWNL 3DSNA 4K9EH 5DA4A 2X4RA 1FO0H 1RMFH 2D9CA 2FWLB 1N2RA 3WEOA 5HHXH 3HJ0A 3L4CA 4EDWL 5J57B 1HOEA 2F15A 1FNGA 3LJ3A 5E6IA 5CCHE 4IW4C 3U0PB 1K6QL 1IAIM 1JPTH 4L9LB 2OLDA 4C56A 3B4NA 1RHHB 2FEJA 3UDWC 4YHIA 2B7DT 5AOLA 5AQ0A 4M9OA 2CK0H 3PPSA 1NH6A 1FNEA 1TVBA 1MCEA 1MCWM 5DHYA 1X5JA 3TEZA 1KOAA 4CC0A 2FECI 3KPSE 2DLHA 1IFHH 1NCAH 2ERJB 1UQSB 4X5RA 3HUJA 1R3IL 1FZKA 4P23B 1EEYB 4YZWA 5EZJA 3V0HA 2D0FA 4Y5VB 5F1IA 4KRPB 4O2CB 4CA4A 5I71B 1HL5A 4EPSA 1CE6A 3HG1E 1NOAA 2VZOA 1HDMB 1KXQE 4U0RB 3UJTL 1V8HA 2R0WL 3AUWB 5I1HH 1QLFB 2LABA 3ORJA 3U1SL 4C55A 3FTUA 3U4EB 4P04A 2BOBA 1MCOH 5DLLA 3FT3B 4UNVA 2AQ1A 1VFBB 1BGXH 4PJ7A 3WUZA 3S96A 4NKIL 1OLZA 5CJ8A 4OLWL 5E4EC 4DQOL 4YSEA 3IGUA 1OM3H 3QI9C 3VYOA 4LESA 3SE3A 3MDJA 5DC0A 2IPUG 2P5WB 5KYWA 1WD8A 4RZCA 3RL1A 4E9RA 2WAQA 4N8PA 4AUJA 5J06A 4KJYB 1RUAH 4C58B 2G4GA 1NGWB 1F41A 5KZCD 4N4YB 5KN5B 3GIZL 3C2AL 3JUYA 4JZOB 4XPBH 2ZZUT 1RPUA 3AT8A 4MKMA 3GXNA 4FJ6A 3GPSA 4AJVA 2NZ9C 3JXAA 3CVIH 1MEXL 4HJIA 1X5YA 4R7DB 4ZX4A 1ZGLM 1PEWA 5T3XL 3GZKA 1BZQK 1H9VA 1NDGB 4UF7C 1JGLL 2WANA 4WENB 3F58L 1PVHA 1R3LA 3OBAA 4PVNA 3UIZA 1F13A 2O72A 1JHKL 5DUPL 4CADA 3GSQA 4YSDA 12E8H 4E9SA 5GJSL 2V9TA 4G9DB 1NCDL 2FQEA 4H8WL 5IUCA 1G6RL 1DQIA 4ZDHB 3UZEA 5CEXB 2EADA 2YMXL 4JFFD 2UUDH 2QKIA 2FJGB 5F3FA 1UFUA 4GIAA 1S9VA 4Y4FB 4LCUA 1BQUA 2X53A 3B37A 4KK8C 4LPUA 3RPBA 3UTZA 2E9JA 4ZTOL 2KLRA 5D1XE 2HLAA 3OXSA 5E6IC 3L9YA 3TA3A 3ULAB 4HG4K 4ZFGL 4AITA 4XO3A 3TIDB 2GTZB 4BFJA 3K6NA 4PVBA 4HJJL 2DLGA 4HETA 2AK1L 5IR1B 3QUML 1KTBA 1F3JB 3IGFA 4EJ1C 3OR6A 1J10A 3D85A 1IM9A 3IDYB 5F7UA 1JL8A 3UYOD 2I7OA 4ZAKD 3D69A 3PJNA 3O6MH 4OCLC 1FA4A 3I9AA 2OTWA 2A74B 2YHGA 4ODHH 3NIFE 4M93C 4JFVA 2A1WH 3EFOA 4NQCB 3OAUL 5CZKA 3RTQA 1C9SA 2PWEA 1YSOA 2R1WA 5IJDC 4HJ0D 4EN3A 4L3EA 4G7VH 2MCG1 1J7VR 4GMSH 3SPCA 4QT5B 3DRTB 5DJZA 3H3PL 3STZB 1V27A 2EDTA 1VCBC 3KLAB 3PE9A 4OZIF 3QCUH 2ZCHL 1DDTA 2P7TA 5KBMA 3I6KB 4XPHL 2W9EL 4QIRA 3ZBMA 3FRUB 4M1GH 1MCJA 1T0NA 5EU5B 4GO9A 3KGSA 4S2SA 4U7SA 4Z18A 2JIXA 2DQIH 5HDRA 3G6JA 3RRQA 3V6FB 2IIJA 2KPWA 4KMQA 4XPGL 4MGXA 3SY0B 2E8ZA 1OPGH 3WSQL 5JO5B 2EUZA 4BQCA 3MXVH 5AZEH 1U3NA 3D3VE 5DJ2A 3E8UH 2YXVA 4YHKH 3BC9A 1BQHB 1EHKB 2P47B 3GM8A 5FO9B 4O58H 3QZWG 1ZVNA 3ZL4H 1U91A 1RHFA 3EO1A 3QIBA 3IWUA 2WYZA 4G6FD 4NFBA 4WZ9A 3SN6N 1K5WA 1P84K 4CN6A 5FYJE 3GBEA 5KTEL 5CILL 1YYLL 4ZX3A 1OGAB 3TXAA 4YC2C 3DX0A 1WAEA 5MENA 3UZEC 5GRJH 4XHQA 3FOMA 4E68A 3I02B 2QKIC 5BVPH 1QQDA 4MNGE 43C9A 5GS0D 5IMLA 3FKUS 4NRYA 2GSMB 5DD3H 2CRMA 4YHPA 1I8IA 5I1GH 1CTOA 4OCYL 4YHYB 1MRDH 4CKVX 2LW3A 1KYOK 3PXHA 5C7ZA 4R5VA 2WBXA 2W59A 1K8IA 1BEYL 3DMMC 4NRZA 4ZX5A 4AGQA 4EKXA 2BSRA 4XMKH 2OL3L 1SVZA 1UWXK 4P3DA 4ELDA 5KSVB 1H8LA 4MXQD 2AJSL 1T0PB 3ZE0B 4A67A 3IAPA 2UY6A 2J1ZA 4BWWA 1XIWB 3IRPX 4WWPA 4L8BB 4EOWL 2XPYA 4PJCB 1MQKH 4P4RB 2WP3T 4KZ0A 5JQHC 2WSKA 3DXAD 3WFEL 4ICWA 4IGBA 2YKKA 3SQBB 2FB4L 5EOTA 1SXAA 4X4MA 3L4WA 4BZ1A 4Z7WA 1SZNA 2JJTA 5F71A 5E5UB 1H3XA 3BAWA 5IOPB 3LQAC 1QSVA 1A2YB 3CIQA 5DQDH 3RTQC 3VFSB 4HQQL 2ZF9A 3HBZA 3LB6C 2A9MH 3P4OA 4TQEL 4XPFL 1VKXA 3GEFA 3PPEA 2VC2H 1A4AA 4IU2B 2ZNXA 3CSTA 7PCYA 4DGYH 2ZOTA 2VZUA 3MSPA 4CMHB 2P26A 2J6EH 4JANA 1AO7A 1A7PL 2A9CA 4XNZC 1A9BB 1YAIA 2YUXA 5HPOA 3AWFA 1HSBA 1BECA 2CIKA 1T4WA 4FABL 3GK8H 4G5AA 1S9WB 4F8QA 2ED9A 5IY5B 4NQXB 1A3RH 4AH2A 2Z31C 4H1LB 2WYTA 4KTEL 3BHBB 4Z1PA 4GW5B 1YA5A 3K6DA 4FTVB 2VZVA 5TTRA 3H9YA 1FN4A 5FUZH 1RZIA 4JRYB 1PKQE 3QUYA 2PCPA 1OWRM 5GIRA 1BREA 3VD9A 1FVDB 1ZVYA 3VMOA 3T6WA 3O6FD 1OAXL 4ZMYA 1OD7A 5EULV 2E7HA 4J6RH 5HVFB 4OZIA 1ND0B 5A6LA 2YQGA 3RU8H 3GMNB 3IF1B 3LEYH 1CK0L 5EUOE 5FFOA 2H7WA 3ZVVA 1XFPA 5E9DA 4HUUB 4GKLA 3WTXA 1Z5LA 2EH7L 2VMFA 4YDVB 5JA8B 3CZUB 1D2OA 1DQDL 4YHOL 4N86A 2JKLA 4XMWA 5DD0H 1NOLA 4JG9A 3TBBA 1U8NB 3PUUA 4RESB 3U82B 3QUGA 1I1YA 5A2AA 1QO3B 2CKBA 2WD0A 4C83A 1QBMH 3EJRA 2WC7A 4DOHB 2IOMA 4ETQB 3ZZLA 2YRPA 4J8RB 1INDL 3N44B 1J8HB 5HHME 1BJ1J 5C6PB 1QATA 3FB8A 4YX2L 2ROYA 4H88H 1VZHA 1S6NA 4NHUA 5B39G 5F9WC 3D6GA 2RFXA 2JLPA 5JIKA 4LPXA 3HR5B 4L4VD 5FM5M 3EKCA 4EZKA 1BX2B 4JHWH 3T6ZA 4JNXA 5BUPA 3FMGH 3CXDL 4GRWF 5D93B 4TUOA 3L8QA 2Y1YA 2W9LA 3QJRB 1CC3A 2WXKA 4ZS7L 4IGBC 5J11B 4Y4HD 3L9BA 1XD1A 3VI4E 2JJTC 3GBML 3MV9D 4IHOB 3W39A 4HKZB 4AGLA 1KBGH 2P43B 5D5MF 5DZAA 4ENEC 4E9LA 4PV8B 3APCA 4ORGB 1G7JB 2YGPA 1JVOA 3U2IA 1H15A 2VLKA 1AQ8A 5DRXB 5FA3B 3LTVA 4GEIA 4LFHG 4RZKA 1IGYB 1AAJA 3L2MA 3U6XA 1LEKA 2J88L 3C75A 1R3KA 1VSCA 2ZWYA 4WFEE 4GW1A 1L0XA 4BKLA 4U1HA 3CH1A 2RAMA 2BVYA 1VF5C 3PWPB 1DLHA 4E0RA 2EVIA 1JZJA 5FKAA 4DZ8A 5I9QB 3VVVA 3QULA 4J28A 4LLDB 4Y9GA 4G6KL 3VXTB 2IADB 4AOFA 4DERA 1QX1A 2KMWA 3Q06A 1TTFA 3LEVH 2CIIA 4N9GB 1WZ1H 3WXVL 3QUZC 1DVFD 2QQLL 1TG8A 2Z35B 3DVIA 3DGGA 1EH9A 5C0AB 4G6JL 4GW4A 2BS8A 4K3HA 3W0WA 2CPCA 3UGUA 2X28A 3B6SB 2Q2LA 4ZMPA 5EU7E 4APQB 3QUYC 5EEYA 4ACPA 4BWUA 4EZLA 2QVFB 3LH2H 1UD2A 1EEZB 4PCSA 4XPTL 2NW3B 1QG3A 4MA3A 4IKNA 1I3GH 1M2VB 2J21A 5C0BA 1LWHA 4LARL 1ZA3A 4FAAB 1ID2A 4UTBL 5C2UB 4W6WB 1WCBA 1UJ3A 1V05A 5DUJA 4HH9A 1J0KA 3JV4A 5D1QD 1CGUA 2DM7A 4YHMH 5I15L 1NA8A 1X5GA 5EO9B 1JPEA 1AY1L 5IVZA 5LVEA 2DLIA 2VE6B 4GQRA 4PJBA 1G7HB 3E9TA 1RD6A 2DS4A 2XBDA 1KZQA 2DQMA 2XLLA 1WSST 4WHYH 4GRLB 3B2UC 3RHWF 1G7IA 3D52A 1NDMA 4HJSA 4JFDD 4OM1H 2WLNA 2CRIA 3LZNA 5FFLA 2UZIL 5MHSD 2QPEB 5FCUL 4PGDB 4LPWA 3WFZA 4F58H 5BJTB 3WIFA 1HEZB 1D6VL 3LV3A 1TFHA 3LPOA 3BLKA 3V52H 3H56A 4HV8A 2DF3A 2C26A 2BSSB 4UQ3A 3QNZB 2XWBB 2UWEA 4Z7VB 3EFFA 3ABGA 1VIWA 4CW1A 3VGEA 1ZVSA 2YD8A 3HC0A 1MWAB 1SQMA 3MROA 3V0VA 4EVNB 2J12B 1RJCA 4A39A 5BPPA 2ZG3A 1MHHB 3L3DA 1IQWL 3ECBA 1T20B 4DIXA 2AKRB 3ULVE 2VR4A 4P5TB 2DWYA 3LNIA 4BH8A 2DQTL 4LLVA 3VFPA 3V0GA 4QOKB 2IDUA 3WE1A 2XVKA 2H1PH 4O2FB 2UV3A 4XTRC 1AYOA 1O7DC 1ZT4B 1F4WL 1EXGA 1FPTL 4L8SB 4UNUA 5DJ6A 3GWJA 5I5JA 1ZS8B 3OZ9L 4TNFA 3HS8A 3NQIA 3RB7A 1A7QH 4Y89A 5HXMA 4YHLL 3QQ3B 1FORL 3E1ZA 3WEXA 1HWWA 3N0PB 2XV2A 4U6YA 4K73A 4DVBA 3GHEH 3BGMA 1J0HA 2RD0A 5JHDE 4DTGH 4WFFE 4WUUD 4MJIE 4YVNA 2L7QA 1TENA 4FFZL 3NABH 4AIXA 4O5LH 1MW0A 2MCAA 3ZJAA 3H9HB 4JUTA 1MWAL 3CSPA 5FGRA 3VI3F 2DIAA 1FDLL 4XC3H 5I1CH 3C6LD 1P7QD 1HILA 4YQXL 4LU5H 2WCSA 3W2DL 3CSYA 4RAHA 3FTWA 3OMNB 3MBEA 2DQFA 4M5TA 3SCMA 2J5LC 3WO3B 5FR3A 3UC0H 2DI7A 2BP8A 2IG2L 4JG5A 5EU6D 1LEGB 3ZYJA 5D5MA 2ODIA 1RK0A 3PNWB 1WC7B 3BAIA 1I82A 3DJZA 4IBZA 2B4CH 2OCJA 1G1YA 2VCOA 3TBSB 3B9VA 2PP9A 1A7BA 3TPUA 1XGTB 2CXGA 2BSEA 3SKNB 3BQUB 2W81C 4YO0A 5ICYA 2DIJA 2H3NB 5GSVA 1WUNT 1QTPA 1JF1A 5GZOA 3CDZB 1QTSA 3GMMA 3VTTA 3KZ8A 4PY8I 2DYPD 4AIZA 4WEMB 1UJ3C 1ZE3H 1IILE 2X2UA 3LN9A 4TUJA 4FP8H 4V11A 1THCA 4JFQA 4ZW8A 4R84A 4F7EA 3NVQA 4BIKA 1UT9A 5D2LF 3RQ3A 1A47A 1HI6A 2BIQA 5FYJD 1H19A 1F4XH 5D2NE 2YAPA 4KDTC 1FL3A 4WV1A 2FVNA 1TQCB 5KZCB 2NMSA 1W16A 1HHHB 2OW7A 4YWGL 4KDWA 4M1DH 2QT6A 1BZ7B 1Q9OA 5I28A 4NLAA 1ZLVK 1GZHA 3ZZSA 3KXFA 2A9DA 5LDSA 3OJDB 1NCCL 1MN4A 4OIBA 1BAFH 1KLGA 2LT9A 4RIRB 1C16A 5TQ2H 5D71L 1HHKB 3T0WA 3GYRA 4M62L 1YN7A 3RKDC 1IC4L 3K2UL 1BMWA 4M6NL 4PR5B 3F01A 2OSLB 2P24A 1T2QH 4WK2B 3K1DA 3QFDA 4WO4D 4UIKH 4JFFB 1PFCA 5T5NG 1T6WA 1OGAE 1LO5A 4HISA 4J3OD 4Q4IA 1RZ7L 4A7GA 4NZFA 5BOJA 5L7XH 1MUJB 2F18A 4FQQB 1NL0H 1CLOH 5HDQL 3AGWA 3DI2B 3BPCB 1V7NH 5I6OA 1R9FA 5IBUB 3UGXA 4XMLH 2Q8BL 3VXSE 4QUOA 1Z9SB 3FB7B 1FL6B 1SHWA 4WW1A 5IF0B 1TCMA 1WBXA 4FNUA 4FXLA 3TV8A 2GIXA 4JM4L 3LRLA 1QNZL 3BKCH 3DHPA 1KIRA 1T83A 4MMZA 5HGBA 1C8PA 1QSFA 2EXSA 3WIHH 4LIQH 1FRGL 3QJFB 1KEML 3L5JA 1D5XA 2FIRT 3OKKA 5T33H 5CEYB 1M71B 4ODSL 4CVWA 5B3NA 4DKEH 5IFHH 1ZIBA 5AAMA 3MBEC 5E1AA 2E4TA 3N5AA 2J2ZA 1IGTA 1KNOB 1S7XA 1QFOA 1BM3H 4GSQA 4Y1AD 5CUSH 4ZAKB 5TFSH 5C0GB 5IMMA 2WNGA 1Z32X 2WUCH 3A6OA 3ISRA 4ALAC 3BVXA 1AIFB 3FO0H 3HLAB 1WTGT 4X6DB 4KJPD 4TQHA 5E99H 3QT2A 4FE9A 2VAAA 2YEQA 4A38A 3EOTL 1SYSB 3AU1B 1SFHA 3MGAA 4QLWA 4JGJA 3EBHA 4AYSA 1QLRB 3AABA 3GSUB 4RVBA 2IANA 2JJVA 3LKQA 1MJ8H 4PGBA 4YK4B 2YPVA 4OQTL 1B90A 2HP4A 3M1CA 2LU3A 3LSOB 5GZOC 3VRIA 1AR1C 4NNPL 4MRBA 2AAAA 5DI8A 1W8NA 1OVZA