1KHCA

Crystal structure of the pwwp domain of mammalian dna methyltransferase dnmt3b
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
135
Chain Sequence
b'EYQDDKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMPGMRWVQWFGDGKFSEISADKLVALGLFSQHFNLATFNKLVSYRKAMYHTLEKARVRAGKTFSSSPGESLEDQLKPMLEWAHGGFKPTGIEGLKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA cytosine-5 methyltransferase 3B2
publication title The PWWP domain of mammalian DNA methyltransferase Dnmt3b defines a new family of DNA-binding folds.
pubmed rcsb
source organism Mus musculus
molecule tags Transferase
total genus 37
structure length 135
sequence length 135
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2001-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.50 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 PWWP, helical domain 1khcA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1khcA01
2R5AA 2EQUA 4N4IA 4PLLA 5KE3A 3MP6A 2L3RA 5J26A 1WJQA 3QJ6A 2RI5A 4C5HA 4E7JA 5M9OA 4Z02A 2HQEA 3OYKA 3QIIA 2CKKA 4QQDA 4A4HA 3L2WA 3L2QA 3OQ5A 2RO0A 4X34A 3E9GA 4IUVA 4BE2A 2PQWA 4BDYA 3OS1A 1XNIA 2LDMA 4ZTJA 2BUDA 2R58A 2RI3A 2JTFA 2DAQA 3O8VA 3LGLA 4ZTFA 4IKFA 2XDPA 3FDRA 2WACA 3DB4A 4EDUA 2X4XA 1WGSA 3MEUA 4L59A 3S6WA 4QVZA 3OYDA 5FROA 2K3YA 5KCHA 2E5QA 4II1A 3DLMA 4E7HA 3KUFA 2BKDN 2JZ2A 1RI0A 2M1HA 2GFUA 3NTIA 4IUPA 1WJSA 4E7IA 4PLIA 5FRMA 3EAEA 5D6YA 3SD4A 2RHUA 3CEYA 4HCZA 4E7LA 3OYAA 3H8ZA 3H6ZA 5CIUA 3MP1A 3P8DA 2RJEA 4C5IA 4QQGA 1OYXA 3BDLA 4RG2A 2M16A 4BACA 4BDZA 1WJRA 4LD6A 3OYIA 4BE1A 3MEVA 3MP8A 4IUQA 4N4GA 1G5VA 2DIGA 3LYIA 3OMCA 4QQ6A 2EFIA 3OYFA 3QBYA 2MWOA 3GOXA 3LLRA 3S3NA 3OYHA 2L8DA 3NTHA 4IURA 3OYEA 2DIQA 3C4SA 3UT1A 4FU6A 3OYJA 2F5KA 4E7KA 2FHDA 3PMIA 5D6XA 3S3MA 2GF7A 4B9XA 3OYBA 4GY5A 3OS2A 2QQRA 4A4EA 1MHNA 3OYNA 2RI2A 2XK0A 3OB9A 2EQJA 3FEOA 2LCCA 5D6WA 4A4FA 3F70A 3L42A 2LTOA 2X4WA 4B9WA 5KH6A 3QKJA 3PMTA 4C5GA 5IAYA 2K3XA 2R57A 3MEAA 3OY9A 3UWNA 2RJCA 3P8HA 3PNWC 2GFAA 3M9QA 4C5EA 2RHIA 4UC4A 4IUUA 4N4HA 2RJFA 3ZEHA 2G3RA 3MO8A 3META 3MEWA 1OI1A 4IUTA 5C6SA 2LVMA 3E9FA 2VYTA 3DB3A 3PFSA 5IN1A 3OYMA 2IG0A 2E6NA 2RHZA 2NLUA 2MWPA 4CRIA 5KCOA 3S3OA 2RJDA 4FL6A 2EQMA 3OS0A 3L2UA 1OZ2A 4QW2A 2L89A 2QQSA 1KHCA 4OVAA 2BIVA 2D9TA 2O4XB 3LX7A 3L2VA 3FC3A 1SSFA 4NS5A 2B8AA 2X35A 4BD3A 4BE0A 1N27A 3OMGA 3L2RA 5C0MA 2M0OA 4A4GA 2R5MA 3Q1JA 5J39A 5FRNA 5KE2A 2EQKA 3FLGA 2EKOA 1H3ZA 3LH0A 1OZ3A 3ME9A 3OYGA 2X4YA 2RHYA 3ASKA 3NTKA 2HQXA 4Q5WA 3LGFA 2P0KA 4PL6A 3OYLA 2YRVA 2LRQA 2RHXA 3OYCA 3OA6A 2O4XA
chains in the Genus database with same CATH superfamily
4PJOB 5KE3A 1WQ7A 1X75C 3GNFB 2EJ9A 3AT1B 1K8AC 2P84A 2E6ZA 2V1RA 2KT1A 2DL7A 3CCLA 3M59A 2WSCE 2R58A 1UHCA 3C94A 3CCRT 2FRWA 1WHHA 1YFNA 3OSSC 4AFUC 3JB9G 2X4XA 2GNCA 2RK1A 1YJWA 1D3BA 3HL8A 5FROA 5GAMh 1QKWA 4HVVA 5KCHA 3QYHB 1PD1A 2QDYB 5GAOm 3CMET 2JZ2A 4M75C 4E7IA 1QVFA 4M7DD 4FSSA 5D6YA 4C8QA 2OTLT 3P8DA 1WZOA 5FU6C 5I2MA 1Q81R 1QP3A 1SF9A 1W1FA 2JVVA 2CSQA 3PGGA 1BK2A 3EHQA 4JJNK 2L8DA 2JVWA 1MMDA 3HKSA 2ZCFB 2VXEA 2OJ2A 1BI1A 1M1GA 5HY6A 1SPKA 2LQKA 1BYMA 1X43A 2QI2A 1G3SA 4ME7A 1MHNA 2HEQA 2J6OA 2VWFA 3TVTA 2A36A 2YHTA 3URGA 4M7DF 4LD9K 1YBYA 2QGGA 3L0OA 2RJCA 4C0FA 2ESWA 3CXCS 4HVUA 1RAIB 3UA6A 2QASA 4C92C 1VQOT 3M0TA 1R77A 4M75D 4Z89A 1WXBA 4QW2A 2RB6A 5IHIA 2VGMA 4QT7A 2QA4Q 3OMGA 5CK9A 4XQ3A 1OU8A 5GAOp 3Q1JA 4CC2A 5GMKi 1AWOA 2QEXQ 5GANh 1GCQC 1MNDA 1BBZA 4Q5WA 1VQ7T 1D1AA 2BZXA 1UJYA 2ECZA 2DVJA 1RLPC 2QDLA 3NFCA 3I56T 4M75F 1EN7A 1S1NA 1FMKA 2HQEA 3UA7A 1GCPA 3CCLT 2JTFA 5I21A 2W10A 2WACA 2ZPEB 2DTIA 1VQKQ 4L59A 1PNJA 3EG9B 1VYTA 4C92D 3X24B 4CC3A 3R6OA 3HPWA 5GMKh 2OX7A 1UUEA 2DXCA 2GQIA 2L5QA 3JCMd 1JRIA 1MGQA 4DBHA 3I35A 1V1CA 3BDLA 4F7UF 4AT1B 3MEVA 3RIRA 2YUNA 1VQNT 5A0GA 4XTXA 3AHUA 4AG1C 2CREA 2ROLA 4C0ZA 2DXBA 4IURA 5LJ5d 1M90R 9ATCB 2LD7A 4E7KA 1GFCA 2QQBA 1WPYA 2HNIA 4C92F 1Q81C 4M7DA 3ZBDA 2DZCA 2K2MA 2DD5A 3BW1A 2HDAA 4GBQA 3H0HA 2VXFA 5IXBA 1WLPB 1YJ9T 3D7SB 3M54A 3PIPA 4OB3B 1OI1A 1X01A 2QK0A 4M78A 3HRSA 2DL4A 3E1SA 3CCQQ 2K5LA 1RAGB 4OGEA 4LDWA 3CCJQ 1VQKA 1Z9ZA 1ZBXA 4A63B 3ER0A 2E70A 5CKFA 3KFVA 3X20B 2FPDA 2D8JA 1M1FA 2LX9A 4AFSC 2DVEA 4M75A 3RNJA 2ODCI 4PLLA 3HSBA 1GBQA 1QQJA 1M2VA 4E7JA 4K11A 3M55A 4BE2A 2CP5A 1SSHA 2KQWA 1LJOA 4ZTFA 3VS1A 1QKXA 4RG8A 2G6FX 3VV0A 3RKWA 1UFFA 4RCCA 1WGSA 3M56A 3RESA 3NHNA 1VOMA 1K73U 1NLOC 3SWNA 1RI0A 1I5OB 2COYA 4RTZA 5EG2A 5LJ3f 4F7UA 1YIJT 3EAEA 5FRMA 4HCZA 1O75A 2RJEA 2AZSA 1HJDA 1UG1A 5L8RE 4RUGA 3OW2P 4LDYA 4XTZA 2P4TA 4M78G 2COZA 1YP5A 1ZBHA 1KSWA 4C92A 2KW9A 4LUEA 2DO3A 2ENMA 2ED1A 2L3PA 5GAN7 2NUTA 2QA4T 3TQ7P 5IHNA 4A4EA 3G4SQ 3I55T 2QEXT 3BFMA 4M7AA 5KH6A 4E47A 1GCQA 4C5EA 1N8RR 1W4SA 1M90C 1G8XA 2DL8A 5A0LA 3PFSA 6AT1B 1NJIU 1D09B 2MWPA 3PT9A 1NBEB 1SKUB 1D3BB 3OS0A 4M77G 5GAMg 4J9IA 4GLMA 1T3SA 3L2VA 2JT4A 2V8IA 3FB9A 3RERA 2IPOB 3QPHA 4C8QB 1KC8R 5FU7C 4J9BA 4RTXA 4JJBA 3KXTA 1W6XA 4OB1B 4FT2A 3I5RA 1LVKA 4OF1A 3PIOA 3OYYA 3H0IA 2CT4A 4JRPA 2LRQA 2RHXA 2KROA 1B07A 1VQ4Q 4JJDA 3VS7A 1KQ2A 1F1BB 4RTYA 4Y28E 7AT1B 4RMOA 4C5HA 3REBB 1Q7YR 5I22A 1XQHA 3C95A 3OQ5A 1YI2Q 1I07A 1AWJA 2DZ9A 2KMTA 1W2BS 3EG3A 3IQLA 1C6VX 3O8VA 4E7SA 5GAOq 1QVGS 2KFVA 1M5Q1 3TREA 4DEYA 1EZZB 4EPCA 3VUBA 2HD0A 2ZPIB 4AFZC 1WXUA 1K0XA 5EC7A 4DOVA 4M7AG 2OTJQ 2DBKA 4M78E 2ZPGB 1NYFA 4XTUA 4LD6A 2MK5A 1IREB 2K5FA 1ZHIA 3OS5A 5HCKA 2W51A 1WDXA 2AHJB 2HL3A 4E7ZA 4OB0B 1A0NB 4FU6A 2M0YA 3JB9D 3CCQT 1YHQT 1OEBA 4OMLA 1JB0E 3OS2A 3OYNA 3CCJT 3CCMT 2EQJA 1Y0MA 2DJQA 5DM7R 3CCSQ 1AWXA 3G6EA 4MZMA 4MDWA 1VQ4A 1FMVA 1G83A 1VQ5A 4M77E 2LNHB 3META 3V7RA 2VYTA 4D8DA 3CXCA 2RM4A 1VIEA 2RNNA 2VGNA 1OZ2A 4JZ4A 3MKDA 2K9GA 1Q95G 3JB9F 2JS2A 1KFZA 1WHLA 2J6KA 3VYGA 1UHFA 3RMSA 1TG0A 3EGXA 2PVGB 3CC7A 8ATCB 2KRNA 2O2OA 4ELZC 1PWTA 3CPWS 2QQAA 3QXEB 1VQ8Q 4Y92A 3VU3C 2KR3A 2F2VA 2BZYA 5HK0A 3HHTB 2KE9A 1MUZA 1VQMT 1NPPA 3JCMJ 4BI4A 1K1ZA 3L1AA 4FW1A 5CCAA 1KC8C 1JQQA 3CC2A 3JCMe 4M7DB 3QIIA 4AMCA 2LJ0A 3L2QA 4JPBW 2CYZB 3RUXA 4BDYA 2XICA 4CC7A 1AVZC 2LDMA 1JU5C 1QCFA 4ANJA 4XU3A 4M7AE 1YCYA 1V66A 3G4ST 3J80E 1Q7YC 3SDZA 1WJSA 2HKQB 2JMCA 1VQPT 3OSVA 3PTAA 2KK4A 3ZL7C 4RG2A 2EKHA 1E6GA 3HP9A 1OQKA 1T3LA 4HA8A 2OAWA 1BI2A 4PK4A 3LYIA 4CC4B 1IRXA 2DK4A 3OYFA 1M4ZA 5GAN6 5KYXA 2CZ0B 5A0DA 1YITT 1KQ1A 3QJYA 3OYJA 2F5KA 3PMIA 2K57A 1K4US 3JV3A 2EWNA 4M75B 1WHMA 1M2VB 3RR6A 5FU6B 4UC4A 4FYXB 2EIFA 1E7OA 1S72T 2LVMA 1K0SA 2L3SA 1TXQA 2PNIA 1JBMA 1H8KA 1ARKA 2K2VA 1YI2T 3V8JA 2EGEA 2JXBA 4F7UB 2DD4A 5C0MA 1FMWA 2R5MA 5J39A 4XAXB 3FLGA 1H3ZA 3LH0A 1G3TA 2O31A 2ED0A 3JCMf 2QGFB 5IHKA 1LCKA 1Y7XA 2P0KA 3VS4A 2YRVA 2EYQA 1AD5A 1UGVA 1QCNA 1I1JA 2OTJT 4C92B 5GAMj 1QWEA 1A63A 2CH4W 2ZZDA 2NUTB 2LQNA 3OBWA 4P5NA 4FT4A 3E9GA 2JTEA 1BIAA 1RUWA 3V8LA 2L3QA 2MPXC 3A8OB 1VYUA 2WSFE 4KRTA 2VV5A 3M0UA 2KVUA 2DXTA 3CBMA 4KGZB 4M78C 4FM4B 2LT4A 2YUPA 2P0PA 2FZKB 1X2KA 3GP8A 3CCST 2VB6A 2J06A 4QQGA 2I2LA 2M16A 5KYUA 1N9RA 1KK7A 1NG2A 4JUVA 5FLXE 2K4YA 3G7ZA 4NOYA 2FB7A 1Y96A 4DBRA 3UT1A 1K73R 2FPFA 1SRMA 1ZBJA 1W2BP 2AZVA 2MMPA 2O9SA 1B3QA 4FYVB 1Y71A 2M51A 3NPFA 1M8VA 5D6WA 2A37A 1PKTA 4M77C 3L42A 4XTWA 5IXFA 4BITA 1K76A 4A54A 1VQ8T 2QXFA 4RKUE 1B34A 2VUBA 3JCMV 5GAMd 3VS5A 3MO8A 1H92A 1U3OA 3MEWA 1FWZA 1AOJA 2RD1A 4OMOA 4M78D 4BUGA 3HFOA 3RKXA 2KVQG 2HSEB 3SWNC 4HCKA 3G1JA 4PJNA 4KH1B 4RTTA 4F16A 2CP6A 1G3YA 2DYBA 2M0OA 2RNAA 2KT8A 1D0YA 4XU0A 1RL2A 1W70A 1NJIR 4HCCA 5CKDA 5KYWA 2J7IA 3OYCA 2DKGA 1WXTA 2JM8A 4N4IA 4OP0A 2EYWA 4M78F 3OBYA 5LJ5j 4M77D 2ZPHB 5GMKj 4LN2A 1MMGA 3BY7A 3OS1A 4M7AC 1E7LA 1SHGA 4C0DC 1DJ7B 3MPUB 4B6MA 4IKFA 1BKBA 1W2BA 4FYYB 2YLCA 4VUBA 1QVGA 2E5QA 2DPPB 1C0MA 2DE0X 3JB9H 2DF6A 4E7LA 3MP1A 3CPWP 1X2QA 2FG0A 2XU8A 1HD3A 1ZSZC 1R0CB 1UB4A 4M77F 5GANd 4N4GA 2G80A 4DBFA 3EGXB 1Q86U 4OB2B 3LLRA 1A8VA 1WYXA 4JZ3A 1YJWT 1M1KU 4XU1A 2NUPA 2EW3A 4A53A 4UZWA 3VJPA 1SEMA 4X9DA 2LCCA 5DLOA 2CZ7B 1UGPB 2J05A 4M7AD 4PFOA 2K3XA 2R57A 1NM7A 1AEYA 2RHIA 3A8GB 1K73C 5LJ3e 2E3IA 3OYMA 2IG0A 2E6NA 3S3OA 4CI0C 3CD6Q 2EQMA 2Y4XA 2K7AA 2DILA 2QQSA 1KHCA 1NEBA 3M58A 5GAOn 1WIEA 2AK5A 3BE3A 3REAB 2EQKA 1FYNA 1HYOA 1JJ2S 2EKOA 2YWWA 5CQYA 4EMKC 3OYGA 4M7AF 2RHYA 1M2OA 3LGFA 3N5BB 5J3BA 3CPWA 1RABB 4F14A 2R5AA 4LXCA 2RN8A 1UGSB 2CZ1B 4XU2A 2PZ1A 3DKMA 2B86A 2VASA 4KGXB 3WVEB 2E12A 1UE9A 3VS0A 1KJWA 1NJIC 4HCBA 2FEIA 5A2QE 5FU7B 2DETA 2XDBA 4EDUA 3H0FA 2CZ6B 2K6DA 2PTKA 3T9NA 2KEAA 3CCUA 1K9MU 2D1XA 1RAHB 5CVIA 1JEGA 2RMOA 4FCYA 1IGQA 3CEYA 2YUQA 3UDCA 1VQLA 4M77A 1OYXA 2GCXA 1ZA1B 1YJNA 3OYIA 4Y91A 1G5VA 1PD0A 1TS9A 1T0HA 3CD6A 3M0SA 2AT1B 2DL3A 3NTHA 1E7DA 2MCNA 5FWBA 3GBQA 4KBMB 1AT1B 1UEBA 1WQWA 5GAN3 3S3MA 1LOJA 2GF7A 2COWA 1UECA 1YNZA 1Q82U 3LWIA 1ZS9A 1R0BG 3WXMB 3SB2A 3PMTA 5FW9A 4C0GA 4DOWA 2GFAA 4HKEA 1NEGA 2JOYA 2IIMA 3QHSA 4JJCA 2BE7D 1ZA2B 3M0PA 4OVAA 3M5AA 2DK3A 2D9TA 2L0AA 3E2UA 1HSQA 1UGRB 1MNEA 4J5YA 2ATCB 3CCVQ 4LUDA 2RF0A 3CMAA 4DEXA 1Y02A 5KYUB 2DRMA 1N5ZA 2CGHA 1VQ6A 2E10A 1C1AA 2MIOA 2KXDA 3M0RA 4PL6A 1N6AA 4WTOB 4NL3A 1MV3A 3RKYA 2O4XA 2PU9B 1PM3A 2RI5A 3M4YA 4YTLA 2EYZA 3OYKA 2NYSA 2LMJA 1ZSZA 1M8MA 2EYXA 2W0ZA 2MF2A 2XI9A 1VQKT 3GPLA 2KRSA 4IIMA 3X28B 5CR2A 3OYDA 1B34B 2E65A 3G6EQ 2QTXA 1M9SA 1LPLA 2Z0WA 2GFUA 2HL5C 4J83A 2NWMA 1VQ5Q 3C0CA 4PJLA 2RQVA 2MYSA 3CXCP 2JUFA 2KYBA 2D6FA 3GF5A 3SHWA 2MOXA 2F2WA 4JS4A 2O88A 3PE0A 2EVRA 2XDDA 4NL2A 2J6FA 3S3NA 1ZX6A 5GAMe 1OX8A 3JCMP 3CC7Q 1U1SA 4LE9A 3JCMQ 3RDVA 3CCVA 5KYWB 2QQRA 2CSIA 3X26B 2WQGA 2PUOB 3FJ5A 2X4WA 5KYYA 1OV3A 1AHJB 1QCOA 3QSUA 4EMKA 1ZLMA 2FRYA 3CC2Q 1YN8A 1OOTA 1BI0A 1KIKA 3GIBA 2NLUA 4CRIA 1GBRA 5GANg 1M3AA 1PKSA 1H9FA 3LX7A 4MZPA 2GGRA 3EFRA 2K3BA 1N27A 4ZGJB 1VQ9Q 2FVUA 2E5KA 4PJOG 4ZNXA 1PC0A 2DEUA 1WA7A 5ECAA 3SFMA 5GAN8 2FL7A 1UDLA 2C0IA 3U23A 2D0NA 3MP6A 1TUCA 3QJ6A 2NUPB 3R6NA 1IGUA 4KH0B 2V8JA 1N8RC 2ROTA 1RAFB 3FIFA 2ZPFB 5LJ3h 2HBPA 3MEUA 3CCRQ 5D7UA 1BU1A 1GFDA 2YRDA 4RTWA 3CCEA 2M1HA 1JJ2P 2V26A 3WVDB 1TTHB 3CMEQ 2MI6A 1QMCA 1RLQC 5GAMf 3I9QA 3VKIA 4BE1A 3CBOA 4F17A 2A28A 2L2PA 1HK9A 3GOXA 4JDSA 2HAXA 1VQ9A 4ZGEB 5LJ5e 1X69A 3CCVT 1I4K1 2P4RA 4M78B 2XK0A 3OB9A 2DNUA 2ZAEA 2KRMA 4C5GA 2A3LA 3UWNA 1Q86R 5GAN5 3M9QA 2RQTA 2KSSA 4J9CA 2YSQA 2RPNA 5C6SA 3CBPA 3BDUA 3DB3A 1M1KR 2F69A 4ZN1A 2RHZA 4BI3A 4O6JA 2QQ9A 4OGCA 5DY9A 1VQOQ 1JXMA 3O5ZA 4J9EA 4L5GA 1I5LA 2VC8A 4PJOE 1RAAB 4X1VA 3HRUA 5FRNA 3CCRA 4OMMA 4M77B 5IH2A 4QKUA 1Z9QA 2X4YA 1D1BA 2QG9B 3G6ET 4PFZA 1JJ2A 4KT0E 1VQ4T 3OYLA 3CMEA 2ODGC 4J6WA 1VQ5T 4LDVA 2H3JA 1WI7A 2HKNA 4GLKA 3JRZA 4J9FA 2KNBB 2OTLA 2DL5A 2LC4A 1H641 4RTVA 4RCBA 3JCMc 1NYGA 4KULA 4R55A 1AZGB 4BY6C 3SWNB 2M02A 1B7TA 3THKA 1EFNA 2PQWA 4PJMA 1XNIA 5CKHA 2HJQA 1Y57A 3CC7T 4OMFB 1CKBA 1EX4A 3QYGB 2LX7A 1YWPA 4RTUA 3ULRB 3NTIA 3QZ9B 2F1LA 1KQSS 3H41A 3OYAA 1UJ0A 4BACA 5LJ5f 3CC2T 2CH4A 3M0QA 1V29B 3OMCA 2LQWA 4M7AB 3QBYA 4C0DB 3DLLA 1VQOA 3OYHA 1BIBA 2GTJA 1TUDA 1K9MR 2PUKB 2M9UA 1D0XA 5IT9E 1H9EA 3V7CA 1KG1A 2FZGB 1N9SA 1KD1U 4X9CA 4N0AA 4WCIA 3UPUA 1XOVA 2Y4YA 2AIRB 2FO0A 2O01E 1J3TA 4HXJA 1PCXA 3QKJA 2HZYA 1YJ9Q 1ZSZB 1VQ7A 4IUUA 3G71Q 2FYKA 2KAFA 4ZN3A 2QNFA 2G3RA 2DM1A 4IUTA 5GAOl 4D6WA 1JEIA 1TSFA 3OW2S 2DEQA 3CPFA 1Q82R 3I56A 2D8HA 1X6GA 3V8KA 3FC3A 1SSFA 1QVGP 1OU9A 2FZCB 4BE0A 1Q86C 2DMOA 3LWHA 2JJ9A 5CKBA 4ESRA 1M1KC 1FXXA 1X6BA 2E4HA 3TSWA 5CKEA 2EPDA 1Y07A 3QDFA 5GMKl 5GANj 2YDLA 2LP5A 3V7SA 2EQUA 3HFNA 1GJJA 2X9HA 5L23A 4AG2C 3EFOA 1M30A 4X34A 2RO0A 8AT1B 4IUVA 1VQNA 2HCKA 3GNGA 1T0JA 1BB9A 1U06A 4FW2A 2DAQA 1IHVA 3LGLA 2LQ8A 1ABOA 2ZGWA 5KYYB 3CC4Q 4DA4A 3A8MB 4EMKB 1TU0B 3S6WA 4MZTA 4QVZA 2K3YA 2LJ3A 2XMFA 2C0OA 2K5IA 2V1QA 2E3HA 4IUPA 5GMKm 4PLIA 4JLGA 3H8ZA 1YJ9A 1YIJQ 5CAIA 3G71A 3QZ5B 3MJXA 1EIFA 3MP8A 1GKUB 4AFQC 2DIGA 3TU4K 3KBGA 4D8KA 3QO3A 1R8OB 2XIDA 4ZGDB 3A98A 4HT8A 2GBQA 4HT9A 3JCMX 1QVPA 3HRTA 3I55Q 3VYHB 4J9GA 1QW1A 1SG5A 3QDRB 3NGPA 1K8AU 1K9MC 3ZEHA 1JO8A 5IN1A 4PJOC 2E41A 1E6HA 1H3HA 4L6V5 3UATA 4C8QG 4FL6A 5LJ3g 2XKOC 2LC3A 5HKCA 4JRQA 1LNXA 5HK3A 4NS5A 4BD3A 3JCMh 3CC4A 3CCUQ 4JS5A 2EGAA 1OX9A 4J8OA 3EH1A 3EG0A 3JAME 1YNSA 1VQLQ 2RA2A 1Q82C 1RACB 4J6XA 1CKAA 1YJNQ 1UGQB 1YIJA 5LJ5h 1VUBA 4PFPA 4HVWA 1TH7A 2DFUA 5AYFA 4QQDA 2YRCA 3A5ZB 3L2ZA 1GRIA 2A08A 1IXDA 4J6YA 2BUDA 4MMKA 1RI9A 4KUDK 4QVDA 1HXDA 4PJOD 2QA4A 1O9SA 1X27A 4II1A 5DLQE 4DBQA 2KBTA 5KYXB 3MHXA 4E7HA 3I55A 2JN0A 2JS0A 2QEXA 4O5VA 4ATOA 2JNGA 2JW4A 1NPRA 2EJFA 3INZA 2FPEA 1WJRA 3G71T 4IIOA 2EJGA 2VKNA 2DRKA 2Y90A 4QQ6A 2EFIA 2MWOA 1G3WA 3CMAQ 2DIQA 3C4SA 1AWWA 3EGDA 2FHDA 5D6XA 1VQ6Q 2CS7A 4PJOF 3OYBA 5GAN4 1YHQQ 2LCLA 1VIFA 3CCMQ 1YCSB 1ZUYA 4MMLA 2GQVA 3MEAA 2BE9B 2WSEE 2RQWA 4C8QE 2BTTA 1KQSP 2LT1A 2JTMA 2LJ1A 3E9FA 2BIVA 1PG5B 4OMQA 2OAUA 2BZ8A 1PRMC 2RNOA 4Z88A 3CC4T 1ZUKA 5KE2A 3FRNA 5GAOr 1OZ3A 4R0KA 4M7DG 2PVDB 1PSFA 3JCMb 2DA9A 2YLBA 3ZFJA 2HMAA 2CP2A 2F5TX 4E2FB 1VQMQ 1P92A 3J81E 2CKKA 2EGCA 2K79A 4JLIA 1Q81U 1H1JS 1X6OA 1YWOA 1GL5A 1BCOA 3CCQA 1YHQA 1QVFS 3QG1A 3A8HB 2H8HA 1Y96B 3CCJA 1ZUUA 3CCMA 3I5SA 2XD0A 1WHJA 2GTOA 2H3EB 2MPHA 1M3CA 1VQPQ 1WX6A 3EG1A 1KQSA 2CUBA 1A62A 2HQHA 3PVQA 3J7AF 2X51A 1UTIA 1IO6A 5I11A 2QAZA 4M75G 4FYWB 4PJOA 2KVEA 1YITQ 3CQTA 3QWXX 1BCMA 1U5SA 3CCUT 3FEOA 2E1HA 4A4FA 5KYNA 3EFOB 2A7YA 4FIBA 1VQLT 3OY9A 2XHCA 2F2XA 1YJNT 1M3BA 2X3WD 4M4ZA 4N4HA 1JXOA 1VQMA 3CD6T 4F7UG 1S72Q 3L2UA 3EG2A 1KD1R 2KYMA 3OW2A 2L89A 4EMGA 3E19A 2ZPBB 3CCEQ 1SHFA 4A4GA 2CP0A 2DERA 5I2SA 4M7DE 4C92G 4EMHA 2DX1A 3ASKA 4TVRA 2AKLA 3LW5E 4BI8B 2YUOA 3G4SA 5LL6S 3HTRA 1QLYA 2LNVA 2YT6A 2X4JA 2C0TA 3OA6A 5FWCA 5GJVB 1VQPA 5LJ3j 1ACMB 2L3RA 2DLPA 2XG8D 2RH2A 4Z02A 4A4HA 4ELYC 1ZSGA 4N0AC 3LH5A 4J7IA 4ORZA 3CMAT 1OPLA 2RI3A 2CP7A 1YITA 1PSEA 2XDPA 3DB4A 1SRLA 2JMAA 1VQ6T 4XK8E 2EAYA 3NMZC 1VYVA 4A4KA 1M90U 3KUFA 2BKDN 2X3XD 2IVWA 1PRLC 2RHUA 2DBMA 1WHKA 4JRIA 3H6ZA 2LCSA 2CDTA 1TUGB 4C5IA 2KXCA 4V2SA 1IHWA 4M75E 2KI7A 4BY6B 2JM9A 1K9AA 4XTVA 2HBWA 3JCMg 3MCAB 1S72A 2DXUA 5GANe 1TWBA 4PJJA 4JRKA 2D0QB 3OYEA 4Z8AA 1QP2A 1OULA 2PVOB 3TEEA 3TSZA 1YI2A 2OI3A 2KY9A 2DYIA 3JCMW 2RI2A 3JSCA 5LJ5g 3TCJA 4C8QC 3QUIA 2QYZA 2SRCA 3F70A 3X25B 2LTOA 5GJWB 4B9WA 1NLPC 2DJZA 2OTLQ 1M27C 5IAYA 1PHTA 3VUZA 4F7UE 3EG9A 3P8HA 5LJ3d 5GAN2 1RADB 1MMAA 1KHIA 4MDXA 1VA7A 3VS6A 2P0QA 2EYYA 2OTJA 5KCOA 2SEMA 1U1TA 4J9DA 1BI3A 5GMKe 4DQ2A 2ABLA 4C92E 4PNOA 4E6RA 1D1CA 3RMQA 4OMPA 1FX7A 1K8AR 2CP3A 3NTKA 2HQXA 4J9HA 2NUZA 3VRYA 3VS2A 3FJPA 1KD1C 2VVKA 2HSPA 3CCSA 3A8LB 5J26A 1WJQA 1JEQA 2O9VA 3EGDB 4C8QD 5M9OA 4R56A 2DTHA 3L2WA 2I0NA 2C06A 1MV0B 4EIKA 4ZTJA 4LDUA 3GLXA 1QWFA 2KVDA 2V8KA 4F04B 2E64A 3FDRA 3QWYA 2RQUA 1AZEA 3RBBB 3M57A 3EFSA 1GXIE 3DLMA 4QVCA 1VQ7Q 1IZ6A 1XTDA 5GANf 1CSKA 3H9NA 3M53A 3EHRA 1D0ZA 1MMNA 3SD4A 5CIUA 1GL9B 1WFWA 2RK2A 2AKKA 3C12A 1I0CA 3I56Q 1I81A 4BDZA 1VQ8A 4C8QF 1G2BA 4LNPA 4IUQA 4KUIA 5CQXA 1NZ9A 1OPKA 2RQRA 1ABQA 3EGUA 2LZ6B 3CCLQ 1N8RU 1IB8A 2CT3A 3M4GA 2DTOA 3EH2A 4BB7A 1JJRA 1NE8A 4WF2A 4B9XA 1I8FA 4GY5A 3PVLA 1YJWQ 3CCET 2A8VA 3UF4A 3P8BB 3JB9I 4J7FA 3SEMA 1QVFP 3JB9J 4LDXA 1KC8U 4PKCC 1RAEB 3PNWC 2RJFA 2KDSA 2QNCA 2EBPA 1VQNQ 4KGVB 3A1PA 2MAMA 2RJDA 1XJWB 4FSXA 3VRZA 4XTYA 5AT1B 1V76A 4M7DC 2KGTA 1VQ9T 2O4XB 2B8AA 2X35A 1Q7YU 3VS3A 3L2RA 1WNLA 1WHGA 2EQIA 2YXYA 3ME9A 1ZQ1A 1U8RA 2CUDA 2QTVA 2A0FB 5CO7A 4OMNA 1TOVA
chains in the Genus database with same CATH topology
1VQMT 1VUBA 4PJOB 5KE3A 1WQ7A 1X75C 1NPPA 3JCMJ 4BI4A 3L1AA 5CCAA 2RI5A 3M4YA 1KC8C 3GNFB 1TH7A 2EJ9A 3JCMe 4YTLA 5AYFA 1K8AC 3CC2A 2E6ZA 3OYKA 3QIIA 4QQDA 4M7DB 3A5ZB 3L2ZA 3L2QA 2CYZB 3CCLA 3RUXA 4BDYA 2MF2A 2XICA 3M59A 2WSCE 2LDMA 4J6YA 2BUDA 2R58A 2XI9A 4MMKA 1VQKT 3GPLA 3C94A 3CCRT 3JB9G 4KUDK 3OSSC 4QVDA 3X28B 2X4XA 1HXDA 2RK1A 5CR2A 1D3BA 1YJWA 3HL8A 3OYDA 4XU3A 5FROA 5GAMh 4M7AE 1YCYA 1B34B 4PJOD 2QA4A 2E65A 5KCHA 1O9SA 3QYHB 3G4ST 2QTXA 3J80E 1M9SA 4II1A 2QDYB 5DLQE 5GAOm 3MHXA 3SDZA 3CMET 2JZ2A 4M75C 3I55A 4E7HA 2GFUA 2JN0A 4J83A 1WJSA 2QEXA 4E7IA 1QVFA 4M7DD 1VQPT 3OSVA 5D6YA 4C8QA 2OTLT 3PTAA 3P8DA 2JUFA 4O5VA 2KK4A 5FU6C 5I2MA 4ATOA 1QP3A 2D6FA 4RG2A 2JNGA 3GF5A 1NPRA 2EJFA 3HP9A 3INZA 4HA8A 1WJRA 3G71T 4JS4A 1BI2A 2JVVA 2EJGA 3LYIA 2XDDA 2Y90A 3PGGA 4NL2A 2EFIA 4QQ6A 3OYFA 1M4ZA 2MWOA 4JJNK 5GAN6 3S3NA 1G3WA 2L8DA 2CZ0B 5A0DA 1YITT 3HKSA 5GAMe 1KQ1A 2ZCFB 2DIQA 3QJYA 3C4SA 2VXEA 1U1SA 3JCMP 3JCMQ 1BI1A 3OYJA 2F5KA 2FHDA 3PMIA 3CCVA 5D6XA 1M1GA 2CS7A 5HY6A 4PJOF 2K57A 2LQKA 3OYBA 1BYMA 2QI2A 1G3SA 2QQRA 4ME7A 5GAN4 1MHNA 2EWNA 4M75B 2LCLA 2YHTA 3URGA 3X26B 4M7DF 4LD9K 2PUOB 1VIFA 1YBYA 2X4WA 1AHJB 5FU6B 4MMLA 2GQVA 3MEAA 3QSUA 2RJCA 4EMKA 4C0FA 2WSEE 4C8QE 4UC4A 3CXCS 2EIFA 2LT1A 2JTMA 1S72T 2LVMA 1BI0A 3E9FA 4C92C 1VQOT 3GIBA 2NLUA 4CRIA 5GANg 4M75D 1JBMA 4QW2A 2K2VA 2RB6A 2BIVA 1YI2T 2OAUA 3LX7A 4MZPA 3V8JA 3EFRA 2VGMA 1N27A 3OMGA 4F7UB 4ZGJB 5CK9A 2DD4A 4XQ3A 5C0MA 5GAOp 2R5MA 3Q1JA 5J39A 5GMKi 3CC4T 4XAXB 5KE2A 3FLGA 3FRNA 1H3ZA 2FVUA 5GAOr 3LH0A 1OZ3A 4PJOG 1G3TA 5GANh 3JCMf 4Q5WA 1Y7XA 2P0KA 2YRVA 1VQ7T 2EYQA 3SFMA 5GAN8 4M7DG 2PVDB 1PSFA 2FL7A 3JCMb 2YLBA 3ZFJA 2OTJT 4C92B 3MP6A 3NFCA 5GAMj 2F5TX 3QJ6A 3I56T 1P92A 4M75F 2ZZDA 3J81E 2HQEA 2CKKA 2V8JA 3OBWA 4P5NA 4FT4A 3E9GA 4JLIA 1Q81U 1N8RC 1BIAA 1X6OA 3CCLT 3FIFA 3V8LA 2ZPFB 2JTFA 5I21A 3A8OB 2WACA 2ZPEB 2WSFE 5LJ3h 2HBPA 2DTIA 3CCQA 2VV5A 3MEUA 4L59A 1YHQA 1QVFS 2DXTA 3QG1A 3CBMA 4C92D 3A8HB 3X24B 3CCEA 4M78C 1Y96B 3R6OA 3HPWA 4FM4B 3CCJA 3CCMA 2M1HA 2LT4A 5GMKh 2XD0A 2P0PA 3WVDB 2DXCA 2L5QA 2MI6A 3JCMd 3GP8A 1JRIA 1MGQA 5GAMf 3CCST 4QQGA 3BDLA 2I2LA 2M16A 4F7UF 1N9RA 1KQSA 3VKIA 4BE1A 3MEVA 3RIRA 3J7AF 3CBOA 1VQNT 1HK9A 4JUVA 5FLXE 5A0GA 4XTXA 3AHUA 2K4YA 3G7ZA 4NOYA 3GOXA 2FB7A 1Y96A 4M75G 4C0ZA 2DXBA 5A2QE 4PJOA 4IURA 5LJ5d 4JDSA 3UT1A 4E7KA 2QQBA 2HAXA 1WPYA 2HNIA 2MMPA 4ZGEB 5LJ5e 1VQ9A 4C92F 1Q81C 3CCVT 1I4K1 1Y71A 3ZBDA 4M7DA 2DZCA 4M78B 3CCUT 2DD5A 3BW1A 2XK0A 3OB9A 3FEOA 1M8VA 2E1HA 5D6WA 2VXFA 4A4FA 4M77C 3L42A 4XTWA 2A7YA 4FIBA 1YJ9T 1VQLT 4C5GA 2A3LA 3M54A 3OY9A 2XHCA 3UWNA 4A54A 1VQ8T 2QXFA 3M9QA 5GAN5 1YJNT 4RKUE 1B34A 2KSSA 4N4HA 2VUBA 3JCMV 3PIPA 5GAMd 3MO8A 4OB3B 3MEWA 1OI1A 1FWZA 5C6SA 3CBPA 3BDUA 3DB3A 1VQMA 2F69A 4ZN1A 1X01A 4M78A 4F7UG 3CD6T 2RHZA 4BI3A 2RD1A 4M78D 3HRSA 2QQ9A 4O6JA 4OGCA 4BUGA 3HFOA 3L2UA 5DY9A 3RKXA 2KVQG 3OW2A 2L89A 3E1SA 3SWNC 4L5GA 4EMGA 1I5LA 3E19A 2K5LA 2VC8A 4PJOE 4OGEA 2ZPBB 4LDWA 1G3YA 3HRUA 2M0OA 4A4GA 1VQKA 5FRNA 1ZBXA 3CCRA 4M77B 5I2SA 4M7DE 3ER0A 1RL2A 4XU0A 4C92G 4EMHA 2E70A 2X4YA 5CKFA 3ASKA 4TVRA 3X20B 3LW5E 4BI8B 3G6ET 3G4SA 4HCCA 1JJ2A 4KT0E 5LL6S 1VQ4T 3OYLA 5CKDA 3CMEA 2LNVA 4J6WA 2X4JA 1M1FA 2LX9A 1VQ5T 4LDVA 2H3JA 2DVEA 3OYCA 3OA6A 2DKGA 4GLKA 1VQPA 4M75A 5LJ3j 3JRZA 4N4IA 4OP0A 4PLLA 2OTLA 2LC4A 2L3RA 3HSBA 2XG8D 2RH2A 4M78F 1H641 4E7JA 3OBYA 4RCBA 3JCMc 4KULA 3M55A 4Z02A 4BY6C 5LJ5j 3SWNB 4M77D 4R55A 2ZPHB 4A4HA 5GMKj 4ELYC 4N0AC 4BE2A 4J7IA 2PQWA 3BY7A 3OS1A 2KQWA 4M7AC 1XNIA 5CKHA 1LJOA 3CMAT 4C0DC 2RI3A 4ZTFA 1DJ7B 1YITA 1PSEA 4IKFA 1BKBA 2XDPA 4OMFB 3DB4A 4RG8A 1W2BA 3CC7T 3VV0A 3RKWA 4RCCA 1WGSA 1VQ6T 2YLCA 3M56A 4VUBA 4XK8E 3QYGB 3RESA 1QVGA 2EAYA 2E5QA 4A4KA 2DPPB 1M90U 3KUFA 2BKDN 1K73U 3SWNA 1RI0A 3NTIA 2IVWA 3QZ9B 5EG2A 5LJ3f 4F7UA 1YIJT 3EAEA 1KQSS 5FRMA 3JB9H 2RHUA 4HCZA 4JRIA 4E7LA 3OYAA 1O75A 3H6ZA 3MP1A 2RJEA 4C5IA 4V2SA 2XU8A 5L8RE 1Q7YC 4BACA 5LJ5f 4M75E 3CC2T 4BY6B 1UB4A 4LDYA 4M77F 4N4GA 5GANd 4XTVA 4XTZA 3JCMg 1V29B 2P4TA 3OMCA 3MCAB 1S72A 2DXUA 4M7AB 5GANe 3QBYA 4OB2B 4M78G 1Q86U 3LLRA 4C0DB 3DLLA 1VQOA 4JRKA 2D0QB 3OYHA 1BIBA 4C92A 3OYEA 2PUKB 2M9UA 2DO3A 1YJWT 1M1KU 1QP2A 5IT9E 2PVOB 3TEEA 1YI2A 4XU1A 4A53A 5GAN7 2QA4T 3VJPA 2KY9A 3V7CA 4A4EA 3JCMW 1KG1A 1N9SA 5HK0A 1KD1U 3I55T 2RI2A 3JSCA 5LJ5g 4X9DA 3TCJA 4C8QC 2QEXT 2LCCA 4N0AA 4X9CA 3UPUA 1XOVA 3QUIA 3F70A 2Y4YA 3BFMA 5DLOA 3X25B 2LTOA 2CZ7B 4M7AA 2O01E 4B9WA 5KH6A 2DJZA 3QKJA 1UGPB 4M7AD 4E47A 5IAYA 2K3XA 2R57A 3VUZA 4F7UE 3P8HA 4C5EA 5LJ3d 2RHIA 1W4SA 1M90C 3A8GB 4IUUA 5GAN2 1K73C 1VQ7A 1KHIA 2FYKA 2KAFA 4ZN3A 4MDXA 2G3RA 5LJ3e 5GAOl 4IUTA 2P0QA 4D6WA 5A0LA 3PFSA 3OYMA 1NJIU 2OTJA 2IG0A 3OW2S 2E6NA 2DEQA 2MWPA 3CPFA 5KCOA 3S3OA 3PT9A 1U1TA 4CI0C 3I56A 1D3BB 2EQMA 3OS0A 2Y4XA 4M77G 1BI3A 5GMKe 5GAMg 2QQSA 1KHCA 3V8KA 3L2VA 4DQ2A 2V8IA 3FB9A 1SSFA 3FC3A 3RERA 4C92E 4PNOA 4BE0A 3M58A 5GAOn 1Q86C 3RMQA 3QPHA 4C8QB 5FU7C 2EQKA 1FX7A 3LWHA 1JJ2S 5CKBA 2EKOA 5CQYA 3KXTA 4EMKC 1FXXA 4OB1B 4FT2A 1M1KC 3OYGA 4M7AF 2RHYA 3NTKA 4OF1A 2HQXA 3LGFA 5CKEA 3PIOA 1Y07A 3FJPA 3N5BB 1KD1C 3OYYA 4JRPA 2LRQA 2RHXA 5GMKl 5J3BA 5GANj 3CPWA 3V7SA 2R5AA 2EQUA 3HFNA 3CCSA 3A8LB 1UGSB 2CZ1B 1WJQA 5J26A 1KQ2A 4RMOA 4Y28E 4XU2A 4C5HA 4C8QD 1XQHA 5M9OA 4R56A 3DKMA 2DTHA 3C95A 3L2WA 3OQ5A 2RO0A 2E12A 4X34A 3WVEB 1VQNA 2DZ9A 2KMTA 4IUVA 1W2BS 2C06A 1NJIC 4HCBA 3GNGA 4ZTJA 2V8KA 3GLXA 3O8VA 4LDUA 2DAQA 5GAOq 3LGLA 2E64A 2LQ8A 2ZGWA 3FDRA 5FU7B 1QVGS 2XDBA 1M5Q1 4EDUA 4DA4A 3A8MB 4EMKB 3S6WA 4MZTA 3TREA 2CZ6B 4QVZA 4EPCA 3M57A 2K3YA 3EFSA 2K5IA 3T9NA 3VUBA 1GXIE 3CCUA 2HD0A 3DLMA 4QVCA 1K9MU 1IZ6A 1XTDA 2ZPIB 4IUPA 3M53A 5GMKm 5GANf 5CVIA 4PLIA 4JLGA 3SD4A 4DOVA 3CEYA 4M7AG 3H8ZA 3UDCA 5CIUA 1YJ9A 1VQLA 2RK2A 3C12A 4M77A 1OYXA 5CAIA 2GCXA 3G71A 4M78E 1I81A 4BDZA 1VQ8A 3QZ5B 2ZPGB 4C8QF 1YJNA 1EIFA 4XTUA 4LD6A 3OYIA 3MP8A 4IUQA 4KUIA 5CQXA 4Y91A 2DIGA 3TU4K 1G5VA 1IREB 1NZ9A 2K5FA 1ZHIA 3OS5A 3CD6A 3KBGA 1N8RU 3QO3A 2AHJB 3NTHA 1R8OB 2XIDA 4OB0B 4FU6A 4ZGDB 4KBMB 3JB9D 3CCQT 3M4GA 2DTOA 4BB7A 1NE8A 1UEBA 1WQWA 5GAN3 3S3MA 1LOJA 2GF7A 4WF2A 4B9XA 1I8FA 4GY5A 1YHQT 1Q82U 1JB0E 3OS2A 3CCET 3OYNA 3LWIA 3CCJT 4HT8A 3P8BB 3CCMT 4HT9A 2EQJA 3JB9I 3JCMX 4J7FA 1QVPA 3HRTA 3VYHB 3WXMB 3JB9J 3SB2A 1QW1A 3PMTA 5DM7R 4LDXA 3QDRB 4C0GA 1KC8U 4PKCC 3G6EA 4DOWA 3PNWC 2GFAA 4MZMA 4MDWA 1VQ4A 1K8AU 1K9MC 4HKEA 2RJFA 2KDSA 3ZEHA 1VQ5A 4M77E 2JOYA 3META 3V7RA 3QHSA 2VYTA 5IN1A 4PJOC 2E41A 3CXCA 4L6V5 2RM4A 1VIEA 2MAMA 2RJDA 4FSXA 4FL6A 4C8QG 2XKOC 2VGNA 5LJ3g 1OZ2A 4XTYA 3JB9F 5HKCA 4JRQA 4M7DC 1LNXA 4OVAA 3M5AA 1VQ9T 2DK3A 2D9TA 2O4XB 5HK3A 1UGRB 4NS5A 2B8AA 2X35A 4J5YA 4BD3A 3JCMh 3CC4A 1Q7YU 3VYGA 3L2RA 3CMAA 1WNLA 4JS5A 3RMSA 4J8OA 2PVGB 3CC7A 3JAME 3ME9A 2CGHA 1VQ6A 4ELZC 2E10A 1ZQ1A 1U8RA 2RA2A 3CPWS 1Q82C 2QQAA 3QXEB 4J6XA 4PL6A 1N6AA 1UGQB 4NL3A 3RKYA 3VU3C 5CO7A 2O4XA 1YIJA 2PU9B 3HHTB 5LJ5h
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5A A;  2EQU A;  4N4I A;  4PLL A;  5KE3 A;  3MP6 A;  2L3R A;  5J26 A;  1WJQ A;  3QJ6 A;  2RI5 A;  4C5H A;  4E7J A;  5M9O A;  4Z02 A;  2HQE A;  3OYK A;  3QII A;  2CKK A;  4QQD A;  4A4H A;  3L2W A;  3L2Q A;  3OQ5 A;  2RO0 A;  4X34 A;  3E9G A;  4IUV A;  4BE2 A;  2PQW A;  4BDY A;  3OS1 A;  1XNI A;  2LDM A;  4ZTJ A;  2BUD A;  2R58 A;  2RI3 A;  2JTF A;  2DAQ A;  3O8V A;  3LGL A;  4ZTF A;  4IKF A;  2XDP A;  3FDR A;  2WAC A;  3DB4 A;  4EDU A;  2X4X A;  1WGS A;  3MEU A;  4L59 A;  3S6W A;  4QVZ A;  3OYD A;  5FRO A;  2K3Y A;  5KCH A;  2E5Q A;  4II1 A;  3DLM A;  4E7H A;  3KUF A;  2BKD N;  2JZ2 A;  1RI0 A;  2M1H A;  2GFU A;  3NTI A;  4IUP A;  1WJS A;  4E7I A;  4PLI A;  5FRM A;  3EAE A;  5D6Y A;  3SD4 A;  2RHU A;  3CEY A;  4HCZ A;  4E7L A;  3OYA A;  3H8Z A;  3H6Z A;  5CIU A;  3MP1 A;  3P8D A;  2RJE A;  4C5I A;  4QQG A;  1OYX A;  3BDL A;  4RG2 A;  2M16 A;  4BAC A;  4BDZ A;  1WJR A;  4LD6 A;  3OYI A;  4BE1 A;  3MEV A;  3MP8 A;  4IUQ A;  4N4G A;  1G5V A;  2DIG A;  3LYI A;  3OMC A;  4QQ6 A;  2EFI A;  3OYF A;  3QBY A;  2MWO A;  3GOX A;  3LLR A;  3S3N A;  3OYH A;  2L8D A;  3NTH A;  4IUR A;  3OYE A;  2DIQ A;  3C4S A;  3UT1 A;  4FU6 A;  3OYJ A;  2F5K A;  4E7K A;  2FHD A;  3PMI A;  5D6X A;  3S3M A;  2GF7 A;  4B9X A;  3OYB A;  4GY5 A;  3OS2 A;  2QQR A;  4A4E A;  1MHN A;  3OYN A;  2RI2 A;  2XK0 A;  3OB9 A;  2EQJ A;  3FEO A;  2LCC A;  5D6W A;  4A4F A;  3F70 A;  3L42 A;  2LTO A;  2X4W A;  4B9W A;  5KH6 A;  3QKJ A;  3PMT A;  4C5G A;  5IAY A;  2K3X A;  2R57 A;  3MEA A;  3OY9 A;  3UWN A;  2RJC A;  3P8H A;  3PNW C;  2GFA A;  3M9Q A;  4C5E A;  2RHI A;  4UC4 A;  4IUU A;  4N4H A;  2RJF A;  3ZEH A;  2G3R A;  3MO8 A;  3MET A;  3MEW A;  1OI1 A;  4IUT A;  5C6S A;  2LVM A;  3E9F A;  2VYT A;  3DB3 A;  3PFS A;  5IN1 A;  3OYM A;  2IG0 A;  2E6N A;  2RHZ A;  2NLU A;  2MWP A;  4CRI A;  5KCO A;  3S3O A;  2RJD A;  4FL6 A;  2EQM A;  3OS0 A;  3L2U A;  1OZ2 A;  4QW2 A;  2L89 A;  2QQS A;  1KHC A;  4OVA A;  2BIV A;  2D9T A;  2O4X B;  3LX7 A;  3L2V A;  3FC3 A;  1SSF A;  4NS5 A;  2B8A A;  2X35 A;  4BD3 A;  4BE0 A;  1N27 A;  3OMG A;  3L2R A;  5C0M A;  2M0O A;  4A4G A;  2R5M A;  3Q1J A;  5J39 A;  5FRN A;  5KE2 A;  2EQK A;  3FLG A;  2EKO A;  1H3Z A;  3LH0 A;  1OZ3 A;  3ME9 A;  3OYG A;  2X4Y A;  2RHY A;  3ASK A;  3NTK A;  2HQX A;  4Q5W A;  3LGF A;  2P0K A;  4PL6 A;  3OYL A;  2YRV A;  2LRQ A;  2RHX A;  3OYC A;  3OA6 A;  2O4X A; 
#chains in the Genus database with same CATH topology
 4PJO B;  5KE3 A;  1WQ7 A;  1X75 C;  3GNF B;  2EJ9 A;  3AT1 B;  1K8A C;  2P84 A;  2E6Z A;  2V1R A;  2KT1 A;  2DL7 A;  3CCL A;  3M59 A;  2WSC E;  2R58 A;  1UHC A;  3C94 A;  3CCR T;  2FRW A;  1WHH A;  1YFN A;  3OSS C;  4AFU C;  3JB9 G;  2X4X A;  2GNC A;  2RK1 A;  1YJW A;  1D3B A;  3HL8 A;  5FRO A;  5GAM h;  1QKW A;  4HVV A;  5KCH A;  3QYH B;  1PD1 A;  2QDY B;  5GAO m;  3CME T;  2JZ2 A;  4M75 C;  4E7I A;  1QVF A;  4M7D D;  4FSS A;  5D6Y A;  4C8Q A;  2OTL T;  3P8D A;  1WZO A;  5FU6 C;  5I2M A;  1Q81 R;  1QP3 A;  1SF9 A;  1W1F A;  2JVV A;  2CSQ A;  3PGG A;  1BK2 A;  3EHQ A;  4JJN K;  2L8D A;  2JVW A;  1MMD A;  3HKS A;  2ZCF B;  2VXE A;  2OJ2 A;  1BI1 A;  1M1G A;  5HY6 A;  1SPK A;  2LQK A;  1BYM A;  1X43 A;  2QI2 A;  1G3S A;  4ME7 A;  1MHN A;  2HEQ A;  2J6O A;  2VWF A;  3TVT A;  2A36 A;  2YHT A;  3URG A;  4M7D F;  4LD9 K;  1YBY A;  2QGG A;  3L0O A;  2RJC A;  4C0F A;  2ESW A;  3CXC S;  4HVU A;  1RAI B;  3UA6 A;  2QAS A;  4C92 C;  1VQO T;  3M0T A;  1R77 A;  4M75 D;  4Z89 A;  1WXB A;  4QW2 A;  2RB6 A;  5IHI A;  2VGM A;  4QT7 A;  2QA4 Q;  3OMG A;  5CK9 A;  4XQ3 A;  1OU8 A;  5GAO p;  3Q1J A;  4CC2 A;  5GMK i;  1AWO A;  2QEX Q;  5GAN h;  1GCQ C;  1MND A;  1BBZ A;  4Q5W A;  1VQ7 T;  1D1A A;  2BZX A;  1UJY A;  2ECZ A;  2DVJ A;  1RLP C;  2QDL A;  3NFC A;  3I56 T;  4M75 F;  1EN7 A;  1S1N A;  1FMK A;  2HQE A;  3UA7 A;  1GCP A;  3CCL T;  2JTF A;  5I21 A;  2W10 A;  2WAC A;  2ZPE B;  2DTI A;  1VQK Q;  4L59 A;  1PNJ A;  3EG9 B;  1VYT A;  4C92 D;  3X24 B;  4CC3 A;  3R6O A;  3HPW A;  5GMK h;  2OX7 A;  1UUE A;  2DXC A;  2GQI A;  2L5Q A;  3JCM d;  1JRI A;  1MGQ A;  4DBH A;  3I35 A;  1V1C A;  3BDL A;  4F7U F;  4AT1 B;  3MEV A;  3RIR A;  2YUN A;  1VQN T;  5A0G A;  4XTX A;  3AHU A;  4AG1 C;  2CRE A;  2ROL A;  4C0Z A;  2DXB A;  4IUR A;  5LJ5 d;  1M90 R;  9ATC B;  2LD7 A;  4E7K A;  1GFC A;  2QQB A;  1WPY A;  2HNI A;  4C92 F;  1Q81 C;  4M7D A;  3ZBD A;  2DZC A;  2K2M A;  2DD5 A;  3BW1 A;  2HDA A;  4GBQ A;  3H0H A;  2VXF A;  5IXB A;  1WLP B;  1YJ9 T;  3D7S B;  3M54 A;  3PIP A;  4OB3 B;  1OI1 A;  1X01 A;  2QK0 A;  4M78 A;  3HRS A;  2DL4 A;  3E1S A;  3CCQ Q;  2K5L A;  1RAG B;  4OGE A;  4LDW A;  3CCJ Q;  1VQK A;  1Z9Z A;  1ZBX A;  4A63 B;  3ER0 A;  2E70 A;  5CKF A;  3KFV A;  3X20 B;  2FPD A;  2D8J A;  1M1F A;  2LX9 A;  4AFS C;  2DVE A;  4M75 A;  3RNJ A;  2ODC I;  4PLL A;  3HSB A;  1GBQ A;  1QQJ A;  1M2V A;  4E7J A;  4K11 A;  3M55 A;  4BE2 A;  2CP5 A;  1SSH A;  2KQW A;  1LJO A;  4ZTF A;  3VS1 A;  1QKX A;  4RG8 A;  2G6F X;  3VV0 A;  3RKW A;  1UFF A;  4RCC A;  1WGS A;  3M56 A;  3RES A;  3NHN A;  1VOM A;  1K73 U;  1NLO C;  3SWN A;  1RI0 A;  1I5O B;  2COY A;  4RTZ A;  5EG2 A;  5LJ3 f;  4F7U A;  1YIJ T;  3EAE A;  5FRM A;  4HCZ A;  1O75 A;  2RJE A;  2AZS A;  1HJD A;  1UG1 A;  5L8R E;  4RUG A;  3OW2 P;  4LDY A;  4XTZ A;  2P4T A;  4M78 G;  2COZ A;  1YP5 A;  1ZBH A;  1KSW A;  4C92 A;  2KW9 A;  4LUE A;  2DO3 A;  2ENM A;  2ED1 A;  2L3P A;  5GAN 7;  2NUT A;  2QA4 T;  3TQ7 P;  5IHN A;  4A4E A;  3G4S Q;  3I55 T;  2QEX T;  3BFM A;  4M7A A;  5KH6 A;  4E47 A;  1GCQ A;  4C5E A;  1N8R R;  1W4S A;  1M90 C;  1G8X A;  2DL8 A;  5A0L A;  3PFS A;  6AT1 B;  1NJI U;  1D09 B;  2MWP A;  3PT9 A;  1NBE B;  1SKU B;  1D3B B;  3OS0 A;  4M77 G;  5GAM g;  4J9I A;  4GLM A;  1T3S A;  3L2V A;  2JT4 A;  2V8I A;  3FB9 A;  3RER A;  2IPO B;  3QPH A;  4C8Q B;  1KC8 R;  5FU7 C;  4J9B A;  4RTX A;  4JJB A;  3KXT A;  1W6X A;  4OB1 B;  4FT2 A;  3I5R A;  1LVK A;  4OF1 A;  3PIO A;  3OYY A;  3H0I A;  2CT4 A;  4JRP A;  2LRQ A;  2RHX A;  2KRO A;  1B07 A;  1VQ4 Q;  4JJD A;  3VS7 A;  1KQ2 A;  1F1B B;  4RTY A;  4Y28 E;  7AT1 B;  4RMO A;  4C5H A;  3REB B;  1Q7Y R;  5I22 A;  1XQH A;  3C95 A;  3OQ5 A;  1YI2 Q;  1I07 A;  1AWJ A;  2DZ9 A;  2KMT A;  1W2B S;  3EG3 A;  3IQL A;  1C6V X;  3O8V A;  4E7S A;  5GAO q;  1QVG S;  2KFV A;  1M5Q 1;  3TRE A;  4DEY A;  1EZZ B;  4EPC A;  3VUB A;  2HD0 A;  2ZPI B;  4AFZ C;  1WXU A;  1K0X A;  5EC7 A;  4DOV A;  4M7A G;  2OTJ Q;  2DBK A;  4M78 E;  2ZPG B;  1NYF A;  4XTU A;  4LD6 A;  2MK5 A;  1IRE B;  2K5F A;  1ZHI A;  3OS5 A;  5HCK A;  2W51 A;  1WDX A;  2AHJ B;  2HL3 A;  4E7Z A;  4OB0 B;  1A0N B;  4FU6 A;  2M0Y A;  3JB9 D;  3CCQ T;  1YHQ T;  1OEB A;  4OML A;  1JB0 E;  3OS2 A;  3OYN A;  3CCJ T;  3CCM T;  2EQJ A;  1Y0M A;  2DJQ A;  5DM7 R;  3CCS Q;  1AWX A;  3G6E A;  4MZM A;  4MDW A;  1VQ4 A;  1FMV A;  1G83 A;  1VQ5 A;  4M77 E;  2LNH B;  3MET A;  3V7R A;  2VYT A;  4D8D A;  3CXC A;  2RM4 A;  1VIE A;  2RNN A;  2VGN A;  1OZ2 A;  4JZ4 A;  3MKD A;  2K9G A;  1Q95 G;  3JB9 F;  2JS2 A;  1KFZ A;  1WHL A;  2J6K A;  3VYG A;  1UHF A;  3RMS A;  1TG0 A;  3EGX A;  2PVG B;  3CC7 A;  8ATC B;  2KRN A;  2O2O A;  4ELZ C;  1PWT A;  3CPW S;  2QQA A;  3QXE B;  1VQ8 Q;  4Y92 A;  3VU3 C;  2KR3 A;  2F2V A;  2BZY A;  5HK0 A;  3HHT B;  2KE9 A;  1MUZ A;  1VQM T;  1NPP A;  3JCM J;  4BI4 A;  1K1Z A;  3L1A A;  4FW1 A;  5CCA A;  1KC8 C;  1JQQ A;  3CC2 A;  3JCM e;  4M7D B;  3QII A;  4AMC A;  2LJ0 A;  3L2Q A;  4JPB W;  2CYZ B;  3RUX A;  4BDY A;  2XIC A;  4CC7 A;  1AVZ C;  2LDM A;  1JU5 C;  1QCF A;  4ANJ A;  4XU3 A;  4M7A E;  1YCY A;  1V66 A;  3G4S T;  3J80 E;  1Q7Y C;  3SDZ A;  1WJS A;  2HKQ B;  2JMC A;  1VQP T;  3OSV A;  3PTA A;  2KK4 A;  3ZL7 C;  4RG2 A;  2EKH A;  1E6G A;  3HP9 A;  1OQK A;  1T3L A;  4HA8 A;  2OAW A;  1BI2 A;  4PK4 A;  3LYI A;  4CC4 B;  1IRX A;  2DK4 A;  3OYF A;  1M4Z A;  5GAN 6;  5KYX A;  2CZ0 B;  5A0D A;  1YIT T;  1KQ1 A;  3QJY A;  3OYJ A;  2F5K A;  3PMI A;  2K57 A;  1K4U S;  3JV3 A;  2EWN A;  4M75 B;  1WHM A;  1M2V B;  3RR6 A;  5FU6 B;  4UC4 A;  4FYX B;  2EIF A;  1E7O A;  1S72 T;  2LVM A;  1K0S A;  2L3S A;  1TXQ A;  2PNI A;  1JBM A;  1H8K A;  1ARK A;  2K2V A;  1YI2 T;  3V8J A;  2EGE A;  2JXB A;  4F7U B;  2DD4 A;  5C0M A;  1FMW A;  2R5M A;  5J39 A;  4XAX B;  3FLG A;  1H3Z A;  3LH0 A;  1G3T A;  2O31 A;  2ED0 A;  3JCM f;  2QGF B;  5IHK A;  1LCK A;  1Y7X A;  2P0K A;  3VS4 A;  2YRV A;  2EYQ A;  1AD5 A;  1UGV A;  1QCN A;  1I1J A;  2OTJ T;  4C92 B;  5GAM j;  1QWE A;  1A63 A;  2CH4 W;  2ZZD A;  2NUT B;  2LQN A;  3OBW A;  4P5N A;  4FT4 A;  3E9G A;  2JTE A;  1BIA A;  1RUW A;  3V8L A;  2L3Q A;  2MPX C;  3A8O B;  1VYU A;  2WSF E;  4KRT A;  2VV5 A;  3M0U A;  2KVU A;  2DXT A;  3CBM A;  4KGZ B;  4M78 C;  4FM4 B;  2LT4 A;  2YUP A;  2P0P A;  2FZK B;  1X2K A;  3GP8 A;  3CCS T;  2VB6 A;  2J06 A;  4QQG A;  2I2L A;  2M16 A;  5KYU A;  1N9R A;  1KK7 A;  1NG2 A;  4JUV A;  5FLX E;  2K4Y A;  3G7Z A;  4NOY A;  2FB7 A;  1Y96 A;  4DBR A;  3UT1 A;  1K73 R;  2FPF A;  1SRM A;  1ZBJ A;  1W2B P;  2AZV A;  2MMP A;  2O9S A;  1B3Q A;  4FYV B;  1Y71 A;  2M51 A;  3NPF A;  1M8V A;  5D6W A;  2A37 A;  1PKT A;  4M77 C;  3L42 A;  4XTW A;  5IXF A;  4BIT A;  1K76 A;  4A54 A;  1VQ8 T;  2QXF A;  4RKU E;  1B34 A;  2VUB A;  3JCM V;  5GAM d;  3VS5 A;  3MO8 A;  1H92 A;  1U3O A;  3MEW A;  1FWZ A;  1AOJ A;  2RD1 A;  4OMO A;  4M78 D;  4BUG A;  3HFO A;  3RKX A;  2KVQ G;  2HSE B;  3SWN C;  4HCK A;  3G1J A;  4PJN A;  4KH1 B;  4RTT A;  4F16 A;  2CP6 A;  1G3Y A;  2DYB A;  2M0O A;  2RNA A;  2KT8 A;  1D0Y A;  4XU0 A;  1RL2 A;  1W70 A;  1NJI R;  4HCC A;  5CKD A;  5KYW A;  2J7I A;  3OYC A;  2DKG A;  1WXT A;  2JM8 A;  4N4I A;  4OP0 A;  2EYW A;  4M78 F;  3OBY A;  5LJ5 j;  4M77 D;  2ZPH B;  5GMK j;  4LN2 A;  1MMG A;  3BY7 A;  3OS1 A;  4M7A C;  1E7L A;  1SHG A;  4C0D C;  1DJ7 B;  3MPU B;  4B6M A;  4IKF A;  1BKB A;  1W2B A;  4FYY B;  2YLC A;  4VUB A;  1QVG A;  2E5Q A;  2DPP B;  1C0M A;  2DE0 X;  3JB9 H;  2DF6 A;  4E7L A;  3MP1 A;  3CPW P;  1X2Q A;  2FG0 A;  2XU8 A;  1HD3 A;  1ZSZ C;  1R0C B;  1UB4 A;  4M77 F;  5GAN d;  4N4G A;  2G80 A;  4DBF A;  3EGX B;  1Q86 U;  4OB2 B;  3LLR A;  1A8V A;  1WYX A;  4JZ3 A;  1YJW T;  1M1K U;  4XU1 A;  2NUP A;  2EW3 A;  4A53 A;  4UZW A;  3VJP A;  1SEM A;  4X9D A;  2LCC A;  5DLO A;  2CZ7 B;  1UGP B;  2J05 A;  4M7A D;  4PFO A;  2K3X A;  2R57 A;  1NM7 A;  1AEY A;  2RHI A;  3A8G B;  1K73 C;  5LJ3 e;  2E3I A;  3OYM A;  2IG0 A;  2E6N A;  3S3O A;  4CI0 C;  3CD6 Q;  2EQM A;  2Y4X A;  2K7A A;  2DIL A;  2QQS A;  1KHC A;  1NEB A;  3M58 A;  5GAO n;  1WIE A;  2AK5 A;  3BE3 A;  3REA B;  2EQK A;  1FYN A;  1HYO A;  1JJ2 S;  2EKO A;  2YWW A;  5CQY A;  4EMK C;  3OYG A;  4M7A F;  2RHY A;  1M2O A;  3LGF A;  3N5B B;  5J3B A;  3CPW A;  1RAB B;  4F14 A;  2R5A A;  4LXC A;  2RN8 A;  1UGS B;  2CZ1 B;  4XU2 A;  2PZ1 A;  3DKM A;  2B86 A;  2VAS A;  4KGX B;  3WVE B;  2E12 A;  1UE9 A;  3VS0 A;  1KJW A;  1NJI C;  4HCB A;  2FEI A;  5A2Q E;  5FU7 B;  2DET A;  2XDB A;  4EDU A;  3H0F A;  2CZ6 B;  2K6D A;  2PTK A;  3T9N A;  2KEA A;  3CCU A;  1K9M U;  2D1X A;  1RAH B;  5CVI A;  1JEG A;  2RMO A;  4FCY A;  1IGQ A;  3CEY A;  2YUQ A;  3UDC A;  1VQL A;  4M77 A;  1OYX A;  2GCX A;  1ZA1 B;  1YJN A;  3OYI A;  4Y91 A;  1G5V A;  1PD0 A;  1TS9 A;  1T0H A;  3CD6 A;  3M0S A;  2AT1 B;  2DL3 A;  3NTH A;  1E7D A;  2MCN A;  5FWB A;  3GBQ A;  4KBM B;  1AT1 B;  1UEB A;  1WQW A;  5GAN 3;  3S3M A;  1LOJ A;  2GF7 A;  2COW A;  1UEC A;  1YNZ A;  1Q82 U;  3LWI A;  1ZS9 A;  1R0B G;  3WXM B;  3SB2 A;  3PMT A;  5FW9 A;  4C0G A;  4DOW A;  2GFA A;  4HKE A;  1NEG A;  2JOY A;  2IIM A;  3QHS A;  4JJC A;  2BE7 D;  1ZA2 B;  3M0P A;  4OVA A;  3M5A A;  2DK3 A;  2D9T A;  2L0A A;  3E2U A;  1HSQ A;  1UGR B;  1MNE A;  4J5Y A;  2ATC B;  3CCV Q;  4LUD A;  2RF0 A;  3CMA A;  4DEX A;  1Y02 A;  5KYU B;  2DRM A;  1N5Z A;  2CGH A;  1VQ6 A;  2E10 A;  1C1A A;  2MIO A;  2KXD A;  3M0R A;  4PL6 A;  1N6A A;  4WTO B;  4NL3 A;  1MV3 A;  3RKY A;  2O4X A;  2PU9 B;  1PM3 A;  2RI5 A;  3M4Y A;  4YTL A;  2EYZ A;  3OYK A;  2NYS A;  2LMJ A;  1ZSZ A;  1M8M A;  2EYX A;  2W0Z A;  2MF2 A;  2XI9 A;  1VQK T;  3GPL A;  2KRS A;  4IIM A;  3X28 B;  5CR2 A;  3OYD A;  1B34 B;  2E65 A;  3G6E Q;  2QTX A;  1M9S A;  1LPL A;  2Z0W A;  2GFU A;  2HL5 C;  4J83 A;  2NWM A;  1VQ5 Q;  3C0C A;  4PJL A;  2RQV A;  2MYS A;  3CXC P;  2JUF A;  2KYB A;  2D6F A;  3GF5 A;  3SHW A;  2MOX A;  2F2W A;  4JS4 A;  2O88 A;  3PE0 A;  2EVR A;  2XDD A;  4NL2 A;  2J6F A;  3S3N A;  1ZX6 A;  5GAM e;  1OX8 A;  3JCM P;  3CC7 Q;  1U1S A;  4LE9 A;  3JCM Q;  3RDV A;  3CCV A;  5KYW B;  2QQR A;  2CSI A;  3X26 B;  2WQG A;  2PUO B;  3FJ5 A;  2X4W A;  5KYY A;  1OV3 A;  1AHJ B;  1QCO A;  3QSU A;  4EMK A;  1ZLM A;  2FRY A;  3CC2 Q;  1YN8 A;  1OOT A;  1BI0 A;  1KIK A;  3GIB A;  2NLU A;  4CRI A;  1GBR A;  5GAN g;  1M3A A;  1PKS A;  1H9F A;  3LX7 A;  4MZP A;  2GGR A;  3EFR A;  2K3B A;  1N27 A;  4ZGJ B;  1VQ9 Q;  2FVU A;  2E5K A;  4PJO G;  4ZNX A;  1PC0 A;  2DEU A;  1WA7 A;  5ECA A;  3SFM A;  5GAN 8;  2FL7 A;  1UDL A;  2C0I A;  3U23 A;  2D0N A;  3MP6 A;  1TUC A;  3QJ6 A;  2NUP B;  3R6N A;  1IGU A;  4KH0 B;  2V8J A;  1N8R C;  2ROT A;  1RAF B;  3FIF A;  2ZPF B;  5LJ3 h;  2HBP A;  3MEU A;  3CCR Q;  5D7U A;  1BU1 A;  1GFD A;  2YRD A;  4RTW A;  3CCE A;  2M1H A;  1JJ2 P;  2V26 A;  3WVD B;  1TTH B;  3CME Q;  2MI6 A;  1QMC A;  1RLQ C;  5GAM f;  3I9Q A;  3VKI A;  4BE1 A;  3CBO A;  4F17 A;  2A28 A;  2L2P A;  1HK9 A;  3GOX A;  4JDS A;  2HAX A;  1VQ9 A;  4ZGE B;  5LJ5 e;  1X69 A;  3CCV T;  1I4K 1;  2P4R A;  4M78 B;  2XK0 A;  3OB9 A;  2DNU A;  2ZAE A;  2KRM A;  4C5G A;  2A3L A;  3UWN A;  1Q86 R;  5GAN 5;  3M9Q A;  2RQT A;  2KSS A;  4J9C A;  2YSQ A;  2RPN A;  5C6S A;  3CBP A;  3BDU A;  3DB3 A;  1M1K R;  2F69 A;  4ZN1 A;  2RHZ A;  4BI3 A;  4O6J A;  2QQ9 A;  4OGC A;  5DY9 A;  1VQO Q;  1JXM A;  3O5Z A;  4J9E A;  4L5G A;  1I5L A;  2VC8 A;  4PJO E;  1RAA B;  4X1V A;  3HRU A;  5FRN A;  3CCR A;  4OMM A;  4M77 B;  5IH2 A;  4QKU A;  1Z9Q A;  2X4Y A;  1D1B A;  2QG9 B;  3G6E T;  4PFZ A;  1JJ2 A;  4KT0 E;  1VQ4 T;  3OYL A;  3CME A;  2ODG C;  4J6W A;  1VQ5 T;  4LDV A;  2H3J A;  1WI7 A;  2HKN A;  4GLK A;  3JRZ A;  4J9F A;  2KNB B;  2OTL A;  2DL5 A;  2LC4 A;  1H64 1;  4RTV A;  4RCB A;  3JCM c;  1NYG A;  4KUL A;  4R55 A;  1AZG B;  4BY6 C;  3SWN B;  2M02 A;  1B7T A;  3THK A;  1EFN A;  2PQW A;  4PJM A;  1XNI A;  5CKH A;  2HJQ A;  1Y57 A;  3CC7 T;  4OMF B;  1CKB A;  1EX4 A;  3QYG B;  2LX7 A;  1YWP A;  4RTU A;  3ULR B;  3NTI A;  3QZ9 B;  2F1L A;  1KQS S;  3H41 A;  3OYA A;  1UJ0 A;  4BAC A;  5LJ5 f;  3CC2 T;  2CH4 A;  3M0Q A;  1V29 B;  3OMC A;  2LQW A;  4M7A B;  3QBY A;  4C0D B;  3DLL A;  1VQO A;  3OYH A;  1BIB A;  2GTJ A;  1TUD A;  1K9M R;  2PUK B;  2M9U A;  1D0X A;  5IT9 E;  1H9E A;  3V7C A;  1KG1 A;  2FZG B;  1N9S A;  1KD1 U;  4X9C A;  4N0A A;  4WCI A;  3UPU A;  1XOV A;  2Y4Y A;  2AIR B;  2FO0 A;  2O01 E;  1J3T A;  4HXJ A;  1PCX A;  3QKJ A;  2HZY A;  1YJ9 Q;  1ZSZ B;  1VQ7 A;  4IUU A;  3G71 Q;  2FYK A;  2KAF A;  4ZN3 A;  2QNF A;  2G3R A;  2DM1 A;  4IUT A;  5GAO l;  4D6W A;  1JEI A;  1TSF A;  3OW2 S;  2DEQ A;  3CPF A;  1Q82 R;  3I56 A;  2D8H A;  1X6G A;  3V8K A;  3FC3 A;  1SSF A;  1QVG P;  1OU9 A;  2FZC B;  4BE0 A;  1Q86 C;  2DMO A;  3LWH A;  2JJ9 A;  5CKB A;  4ESR A;  1M1K C;  1FXX A;  1X6B A;  2E4H A;  3TSW A;  5CKE A;  2EPD A;  1Y07 A;  3QDF A;  5GMK l;  5GAN j;  2YDL A;  2LP5 A;  3V7S A;  2EQU A;  3HFN A;  1GJJ A;  2X9H A;  5L23 A;  4AG2 C;  3EFO A;  1M30 A;  4X34 A;  2RO0 A;  8AT1 B;  4IUV A;  1VQN A;  2HCK A;  3GNG A;  1T0J A;  1BB9 A;  1U06 A;  4FW2 A;  2DAQ A;  1IHV A;  3LGL A;  2LQ8 A;  1ABO A;  2ZGW A;  5KYY B;  3CC4 Q;  4DA4 A;  3A8M B;  4EMK B;  1TU0 B;  3S6W A;  4MZT A;  4QVZ A;  2K3Y A;  2LJ3 A;  2XMF A;  2C0O A;  2K5I A;  2V1Q A;  2E3H A;  4IUP A;  5GMK m;  4PLI A;  4JLG A;  3H8Z A;  1YJ9 A;  1YIJ Q;  5CAI A;  3G71 A;  3QZ5 B;  3MJX A;  1EIF A;  3MP8 A;  1GKU B;  4AFQ C;  2DIG A;  3TU4 K;  3KBG A;  4D8K A;  3QO3 A;  1R8O B;  2XID A;  4ZGD B;  3A98 A;  4HT8 A;  2GBQ A;  4HT9 A;  3JCM X;  1QVP A;  3HRT A;  3I55 Q;  3VYH B;  4J9G A;  1QW1 A;  1SG5 A;  3QDR B;  3NGP A;  1K8A U;  1K9M C;  3ZEH A;  1JO8 A;  5IN1 A;  4PJO C;  2E41 A;  1E6H A;  1H3H A;  4L6V 5;  3UAT A;  4C8Q G;  4FL6 A;  5LJ3 g;  2XKO C;  2LC3 A;  5HKC A;  4JRQ A;  1LNX A;  5HK3 A;  4NS5 A;  4BD3 A;  3JCM h;  3CC4 A;  3CCU Q;  4JS5 A;  2EGA A;  1OX9 A;  4J8O A;  3EH1 A;  3EG0 A;  3JAM E;  1YNS A;  1VQL Q;  2RA2 A;  1Q82 C;  1RAC B;  4J6X A;  1CKA A;  1YJN Q;  1UGQ B;  1YIJ A;  5LJ5 h;  1VUB A;  4PFP A;  4HVW A;  1TH7 A;  2DFU A;  5AYF A;  4QQD A;  2YRC A;  3A5Z B;  3L2Z A;  1GRI A;  2A08 A;  1IXD A;  4J6Y A;  2BUD A;  4MMK A;  1RI9 A;  4KUD K;  4QVD A;  1HXD A;  4PJO D;  2QA4 A;  1O9S A;  1X27 A;  4II1 A;  5DLQ E;  4DBQ A;  2KBT A;  5KYX B;  3MHX A;  4E7H A;  3I55 A;  2JN0 A;  2JS0 A;  2QEX A;  4O5V A;  4ATO A;  2JNG A;  2JW4 A;  1NPR A;  2EJF A;  3INZ A;  2FPE A;  1WJR A;  3G71 T;  4IIO A;  2EJG A;  2VKN A;  2DRK A;  2Y90 A;  4QQ6 A;  2EFI A;  2MWO A;  1G3W A;  3CMA Q;  2DIQ A;  3C4S A;  1AWW A;  3EGD A;  2FHD A;  5D6X A;  1VQ6 Q;  2CS7 A;  4PJO F;  3OYB A;  5GAN 4;  1YHQ Q;  2LCL A;  1VIF A;  3CCM Q;  1YCS B;  1ZUY A;  4MML A;  2GQV A;  3MEA A;  2BE9 B;  2WSE E;  2RQW A;  4C8Q E;  2BTT A;  1KQS P;  2LT1 A;  2JTM A;  2LJ1 A;  3E9F A;  2BIV A;  1PG5 B;  4OMQ A;  2OAU A;  2BZ8 A;  1PRM C;  2RNO A;  4Z88 A;  3CC4 T;  1ZUK A;  5KE2 A;  3FRN A;  5GAO r;  1OZ3 A;  4R0K A;  4M7D G;  2PVD B;  1PSF A;  3JCM b;  2DA9 A;  2YLB A;  3ZFJ A;  2HMA A;  2CP2 A;  2F5T X;  4E2F B;  1VQM Q;  1P92 A;  3J81 E;  2CKK A;  2EGC A;  2K79 A;  4JLI A;  1Q81 U;  1H1J S;  1X6O A;  1YWO A;  1GL5 A;  1BCO A;  3CCQ A;  1YHQ A;  1QVF S;  3QG1 A;  3A8H B;  2H8H A;  1Y96 B;  3CCJ A;  1ZUU A;  3CCM A;  3I5S A;  2XD0 A;  1WHJ A;  2GTO A;  2H3E B;  2MPH A;  1M3C A;  1VQP Q;  1WX6 A;  3EG1 A;  1KQS A;  2CUB A;  1A62 A;  2HQH A;  3PVQ A;  3J7A F;  2X51 A;  1UTI A;  1IO6 A;  5I11 A;  2QAZ A;  4M75 G;  4FYW B;  4PJO A;  2KVE A;  1YIT Q;  3CQT A;  3QWX X;  1BCM A;  1U5S A;  3CCU T;  3FEO A;  2E1H A;  4A4F A;  5KYN A;  3EFO B;  2A7Y A;  4FIB A;  1VQL T;  3OY9 A;  2XHC A;  2F2X A;  1YJN T;  1M3B A;  2X3W D;  4M4Z A;  4N4H A;  1JXO A;  1VQM A;  3CD6 T;  4F7U G;  1S72 Q;  3L2U A;  3EG2 A;  1KD1 R;  2KYM A;  3OW2 A;  2L89 A;  4EMG A;  3E19 A;  2ZPB B;  3CCE Q;  1SHF A;  4A4G A;  2CP0 A;  2DER A;  5I2S A;  4M7D E;  4C92 G;  4EMH A;  2DX1 A;  3ASK A;  4TVR A;  2AKL A;  3LW5 E;  4BI8 B;  2YUO A;  3G4S A;  5LL6 S;  3HTR A;  1QLY A;  2LNV A;  2YT6 A;  2X4J A;  2C0T A;  3OA6 A;  5FWC A;  5GJV B;  1VQP A;  5LJ3 j;  1ACM B;  2L3R A;  2DLP A;  2XG8 D;  2RH2 A;  4Z02 A;  4A4H A;  4ELY C;  1ZSG A;  4N0A C;  3LH5 A;  4J7I A;  4ORZ A;  3CMA T;  1OPL A;  2RI3 A;  2CP7 A;  1YIT A;  1PSE A;  2XDP A;  3DB4 A;  1SRL A;  2JMA A;  1VQ6 T;  4XK8 E;  2EAY A;  3NMZ C;  1VYV A;  4A4K A;  1M90 U;  3KUF A;  2BKD N;  2X3X D;  2IVW A;  1PRL C;  2RHU A;  2DBM A;  1WHK A;  4JRI A;  3H6Z A;  2LCS A;  2CDT A;  1TUG B;  4C5I A;  2KXC A;  4V2S A;  1IHW A;  4M75 E;  2KI7 A;  4BY6 B;  2JM9 A;  1K9A A;  4XTV A;  2HBW A;  3JCM g;  3MCA B;  1S72 A;  2DXU A;  5GAN e;  1TWB A;  4PJJ A;  4JRK A;  2D0Q B;  3OYE A;  4Z8A A;  1QP2 A;  1OUL A;  2PVO B;  3TEE A;  3TSZ A;  1YI2 A;  2OI3 A;  2KY9 A;  2DYI A;  3JCM W;  2RI2 A;  3JSC A;  5LJ5 g;  3TCJ A;  4C8Q C;  3QUI A;  2QYZ A;  2SRC A;  3F70 A;  3X25 B;  2LTO A;  5GJW B;  4B9W A;  1NLP C;  2DJZ A;  2OTL Q;  1M27 C;  5IAY A;  1PHT A;  3VUZ A;  4F7U E;  3EG9 A;  3P8H A;  5LJ3 d;  5GAN 2;  1RAD B;  1MMA A;  1KHI A;  4MDX A;  1VA7 A;  3VS6 A;  2P0Q A;  2EYY A;  2OTJ A;  5KCO A;  2SEM A;  1U1T A;  4J9D A;  1BI3 A;  5GMK e;  4DQ2 A;  2ABL A;  4C92 E;  4PNO A;  4E6R A;  1D1C A;  3RMQ A;  4OMP A;  1FX7 A;  1K8A R;  2CP3 A;  3NTK A;  2HQX A;  4J9H A;  2NUZ A;  3VRY A;  3VS2 A;  3FJP A;  1KD1 C;  2VVK A;  2HSP A;  3CCS A;  3A8L B;  5J26 A;  1WJQ A;  1JEQ A;  2O9V A;  3EGD B;  4C8Q D;  5M9O A;  4R56 A;  2DTH A;  3L2W A;  2I0N A;  2C06 A;  1MV0 B;  4EIK A;  4ZTJ A;  4LDU A;  3GLX A;  1QWF A;  2KVD A;  2V8K A;  4F04 B;  2E64 A;  3FDR A;  3QWY A;  2RQU A;  1AZE A;  3RBB B;  3M57 A;  3EFS A;  1GXI E;  3DLM A;  4QVC A;  1VQ7 Q;  1IZ6 A;  1XTD A;  5GAN f;  1CSK A;  3H9N A;  3M53 A;  3EHR A;  1D0Z A;  1MMN A;  3SD4 A;  5CIU A;  1GL9 B;  1WFW A;  2RK2 A;  2AKK A;  3C12 A;  1I0C A;  3I56 Q;  1I81 A;  4BDZ A;  1VQ8 A;  4C8Q F;  1G2B A;  4LNP A;  4IUQ A;  4KUI A;  5CQX A;  1NZ9 A;  1OPK A;  2RQR A;  1ABQ A;  3EGU A;  2LZ6 B;  3CCL Q;  1N8R U;  1IB8 A;  2CT3 A;  3M4G A;  2DTO A;  3EH2 A;  4BB7 A;  1JJR A;  1NE8 A;  4WF2 A;  4B9X A;  1I8F A;  4GY5 A;  3PVL A;  1YJW Q;  3CCE T;  2A8V A;  3UF4 A;  3P8B B;  3JB9 I;  4J7F A;  3SEM A;  1QVF P;  3JB9 J;  4LDX A;  1KC8 U;  4PKC C;  1RAE B;  3PNW C;  2RJF A;  2KDS A;  2QNC A;  2EBP A;  1VQN Q;  4KGV B;  3A1P A;  2MAM A;  2RJD A;  1XJW B;  4FSX A;  3VRZ A;  4XTY A;  5AT1 B;  1V76 A;  4M7D C;  2KGT A;  1VQ9 T;  2O4X B;  2B8A A;  2X35 A;  1Q7Y U;  3VS3 A;  3L2R A;  1WNL A;  1WHG A;  2EQI A;  2YXY A;  3ME9 A;  1ZQ1 A;  1U8R A;  2CUD A;  2QTV A;  2A0F B;  5CO7 A;  4OMN A;  1TOV A; 
#chains in the Genus database with same CATH homology
 1VQM T;  1VUB A;  4PJO B;  5KE3 A;  1WQ7 A;  1X75 C;  1NPP A;  3JCM J;  4BI4 A;  3L1A A;  5CCA A;  2RI5 A;  3M4Y A;  1KC8 C;  3GNF B;  1TH7 A;  2EJ9 A;  3JCM e;  4YTL A;  5AYF A;  1K8A C;  3CC2 A;  2E6Z A;  3OYK A;  3QII A;  4QQD A;  4M7D B;  3A5Z B;  3L2Z A;  3L2Q A;  2CYZ B;  3CCL A;  3RUX A;  4BDY A;  2MF2 A;  2XIC A;  3M59 A;  2WSC E;  2LDM A;  4J6Y A;  2BUD A;  2R58 A;  2XI9 A;  4MMK A;  1VQK T;  3GPL A;  3C94 A;  3CCR T;  3JB9 G;  4KUD K;  3OSS C;  4QVD A;  3X28 B;  2X4X A;  1HXD A;  2RK1 A;  5CR2 A;  1D3B A;  1YJW A;  3HL8 A;  3OYD A;  4XU3 A;  5FRO A;  5GAM h;  4M7A E;  1YCY A;  1B34 B;  4PJO D;  2QA4 A;  2E65 A;  5KCH A;  1O9S A;  3QYH B;  3G4S T;  2QTX A;  3J80 E;  1M9S A;  4II1 A;  2QDY B;  5DLQ E;  5GAO m;  3MHX A;  3SDZ A;  3CME T;  2JZ2 A;  4M75 C;  3I55 A;  4E7H A;  2GFU A;  2JN0 A;  4J83 A;  1WJS A;  2QEX A;  4E7I A;  1QVF A;  4M7D D;  1VQP T;  3OSV A;  5D6Y A;  4C8Q A;  2OTL T;  3PTA A;  3P8D A;  2JUF A;  4O5V A;  2KK4 A;  5FU6 C;  5I2M A;  4ATO A;  1QP3 A;  2D6F A;  4RG2 A;  2JNG A;  3GF5 A;  1NPR A;  2EJF A;  3HP9 A;  3INZ A;  4HA8 A;  1WJR A;  3G71 T;  4JS4 A;  1BI2 A;  2JVV A;  2EJG A;  3LYI A;  2XDD A;  2Y90 A;  3PGG A;  4NL2 A;  2EFI A;  4QQ6 A;  3OYF A;  1M4Z A;  2MWO A;  4JJN K;  5GAN 6;  3S3N A;  1G3W A;  2L8D A;  2CZ0 B;  5A0D A;  1YIT T;  3HKS A;  5GAM e;  1KQ1 A;  2ZCF B;  2DIQ A;  3QJY A;  3C4S A;  2VXE A;  1U1S A;  3JCM P;  3JCM Q;  1BI1 A;  3OYJ A;  2F5K A;  2FHD A;  3PMI A;  3CCV A;  5D6X A;  1M1G A;  2CS7 A;  5HY6 A;  4PJO F;  2K57 A;  2LQK A;  3OYB A;  1BYM A;  2QI2 A;  1G3S A;  2QQR A;  4ME7 A;  5GAN 4;  1MHN A;  2EWN A;  4M75 B;  2LCL A;  2YHT A;  3URG A;  3X26 B;  4M7D F;  4LD9 K;  2PUO B;  1VIF A;  1YBY A;  2X4W A;  1AHJ B;  5FU6 B;  4MML A;  2GQV A;  3MEA A;  3QSU A;  2RJC A;  4EMK A;  4C0F A;  2WSE E;  4C8Q E;  4UC4 A;  3CXC S;  2EIF A;  2LT1 A;  2JTM A;  1S72 T;  2LVM A;  1BI0 A;  3E9F A;  4C92 C;  1VQO T;  3GIB A;  2NLU A;  4CRI A;  5GAN g;  4M75 D;  1JBM A;  4QW2 A;  2K2V A;  2RB6 A;  2BIV A;  1YI2 T;  2OAU A;  3LX7 A;  4MZP A;  3V8J A;  3EFR A;  2VGM A;  1N27 A;  3OMG A;  4F7U B;  4ZGJ B;  5CK9 A;  2DD4 A;  4XQ3 A;  5C0M A;  5GAO p;  2R5M A;  3Q1J A;  5J39 A;  5GMK i;  3CC4 T;  4XAX B;  5KE2 A;  3FLG A;  3FRN A;  1H3Z A;  2FVU A;  5GAO r;  3LH0 A;  1OZ3 A;  4PJO G;  1G3T A;  5GAN h;  3JCM f;  4Q5W A;  1Y7X A;  2P0K A;  2YRV A;  1VQ7 T;  2EYQ A;  3SFM A;  5GAN 8;  4M7D G;  2PVD B;  1PSF A;  2FL7 A;  3JCM b;  2YLB A;  3ZFJ A;  2OTJ T;  4C92 B;  3MP6 A;  3NFC A;  5GAM j;  2F5T X;  3QJ6 A;  3I56 T;  1P92 A;  4M75 F;  2ZZD A;  3J81 E;  2HQE A;  2CKK A;  2V8J A;  3OBW A;  4P5N A;  4FT4 A;  3E9G A;  4JLI A;  1Q81 U;  1N8R C;  1BIA A;  1X6O A;  3CCL T;  3FIF A;  3V8L A;  2ZPF B;  2JTF A;  5I21 A;  3A8O B;  2WAC A;  2ZPE B;  2WSF E;  5LJ3 h;  2HBP A;  2DTI A;  3CCQ A;  2VV5 A;  3MEU A;  4L59 A;  1YHQ A;  1QVF S;  2DXT A;  3QG1 A;  3CBM A;  4C92 D;  3A8H B;  3X24 B;  3CCE A;  4M78 C;  1Y96 B;  3R6O A;  3HPW A;  4FM4 B;  3CCJ A;  3CCM A;  2M1H A;  2LT4 A;  5GMK h;  2XD0 A;  2P0P A;  3WVD B;  2DXC A;  2L5Q A;  2MI6 A;  3JCM d;  3GP8 A;  1JRI A;  1MGQ A;  5GAM f;  3CCS T;  4QQG A;  3BDL A;  2I2L A;  2M16 A;  4F7U F;  1N9R A;  1KQS A;  3VKI A;  4BE1 A;  3MEV A;  3RIR A;  3J7A F;  3CBO A;  1VQN T;  1HK9 A;  4JUV A;  5FLX E;  5A0G A;  4XTX A;  3AHU A;  2K4Y A;  3G7Z A;  4NOY A;  3GOX A;  2FB7 A;  1Y96 A;  4M75 G;  4C0Z A;  2DXB A;  5A2Q E;  4PJO A;  4IUR A;  5LJ5 d;  4JDS A;  3UT1 A;  4E7K A;  2QQB A;  2HAX A;  1WPY A;  2HNI A;  2MMP A;  4ZGE B;  5LJ5 e;  1VQ9 A;  4C92 F;  1Q81 C;  3CCV T;  1I4K 1;  1Y71 A;  3ZBD A;  4M7D A;  2DZC A;  4M78 B;  3CCU T;  2DD5 A;  3BW1 A;  2XK0 A;  3OB9 A;  3FEO A;  1M8V A;  2E1H A;  5D6W A;  2VXF A;  4A4F A;  4M77 C;  3L42 A;  4XTW A;  2A7Y A;  4FIB A;  1YJ9 T;  1VQL T;  4C5G A;  2A3L A;  3M54 A;  3OY9 A;  2XHC A;  3UWN A;  4A54 A;  1VQ8 T;  2QXF A;  3M9Q A;  5GAN 5;  1YJN T;  4RKU E;  1B34 A;  2KSS A;  4N4H A;  2VUB A;  3JCM V;  3PIP A;  5GAM d;  3MO8 A;  4OB3 B;  3MEW A;  1OI1 A;  1FWZ A;  5C6S A;  3CBP A;  3BDU A;  3DB3 A;  1VQM A;  2F69 A;  4ZN1 A;  1X01 A;  4M78 A;  4F7U G;  3CD6 T;  2RHZ A;  4BI3 A;  2RD1 A;  4M78 D;  3HRS A;  2QQ9 A;  4O6J A;  4OGC A;  4BUG A;  3HFO A;  3L2U A;  5DY9 A;  3RKX A;  2KVQ G;  3OW2 A;  2L89 A;  3E1S A;  3SWN C;  4L5G A;  4EMG A;  1I5L A;  3E19 A;  2K5L A;  2VC8 A;  4PJO E;  4OGE A;  2ZPB B;  4LDW A;  1G3Y A;  3HRU A;  2M0O A;  4A4G A;  1VQK A;  5FRN A;  1ZBX A;  3CCR A;  4M77 B;  5I2S A;  4M7D E;  3ER0 A;  1RL2 A;  4XU0 A;  4C92 G;  4EMH A;  2E70 A;  2X4Y A;  5CKF A;  3ASK A;  4TVR A;  3X20 B;  3LW5 E;  4BI8 B;  3G6E T;  3G4S A;  4HCC A;  1JJ2 A;  4KT0 E;  5LL6 S;  1VQ4 T;  3OYL A;  5CKD A;  3CME A;  2LNV A;  4J6W A;  2X4J A;  1M1F A;  2LX9 A;  1VQ5 T;  4LDV A;  2H3J A;  2DVE A;  3OYC A;  3OA6 A;  2DKG A;  4GLK A;  1VQP A;  4M75 A;  5LJ3 j;  3JRZ A;  4N4I A;  4OP0 A;  4PLL A;  2OTL A;  2LC4 A;  2L3R A;  3HSB A;  2XG8 D;  2RH2 A;  4M78 F;  1H64 1;  4E7J A;  3OBY A;  4RCB A;  3JCM c;  4KUL A;  3M55 A;  4Z02 A;  4BY6 C;  5LJ5 j;  3SWN B;  4M77 D;  4R55 A;  2ZPH B;  4A4H A;  5GMK j;  4ELY C;  4N0A C;  4BE2 A;  4J7I A;  2PQW A;  3BY7 A;  3OS1 A;  2KQW A;  4M7A C;  1XNI A;  5CKH A;  1LJO A;  3CMA T;  4C0D C;  2RI3 A;  4ZTF A;  1DJ7 B;  1YIT A;  1PSE A;  4IKF A;  1BKB A;  2XDP A;  4OMF B;  3DB4 A;  4RG8 A;  1W2B A;  3CC7 T;  3VV0 A;  3RKW A;  4RCC A;  1WGS A;  1VQ6 T;  2YLC A;  3M56 A;  4VUB A;  4XK8 E;  3QYG B;  3RES A;  1QVG A;  2EAY A;  2E5Q A;  4A4K A;  2DPP B;  1M90 U;  3KUF A;  2BKD N;  1K73 U;  3SWN A;  1RI0 A;  3NTI A;  2IVW A;  3QZ9 B;  5EG2 A;  5LJ3 f;  4F7U A;  1YIJ T;  3EAE A;  1KQS S;  5FRM A;  3JB9 H;  2RHU A;  4HCZ A;  4JRI A;  4E7L A;  3OYA A;  1O75 A;  3H6Z A;  3MP1 A;  2RJE A;  4C5I A;  4V2S A;  2XU8 A;  5L8R E;  1Q7Y C;  4BAC A;  5LJ5 f;  4M75 E;  3CC2 T;  4BY6 B;  1UB4 A;  4LDY A;  4M77 F;  4N4G A;  5GAN d;  4XTV A;  4XTZ A;  3JCM g;  1V29 B;  2P4T A;  3OMC A;  3MCA B;  1S72 A;  2DXU A;  4M7A B;  5GAN e;  3QBY A;  4OB2 B;  4M78 G;  1Q86 U;  3LLR A;  4C0D B;  3DLL A;  1VQO A;  4JRK A;  2D0Q B;  3OYH A;  1BIB A;  4C92 A;  3OYE A;  2PUK B;  2M9U A;  2DO3 A;  1YJW T;  1M1K U;  1QP2 A;  5IT9 E;  2PVO B;  3TEE A;  1YI2 A;  4XU1 A;  4A53 A;  5GAN 7;  2QA4 T;  3VJP A;  2KY9 A;  3V7C A;  4A4E A;  3JCM W;  1KG1 A;  1N9S A;  5HK0 A;  1KD1 U;  3I55 T;  2RI2 A;  3JSC A;  5LJ5 g;  4X9D A;  3TCJ A;  4C8Q C;  2QEX T;  2LCC A;  4N0A A;  4X9C A;  3UPU A;  1XOV A;  3QUI A;  3F70 A;  2Y4Y A;  3BFM A;  5DLO A;  3X25 B;  2LTO A;  2CZ7 B;  4M7A A;  2O01 E;  4B9W A;  5KH6 A;  2DJZ A;  3QKJ A;  1UGP B;  4M7A D;  4E47 A;  5IAY A;  2K3X A;  2R57 A;  3VUZ A;  4F7U E;  3P8H A;  4C5E A;  5LJ3 d;  2RHI A;  1W4S A;  1M90 C;  3A8G B;  4IUU A;  5GAN 2;  1K73 C;  1VQ7 A;  1KHI A;  2FYK A;  2KAF A;  4ZN3 A;  4MDX A;  2G3R A;  5LJ3 e;  5GAO l;  4IUT A;  2P0Q A;  4D6W A;  5A0L A;  3PFS A;  3OYM A;  1NJI U;  2OTJ A;  2IG0 A;  3OW2 S;  2E6N A;  2DEQ A;  2MWP A;  3CPF A;  5KCO A;  3S3O A;  3PT9 A;  1U1T A;  4CI0 C;  3I56 A;  1D3B B;  2EQM A;  3OS0 A;  2Y4X A;  4M77 G;  1BI3 A;  5GMK e;  5GAM g;  2QQS A;  1KHC A;  3V8K A;  3L2V A;  4DQ2 A;  2V8I A;  3FB9 A;  1SSF A;  3FC3 A;  3RER A;  4C92 E;  4PNO A;  4BE0 A;  3M58 A;  5GAO n;  1Q86 C;  3RMQ A;  3QPH A;  4C8Q B;  5FU7 C;  2EQK A;  1FX7 A;  3LWH A;  1JJ2 S;  5CKB A;  2EKO A;  5CQY A;  3KXT A;  4EMK C;  1FXX A;  4OB1 B;  4FT2 A;  1M1K C;  3OYG A;  4M7A F;  2RHY A;  3NTK A;  4OF1 A;  2HQX A;  3LGF A;  5CKE A;  3PIO A;  1Y07 A;  3FJP A;  3N5B B;  1KD1 C;  3OYY A;  4JRP A;  2LRQ A;  2RHX A;  5GMK l;  5J3B A;  5GAN j;  3CPW A;  3V7S A;  2R5A A;  2EQU A;  3HFN A;  3CCS A;  3A8L B;  1UGS B;  2CZ1 B;  1WJQ A;  5J26 A;  1KQ2 A;  4RMO A;  4Y28 E;  4XU2 A;  4C5H A;  4C8Q D;  1XQH A;  5M9O A;  4R56 A;  3DKM A;  2DTH A;  3C95 A;  3L2W A;  3OQ5 A;  2RO0 A;  2E12 A;  4X34 A;  3WVE B;  1VQN A;  2DZ9 A;  2KMT A;  4IUV A;  1W2B S;  2C06 A;  1NJI C;  4HCB A;  3GNG A;  4ZTJ A;  2V8K A;  3GLX A;  3O8V A;  4LDU A;  2DAQ A;  5GAO q;  3LGL A;  2E64 A;  2LQ8 A;  2ZGW A;  3FDR A;  5FU7 B;  1QVG S;  2XDB A;  1M5Q 1;  4EDU A;  4DA4 A;  3A8M B;  4EMK B;  3S6W A;  4MZT A;  3TRE A;  2CZ6 B;  4QVZ A;  4EPC A;  3M57 A;  2K3Y A;  3EFS A;  2K5I A;  3T9N A;  3VUB A;  1GXI E;  3CCU A;  2HD0 A;  3DLM A;  4QVC A;  1K9M U;  1IZ6 A;  1XTD A;  2ZPI B;  4IUP A;  3M53 A;  5GMK m;  5GAN f;  5CVI A;  4PLI A;  4JLG A;  3SD4 A;  4DOV A;  3CEY A;  4M7A G;  3H8Z A;  3UDC A;  5CIU A;  1YJ9 A;  1VQL A;  2RK2 A;  3C12 A;  4M77 A;  1OYX A;  5CAI A;  2GCX A;  3G71 A;  4M78 E;  1I81 A;  4BDZ A;  1VQ8 A;  3QZ5 B;  2ZPG B;  4C8Q F;  1YJN A;  1EIF A;  4XTU A;  4LD6 A;  3OYI A;  3MP8 A;  4IUQ A;  4KUI A;  5CQX A;  4Y91 A;  2DIG A;  3TU4 K;  1G5V A;  1IRE B;  1NZ9 A;  2K5F A;  1ZHI A;  3OS5 A;  3CD6 A;  3KBG A;  1N8R U;  3QO3 A;  2AHJ B;  3NTH A;  1R8O B;  2XID A;  4OB0 B;  4FU6 A;  4ZGD B;  4KBM B;  3JB9 D;  3CCQ T;  3M4G A;  2DTO A;  4BB7 A;  1NE8 A;  1UEB A;  1WQW A;  5GAN 3;  3S3M A;  1LOJ A;  2GF7 A;  4WF2 A;  4B9X A;  1I8F A;  4GY5 A;  1YHQ T;  1Q82 U;  1JB0 E;  3OS2 A;  3CCE T;  3OYN A;  3LWI A;  3CCJ T;  4HT8 A;  3P8B B;  3CCM T;  4HT9 A;  2EQJ A;  3JB9 I;  3JCM X;  4J7F A;  1QVP A;  3HRT A;  3VYH B;  3WXM B;  3JB9 J;  3SB2 A;  1QW1 A;  3PMT A;  5DM7 R;  4LDX A;  3QDR B;  4C0G A;  1KC8 U;  4PKC C;  3G6E A;  4DOW A;  3PNW C;  2GFA A;  4MZM A;  4MDW A;  1VQ4 A;  1K8A U;  1K9M C;  4HKE A;  2RJF A;  2KDS A;  3ZEH A;  1VQ5 A;  4M77 E;  2JOY A;  3MET A;  3V7R A;  3QHS A;  2VYT A;  5IN1 A;  4PJO C;  2E41 A;  3CXC A;  4L6V 5;  2RM4 A;  1VIE A;  2MAM A;  2RJD A;  4FSX A;  4FL6 A;  4C8Q G;  2XKO C;  2VGN A;  5LJ3 g;  1OZ2 A;  4XTY A;  3JB9 F;  5HKC A;  4JRQ A;  4M7D C;  1LNX A;  4OVA A;  3M5A A;  1VQ9 T;  2DK3 A;  2D9T A;  2O4X B;  5HK3 A;  1UGR B;  4NS5 A;  2B8A A;  2X35 A;  4J5Y A;  4BD3 A;  3JCM h;  3CC4 A;  1Q7Y U;  3VYG A;  3L2R A;  3CMA A;  1WNL A;  4JS5 A;  3RMS A;  4J8O A;  2PVG B;  3CC7 A;  3JAM E;  3ME9 A;  2CGH A;  1VQ6 A;  4ELZ C;  2E10 A;  1ZQ1 A;  1U8R A;  2RA2 A;  3CPW S;  1Q82 C;  2QQA A;  3QXE B;  4J6X A;  4PL6 A;  1N6A A;  1UGQ B;  4NL3 A;  3RKY A;  3VU3 C;  5CO7 A;  2O4X A;  1YIJ A;  2PU9 B;  3HHT B;  5LJ5 h; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...