1KHCA

Crystal structure of the pwwp domain of mammalian dna methyltransferase dnmt3b
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
135
Chain Sequence
EYQDDKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMPGMRWVQWFGDGKFSEISADKLVALGLFSQHFNLATFNKLVSYRKAMYHTLEKARVRAGKTFSSSPGESLEDQLKPMLEWAHGGFKPTGIEGLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA cytosine-5 methyltransferase 3B2
publication title The PWWP domain of mammalian DNA methyltransferase Dnmt3b defines a new family of DNA-binding folds.
pubmed rcsb
source organism Mus musculus
molecule tags Transferase
total genus 37
structure length 135
sequence length 135
ec nomenclature ec 2.1.1.37: DNA (cytosine-5-)-methyltransferase.
pdb deposition date 2001-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.720.50 Mainly Alpha Orthogonal Bundle Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 PWWP, helical domain 1khcA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1khcA01
3E9GA 3OMCA 4PL6A 4IUVA 2QQSA 3S6WA 2EQMA 2JTFA 2BIVA 1WGSA 3CEYA 1OYXA 2RJFA 3S3NA 4C5GA 4QW2A 1WJQA 2RHZA 3QKJA 2RHIA 4BE0A 1N27A 3MEAA 2XDPA 1OZ2A 4OVAA 3PMTA 2LRQA 4N4IA 3OS2A 4ZTJA 2NLUA 5FRNA 4CRIA 3FLGA 3OYJA 3PMIA 5IAYA 3OB9A 2GF7A 3UWNA 3L2VA 5J39A 5FRMA 2EQKA 3OYLA 3DB3A 2DIGA 3O8VA 4IUUA 2LVMA 4BACA 3P8DA 4EDUA 3OYMA 3E9FA 3NTHA 3OA6A 2DIQA 4Z02A 3MEUA 2HQXA 3DB4A 3Q1JA 4BDYA 3C4SA 2BUDA 5D6YA 4E7KA 2LTOA 1SSFA 2RHUA 3EAEA 3LGFA 4N4HA 3OYAA 2X4YA 4E7IA 3MP8A 1MHNA 1WJSA 3MP1A 2R5AA 3QJ6A 4L59A 2VYTA 4A4HA 2YRVA 2WACA 4A4GA 3KUFA 4E7HA 5D6WA 4GY5A 3QIIA 2K3YA 3OYCA 2EFIA 2RJDA 5KCHA 2L8DA 2CKKA 3OS1A 2P0KA 3OYBA 3L2RA 3NTKA 3OYHA 2L89A 2BKDN 4IUTA 5KE2A 2FHDA 3LX7A 3FDRA 4IURA 4PLLA 4BDZA 1OZ3A 2R5MA 1G5VA 4II1A 4IUPA 2QQRA 4C5HA 2M0OA 4IUQA 3MO8A 2O4XA 2RI2A 4ZTFA 2G3RA 2IG0A 4FL6A 4B9WA 3L2WA 2RHYA 2PQWA 4LD6A 4A4FA 3OYKA 3UT1A 3FC3A 3OYNA 3QBYA 4E7LA 1RI0A 4C5EA 2JZ2A 1KHCA 2RI3A 3MEWA 4PLIA 3OYFA 4IKFA 4HCZA 4QQGA 2R58A 2EQJA 4BD3A 5KE3A 2O4XB 3MP6A 4NS5A 3SD4A 1WJRA 3L2UA 4QQDA 5KH6A 2B8AA 3ASKA 4B9XA 2RI5A 4N4GA 2E6NA 3S3MA 2RHXA 3F70A 2DAQA 2X35A 3OYIA 2E5QA 2RO0A 3NTIA 4FU6A 1OI1A 3DLMA 3META 4C5IA 2X4XA 2RJEA 3LGLA 3LYIA 2MWOA 5M9OA 3GOXA 2RJCA 3H6ZA 3MEVA 3PNWC 1XNIA 5C6SA 2HQEA 3OYEA 2D9TA 5J26A 3OY9A 4BE1A 1H3ZA 2GFUA 2LDMA 2GFAA 3LH0A 4X34A 5IN1A 5C0MA 3L2QA 4UC4A 5CIUA 2M16A 3PFSA 4QQ6A 3BDLA 3FEOA 4A4EA 2XK0A 2EKOA 2F5KA 3L42A 2X4WA 3ME9A 3OQ5A 4BE2A 4Q5WA 3ZEHA 3H8ZA 3M9QA 2EQUA 3OMGA 2MWPA 5KCOA 4E7JA 3OYDA 4QVZA 3S3OA 2LCCA 5FROA 2L3RA 3LLRA 5D6XA 2K3XA 3P8HA 3OYGA 4RG2A 3OS0A 2R57A 2M1HA
chains in the Genus database with same CATH superfamily
1X69A 1U3OA 2KW9A 4C8QE 1WJQA 2RHZA 3FJPA 2EYXA 3NFCA 3MEAA 1X2KA 3NHNA 4CRIA 2V26A 4LN2A 4PJOC 1I07A 2E1HA 3O8VA 1TS9A 4E47A 1KJWA 1W1FA 1ZUYA 1Q95G 2GBQA 2HBPA 2BUDA 5LL6S 2FB7A 3RDVA 2E65A 3I9QA 1Y57A 3QJ6A 2PUKB 1QQJA 4CC2A 1VQ7Q 3D7SB 2CSIA 2RJDA 5KCHA 1OV3A 4XTYA 5FU7C 3CCLT 2K5IA 2BZ8A 2WSCE 3X20B 1AWOA 1BCOA 1YHQQ 2QA4T 4MZTA 4DOWA 1X01A 3J81E 4M77G 1HJDA 4RKUE 2JVVA 4J9CA 1WQWA 5KYXA 3CMEQ 1E7OA 4HCZA 4JPBW 2QGGA 5KH6A 4M75D 2F2VA 3OYIA 2E12A 2KT8A 4M78C 1H9EA 5M9OA 3SWNA 2ED1A 2QNFA 1RL2A 2CP5A 2ZPIB 3LH0A 3X28B 1M8VA 2ZZDA 5DY9A 2RB6A 2DLPA 4DEYA 3X24B 2LMJA 2DNUA 2C06A 3G4ST 3S3OA 2QA4Q 1VQNQ 6AT1B 5IT9E 2XIDA 4F7UA 1ZBHA 3JCMP 2GQVA 3MHXA 2A36A 3GBQA 2RNAA 3E19A 1Q82C 3CCST 4C92G 3CD6A 2RN8A 1KG1A 2GF7A 4E2FB 5FRMA 1NBEB 1KQSA 4A53A 2KNBB 3WVDB 2FO0A 1TH7A 3A8HB 4EMGA 3OA6A 5GANj 3JB9D 1JB0E 4XQ3A 1M8MA 2LTOA 4N4HA 1SSFA 2PUOB 1NYFA 2RNNA 1KFZA 2RQVA 3G4SQ 4DBHA 4L59A 4HVUA 4GLKA 3CQTA 1N8RR 1AD5A 3EGDB 2YXYA 5GAMh 4N0AA 3OYHA 2RQWA 4XTZA 3VUBA 2JVWA 2PU9B 4M78E 1TSFA 5CQYA 3NPFA 2CZ0B 4RMOA 2GTJA 3CC2Q 3JSCA 3MP6A 3SD4A 1WJRA 2HSPA 2RI5A 4AG2C 2DAQA 4M77A 4FU6A 2X4XA 3LGLA 5IH2A 1GCQA 4M75F 4BI3A 2KR3A 4PJNA 1H3ZA 1VYTA 2GFAA 4LDUA 4PJOB 4JLGA 3EFOA 4A63B 3OSSC 3RBBB 1OU8A 2EKOA 3ME9A 4M7AD 3QWYA 3QPHA 2EQUA 3THKA 1RLPC 3SHWA 2K5FA 2QDLA 4J9EA 1UHCA 4ANJA 1GFDA 3LLRA 4AFSC 3A8MB 2OTLA 2FRYA 1NPRA 5FW9A 2EJGA 2M0YA 2RJFA 4J9HA 2E3IA 1VQMA 1IXDA 4C5GA 2X9HA 2SEMA 4QT7A 1UEBA 2BE9B 3G71A 2LP5A 2XDPA 2CH4A 2VGMA 5FRNA 4ZNXA 2JW4A 1EN7A 3KBGA 2NUTB 5J39A 2FL7A 4EMKA 2LZ6B 5GMKm 2QYZA 3CC7T 3I5SA 3P8DA 3EFSA 1D3BB 5GANg 4LE9A 2HQXA 3DB4A 1GXIE 2FZCB 4M7DD 2L3QA 2JJ9A 2K7AA 1H8KA 3MJXA 3RESA 3MP1A 1TG0A 4C0FA 1UJ0A 3M0SA 1NYGA 2K2VA 2CKKA 1QVGA 1UDLA 1BIAA 2DD5A 5GANe 1K73C 1G5VA 2LX7A 3H0IA 3RNJA 1M27C 2A0FB 2G3RA 2IG0A 2DRKA 2H3JA 4ELZC 3M5AA 1YFNA 4RG8A 3OYNA 1YNZA 2K5LA 1WXBA 3FRNA 1S72A 1ZSGA 1YITQ 3CC7Q 1FWZA 2KYMA 2QNCA 1G3TA 5GAOm 3I56T 5C6SA 3RKXA 3KXTA 1X6BA 1M5Q1 3JB9J 3JB9H 4YTLA 5LJ3h 4OMNA 3PIPA 2K4YA 2F2WA 1RAEB 4BE2A 2A08A 4C0DB 3ZEHA 2RQUA 2Z0WA 1VIEA 5KYUB 2MK5A 4M7AF 1RABB 3OS0A 4LUEA 4QVCA 1H92A 2LNVA 3E9GA 1MV0B 1GCQC 4OMFB 1VYVA 3C12A 1QCFA 1SF9A 2XHCA 3IQLA 4JJCA 4XU3A 4J7FA 4O5VA 2MPHA 1UG1A 2CT4A 1KSWA 3JV3A 3I56Q 4Z8AA 5HKCA 2CZ7B 1IB8A 2ESWA 4C8QA 2F2XA 1MMGA 2DIQA 4EPCA 2D6FA 1D09B 3QO3A 4KULA 1KD1U 3A98A 1BCMA 1Q82R 1ZHIA 2QEXA 3L0OA 1VA7A 2A28A 1VQ8A 1V76A 2OTJT 2ATCB 2KK4A 4A4HA 2LNHB 4OF1A 4M7DF 4KGVB 5J3BA 2JXBA 2HKNA 5KYXB 3QHSA 4EMKC 1PRLC 2G6FX 2QI2A 3M56A 3GPLA 3I55T 3CXCA 2O88A 2EBPA 2ZPBB 5CK9A 5LJ5g 1M1FA 1K0SA 4R55A 1HK9A 1AWJA 4M78G 4A4FA 3SWNB 2EWNA 4C5EA 4C0ZA 3HFOA 2EJ9A 2LJ0A 3BDUA 2J6FA 2QDYB 5GANd 3CCVT 2V8KA 3F70A 2E5QA 1MNEA 3QUIA 2OTLQ 3PT9A 2MWOA 3VYHB 3GOXA 1X2QA 1E6HA 1R0CB 1YJNT 1VQMQ 3M59A 2M16A 4QQ6A 4ESRA 3G71Q 3QYHB 4M7AB 1QCOA 4F7UB 2D0QB 1WZOA 5FROA 2RH2A 1SHFA 1ZSZB 2CH4W 4XTWA 1C0MA 2ZAEA 4HA8A 4RCBA 3CEYA 4AFZC 2E3HA 2QTXA 2YUPA 3A8GB 3ER0A 1R0BG 1SG5A 1WPYA 3CC4A 3HSBA 1YIJA 5GANh 2FEIA 1EX4A 1WHLA 1YJWA 1WX6A 2MYSA 4C92F 1PKTA 1YJNQ 3HPWA 3BY7A 2EIFA 1GKUB 1LNXA 2HCKA 1AOJA 1ARKA 1OULA 3MP8A 3V7RA 1BI1A 1S72Q 3HRTA 4RTZA 4A4GA 4OB0B 4FSSA 1XJWB 2YLBA 2XG8D 4AT1B 2P0KA 3N5BB 3EG9A 3ZBDA 1P92A 3NTKA 3E2UA 3JCMg 5FU6C 4C8QC 1BYMA 1IREB 5FWCA 2H3EB 4DBRA 4II1A 4IUPA 4JS5A 4C5HA 2PZ1A 2ROLA 2RI2A 3OS5A 4M77B 3VV0A 4JUVA 2PQWA 3JRZA 4LDWA 3OYFA 5CKDA 2O4XB 3EFOB 1K73R 2B8AA 1M1KU 5L23A 1T3LA 2X35A 3R6OA 3TSWA 2DBMA 2Y4YA 4C5IA 4M78A 1ZUUA 1Y96B 3BE3A 3NGPA 4AFQC 8ATCB 2Y90A 2DVEA 3SFMA 2COYA 1KQ2A 3UATA 1VQKT 5I2MA 5GMKi 2L2PA 2DJZA 5IHKA 2MWPA 2MOXA 2AK5A 5LJ5d 2CT3A 2JTEA 4O6JA 3OYGA 5I21A 5LJ5f 2KY9A 1TUGB 3CMAA 2LQKA 1GBRA 2EQMA 3VS6A 1WGSA 2ZGWA 5GMKj 4PJOD 1UB4A 3CCMQ 2QEXQ 1FMKA 4FYXB 2KQWA 4C0GA 2NLUA 4ZGJB 1BBZA 4C92B 2P0QA 1OX8A 5IHNA 4LUDA 5HCKA 1BB9A 4BITA 2C0IA 1JEQA 3PGGA 1UGRB 4RTUA 1WLPB 3CCSA 1K9MU 2DZ9A 4PFPA 5EC7A 3MPUB 1C6VX 1QWEA 2DYIA 1YHQT 2R5AA 4PJJA 2YRVA 3OBYA 3KUFA 1JJ2S 1U5SA 1LVKA 3LWHA 3OYCA 1WHHA 4LNPA 3CMET 2RMOA 4IUTA 3G7ZA 1D0XA 2R5MA 4KUDK 2EYQA 2KVUA 4P5NA 2KEAA 3FB9A 4B9WA 1EZZB 2WSEE 2D0NA 1MMNA 2RI3A 2EKHA 3M0TA 4QQGA 4RTYA 4QKUA 4FW2A 4N4GA 2F1LA 1ZLMA 1MNDA 2RO0A 2VXEA 2YLCA 4ME7A 1WYXA 3MEVA 4ZGDB 5J26A 2HJQA 1RAIB 4OGEA 3L2QA 1VQNT 1KQ1A 1OEBA 3BDLA 4A4EA 2QQ9A 2YT6A 2XK0A 3EH1A 1SPKA 4RTVA 3ULRB 3JCMd 3M55A 1GJJA 1ZBXA 3X26B 2J7IA 1YJWQ 3JCMf 2GQIA 1XTDA 4ZN1A 2DTIA 5GJWB 1GBQA 2ZPHB 3M0QA 1NE8A 1UECA 2LT1A 3TVTA 2LQ8A 2PTKA 1RLQC 1VQ5Q 3MKDA 2BIVA 2E70A 5GAN6 1JU5C 2CUBA 4R0KA 4JZ3A 2J6KA 1OZ2A 4PJOF 2ODCI 3O5ZA 3CPWS 2O31A 1PSEA 3CXCP 3FLGA 3REAB 1NLOC 3OYJA 2E10A 4OB3B 3L2VA 1PWTA 1YI2A 3JB9I 2HZYA 4BY6B 5GMKe 4BACA 4BI4A 3CCQQ 3MEUA 1DJ7B 1TUCA 3C4SA 4QVDA 1VQ4A 4OMQA 3OYAA 1JJ2P 4JS4A 1YWPA 2WACA 1YJ9T 1MV3A 1GRIA 2L8DA 3HFNA 3CC2T 1VQ6A 2DE0X 1JJRA 3OYBA 2BKDN 3L1AA 2AZSA 1PCXA 3CCEA 1K1ZA 4D6WA 2LT4A 2EQIA 1JO8A 4R56A 4M75C 2J6OA 1M3BA 2VUBA 2CREA 2DZCA 3QBYA 2DMOA 1R77A 2LQNA 1RI0A 1KHCA 1KD1C 1VQ9A 1N9RA 2GNCA 2CS7A 2O9SA 2YSQA 1QP3A 2RHXA 4LDXA 2HL5C 2XDBA 5HK0A 2MF2A 3PNWC 3HKSA 1BI3A 1KC8U 3CCRA 4KGXB 3G6EA 4Z88A 3FEOA 1YJ9Q 1NJIC 2Y4XA 3L42A 3OQ5A 2CSQA 4E7SA 1OQKA 1Q86C 4KRTA 3MCAB 2DILA 2DD4A 2K3XA 4J7IA 5KYWA 1TUDA 1VQPA 1BU1A 1N6AA 2JUFA 3HL8A 3TQ7P 2YUOA 3V8JA 2M02A 2E64A 2NYSA 3G1JA 1PNJA 4J9GA 3S3NA 4XU2A 2E5KA 2EYYA 4BE0A 5KYNA 1G2BA 2BZXA 4JJDA 2PVOB 4HCKA 2BZYA 5ECAA 2E41A 1QVFA 3UWNA 4BUGA 4V2SA 4XU0A 3M54A 3RMQA 1BKBA 2K2MA 2JNGA 1SHGA 2XICA 4Z02A 2MMPA 5GAN2 2VKNA 2KYBA 4Z89A 5FU7B 4C8QG 1CKAA 1T0HA 2P4RA 5CKEA 2DL3A 2KMTA 4M75E 1U1SA 4E7HA 1I5OB 4JDSA 3M58A 2EFIA 4MZPA 1I81A 3J80E 1UTIA 3LX7A 1YITT 2O01E 3FIFA 1LPLA 3PE0A 2QQRA 1IHVA 4IUQA 2CUDA 4LXCA 1RUWA 4M78B 3FC3A 4LD9K 3OSVA 2EQJA 3TCJA 2HMAA 3PVLA 3I55A 1I4K1 3ASKA 4B9XA 2V1QA 1UGPB 4JRKA 2RA2A 3V8LA 1UE9A 3HHTB 3CD6T 3GLXA 4KT0E 2LJ1A 2ZPFB 1QWFA 5LJ5j 3EHQA 4NL2A 1C1AA 4M77D 1SSHA 2LCSA 1E6GA 1MMAA 1WFWA 1M90U 1TXQA 1B3QA 1WXUA 3M9QA 5LJ3f 5GMKh 2XKOC 4DEXA 4E7JA 1I5LA 3TSZA 5KYYB 1AZEA 5IHIA 1YI2Q 2DL8A 4HKEA 2NWMA 2YUNA 1WDXA 1M1KC 2WQGA 2RPNA 1K8AU 2JS2A 1VQ4Q 4QW2A 2DXUA 1D1AA 3A5ZB 2IVWA 2QG9B 3EFRA 3EG0A 3NMZC 4J6YA 2LRQA 1PD0A 1D0ZA 2DXCA 3CCJA 4ZTJA 3CD6Q 2AT1B 4MMKA 4DOVA 4HT8A 4F7UF 1VQ6Q 4M7DC 2DVJA 3CCEQ 4F04B 4KBMB 4BB7A 3C94A 1PRMC 5DM7R 3REBB 4E7IA 1MHNA 4A54A 1WNLA 4HXJA 3EG3A 4C92D 4FM4B 3M0RA 5FWBA 3GNFB 2DTHA 2DKGA 3TREA 1OX9A 2L89A 4XK8E 2ZPGB 1LCKA 2A3LA 2QGFB 3CBOA 5AYFA 2LC4A 1RAHB 2VXFA 1VQOA 2XU8A 3CCUA 1Q7YU 2DETA 3G6EQ 3JCMc 4M7AE 3EG1A 4OGCA 3L2WA 2OTLT 3UT1A 3RIRA 3MEWA 1K9MC 3UF4A 1VQMT 4Y28E 2AHJB 4KH0B 3G71T 2COWA 5I2SA 2L0AA 2X3XD 5HY6A 1VQPQ 5A0GA 3OYEA 1NJIU 3OY9A 3RERA 4EMHA 2ABLA 1KD1R 2HNIA 4UC4A 1Q86U 2JMCA 2QQBA 1Y7XA 1ZBJA 2DL5A 2ENMA 4M77F 1QVFS 3I35A 3QDRB 1OU9A 4D8KA 2DERA 1JBMA 2C0OA 3UA6A 1J3TA 1VQLA 5GAOr 2KXCA 2L3RA 4PJMA 1E7DA 1JJ2A 2M1HA 1RAAB 2CDTA 2H8HA 5LJ5e 3OMCA 1NJIR 4IUVA 1YWOA 2KGTA 2M9UA 4M7DE 4MDXA 1M30A 4OMPA 1QKXA 2CZ6B 2MPXC 2VWFA 2RM4A 2DO3A 2GTOA 1T0JA 1FX7A 3OB9A 2EJFA 1PC0A 4K11A 1S72T 4WCIA 2DIGA 1JRIA 2F5TX 1SEMA 3PTAA 1Q81U 3QZ9B 3EGDA 4C8QD 2L3PA 4A4KA 3LGFA 2RHUA 4DBFA 2OJ2A 1NPPA 3TU4K 1B34A 1KK7A 4E7ZA 1VQ7A 2L3SA 2KBTA 1ZUKA 3QIIA 2CP3A 4M75G 5D7UA 4ELYC 3HTRA 3LWIA 1EFNA 4KGZB 2BTTA 4PLLA 5KE2A 4BDZA 4HCBA 1OZ3A 3CBMA 2YHTA 1YHQA 4NOYA 2DXBA 3VS3A 1M3AA 1CSKA 3INZA 2PNIA 2AIRB 4XTUA 1ZS9A 2X51A 4PLIA 3CMEA 3SEMA 1AEYA 2KRSA 4HVWA 5GAN3 5KE3A 2FYKA 1KHIA 3CPWA 3S3MA 2CZ1B 1VOMA 1OI1A 3EHRA 3QXEB 2RJCA 3L2ZA 2HQEA 1PM3A 4FIBA 4BE1A 3RKWA 4DBQA 3EG2A 1T3SA 2K57A 4L6V5 1QVFP 4C92E 3CCMT 3CCLA 1MGQA 1QKWA 2FZGB 2HAXA 2QEXT 3JCMe 2QA4A 2VV5A 1VQNA 5DLQE 1AWWA 3RMSA 2QQSA 3S6WA 1YN8A 5GAOp 2JTFA 3H41A 3JB9G 2LQWA 3M0PA 1IRXA 4J6WA 1QP2A 3E1SA 4OMMA 1KC8C 1D1BA 1A0NB 3PMTA 4Y92A 8AT1B 4M4ZA 1SRLA 1O9SA 1JQQA 3PMIA 1V29B 3DLLA 1Z9ZA 1M1KR 1FXXA 2QQAA 3DB3A 4ZN3A 4PNOA 4PK4A 4EDUA 2QK0A 3OYMA 1LJOA 4RUGA 1VQOQ 1EIFA 4RCCA 4OB2B 2K79A 5D6YA 3V7SA 4EMKB 1VUBA 3VS5A 5I22A 3OW2S 3PVQA 3EGXA 3G4SA 1VQ8Q 4J5YA 5GAMg 4WF2A 3QWXX 4C8QF 1RADB 4CC7A 1IHWA 1OOTA 1HYOA 2RQRA 2DRMA 4ATOA 1RI9A 5CKFA 5GAN4 4J83A 1NZ9A 2GCXA 3WXMB 2M0OA 1Y0MA 2KVDA 1TU0B 5GAMe 1UGSB 3OYKA 5CO7A 2EPDA 1PSFA 4M75A 4M7AG 1UJYA 2A7YA 4E7LA 2FPFA 4IKFA 2RD1A 1YCYA 3GIBA 5LJ5h 5A0DA 1VQLQ 1Y07A 3JCMQ 1VIFA 1U8RA 3VS4A 2MAMA 3LYIA 5EG2A 3AHUA 1YJWT 5CAIA 4FT2A 2D9TA 2BE7D 2FRWA 2V8IA 5AT1B 1K9MR 5KYUA 5CIUA 1H9FA 2QXFA 3JCMW 1O75A 4M78D 4ORZA 4J6XA 3M53A 2DJQA 3UPUA 1VQ5T 4PJLA 2DK3A 5A2QE 3H0FA 4E6RA 3RUXA 3OYYA 2KRMA 4QVZA 4BI8B 1Y02A 1B7TA 4J9FA 2CYZB 4MDWA 1FYNA 4HVVA 1QMCA 4M7DG 2XMFA 1VYUA 5FLXE 2KVQG 3CC4Q 3CCQT 2VVKA 3VS1A 1YIJQ 1WHGA 3A8OB 3M4YA 1M90C 1G83A 4WTOB 1PHTA 4IUUA 3ZFJA 2LVMA 2CP2A 1WHJA 3E9FA 1U06A 3FJ5A 4GLMA 3JCMJ 1MMDA 4FSXA 3OW2P 1W6XA 4XTVA 3HRUA 1BI2A 2X4YA 5FU6B 1PKSA 4C8QB 4JZ4A 2HBWA 1GFCA 1WJSA 1IGQA 4FYVB 1AZGB 1K8AC 2DTOA 2MIOA 2K3YA 1UUEA 1X43A 3JCMX 4CI0C 1H1JS 2P84A 4XU1A 2NUPA 1Y71A 2G80A 2YDLA 1RAFB 2DK4A 3CMAT 3C95A 3JCMh 2E6ZA 3A1PA 2COZA 2JMAA 3CCLQ 2O9VA 1YITA 2ECZA 3CC7A 3V8KA 3GF5A 4DA4A 3KFVA 1JEGA 1TTHB 3ZL7C 5LJ3g 3META 1ACMB 3QJYA 4PJOE 1N9SA 4M7AA 2AKKA 5GAMd 2DL7A 1FMWA 2KFVA 5GAMf 4HCCA 1ZX6A 4EIKA 2X4WA 1QVPA 1ZSZA 1Q7YC 1IZ6A 2DX1A 4M78F 2LCLA 5LJ3e 4D8DA 4OMOA 1N8RU 3OYDA 1QW1A 1IO6A 1RACB 3P8HA 1HXDA 2R57A 1BI0A 4IIOA 1A62A 2HDAA 1WIEA 1JXMA 3CMAQ 4PL6A 4C0DC 3LW5E 2PVGB 2LX9A 2YUQA 5CQXA 1PG5B 4J9IA 2JOYA 4FYYB 2OAWA 2VASA 2JTMA 3QYGB 2W10A 1WI7A 2EVRA 3OBWA 2E4HA 3I56A 2EQKA 1B34B 1UGQB 1I8FA 4M7DA 1LOJA 3NTHA 2OI3A 3T9NA 1H3HA 1K9AA 1KC8R 3CCSQ 1KIKA 3SB2A 4JRQA 1NM7A 3EAEA 1Z9QA 3CPWP 1YNSA 4FW1A 2X3WD 1UHFA 4J8OA 3VYGA 1NG2A 3M0UA 3PIOA 1IGUA 2HKQB 3OS1A 4ZGEB 2FHDA 1UGVA 3FDRA 1M2VA 2K6DA 5GAOn 1B07A 2HD0A 2O4XA 2DPPB 5CKHA 2KI7A 3EG9B 1CKBA 2AZVA 2W51A 3BW1A 5GAOq 2ODGC 1Q81C 1Y96A 2JT4A 1X6GA 4RTTA 4J9BA 2E6NA 1G3WA 2RQTA 2J06A 3NTIA 2K9GA 1W2BA 2RJEA 3QZ5B 3SWNC 3H6ZA 4B6MA 4CC4B 3M4GA 2KE9A 3QG1A 1YI2T 2OTJA 2LDMA 5IN1A 5C0MA 3QSUA 5CR2A 2RK1A 1I0CA 1K76A 5DLOA 2V8JA 1VQ4T 1W70A 2EGEA 1TWBA 1GL9B 2W0ZA 2FZKB 1TOVA 3JCMV 2ZPEB 4M7AC 1N5ZA 4PFOA 4C92A 1VQ6T 1OYXA 2CP7A 2M51A 2DXTA 2RHIA 2RNOA 3CCET 1N27A 2EYZA 2X4JA 1HSQA 4Y91A 2JS0A 1ZSZC 5LJ3d 3CCVA 3JB9F 2B86A 1WHKA 2KSSA 1H641 3RR6A 3VRZA 2FPEA 3X25B 1YJNA 3EGXB 1VQ9T 1BIBA 1ZA1B 1XQHA 3U23A 2J05A 4FYWB 3JCMb 2MI6A 3UDCA 1R8OB 2DFUA 4E7KA 3WVEB 2FPDA 1M2OA 1M90R 2DEUA 4JJBA 4UZWA 3CCRT 2VYTA 3G6ET 1YBYA 2DBKA 1K4US 1AHJB 5A0LA 4M75B 3M57A 3L2RA 4N0AC 2NUZA 1OPKA 3J7AF 2CGHA 1NLPC 1X75C 1E7LA 3MO8A 4MZMA 1M3CA 5GAN8 2A8VA 3A8LB 1K8AR 2RHYA 1VQPT 2HSEB 1SRMA 2I0NA 1X6OA 4HT9A 2JM8A 1G3SA 3VS2A 2LD7A 3HP9A 2AKLA 1VQ9Q 1KQSS 2L5QA 4AFUC 1ZA2B 4BD3A 1V1CA 2DF6A 1F1BB 4M77C 1FMVA 1AT1B 2FG0A 3DLMA 2OAUA 1JXOA 1AVZC 3UA7A 2D1XA 1AWXA 2KDSA 3VRYA 5GJVB 4PJOG 3CCRQ 1Q82U 4LDVA 2QAZA 3V7CA 2DYBA 1PD1A 4F7UE 4RTXA 1ABQA 2F5KA 1ABOA 4Q5WA 3H8ZA 3LH5A 3OMGA 1V66A 3OW2A 7AT1B 4XAXB 2LCCA 3VJPA 4JLIA 4J9DA 1YP5A 2O2OA 1D0YA 2YRCA 3R6NA 1BK2A 3HRSA 3CCMA 1YCSB 1Q7YR 1G8XA 1WA7A 2HQHA 3QKJA 3GNGA 3OS2A 2DL4A 2I2LA 4NL3A 1XOVA 3H9NA 4OMLA 3CPFA 3VS0A 2V1RA 1VQKA 2ZCFB 2DA9A 4C92C 3Q1JA 4BDYA 1OPLA 1Q86R 4GBQA 2IIMA 2ROTA 2NUPB 2EW3A 4OP0A 2DM1A 2YWWA 2GGRA 5I11A 1NEBA 4GY5A 1W2BS 5GANf 1M1GA 2MCNA 4LDYA 2WSFE 4IURA 2HL3A 4M77E 3C0CA 3I5RA 3P8BB 2OTJQ 2KRNA 2FVUA 2JM9A 2KROA 4FL6A 4LD6A 1KQSP 5GMKl 2D8HA 4X9CA 2KAFA 5GAMj 1MUZA 1U1TA 2KVEA 3I55Q 2C0TA 3RKYA 3VUZA 3CCJT 2CP0A 2XI9A 1XNIA 4DQ2A 4X9DA 1S1NA 2VC8A 2JN0A 2KT1A 2GFUA 3GP8A 1Q81R 1QCNA 1A63A 2OX7A 2QTVA 5CVIA 1X27A 4MMLA 3CCVQ 4JRIA 2EYWA 1QVGS 1M4ZA 5CCAA 4L5GA 1WQ7A 4PJOA 3JAME 4RG2A 2XD0A 4AMCA 2IPOB 4JRPA 1I1JA 4KUIA 1VQ5A 4F16A 3QDFA 2ED0A 4M7DB 5KYWB 1D1CA 2RF0A 4OB1B 5GAN7 5GAOl 5IXFA 3BFMA 4OVAA 1VQOT 1HD3A 5CKBA 3CCUT 1K0XA 4N4IA 3CBPA 3CCJQ 2KXDA 1K73U 5IAYA 4PFZA 2D8JA 2K3BA 4FT4A 5IXBA 1VQ8T 4RTWA 2VGNA 3OYLA 1N8RC 1WHMA 3CCQA 1A8VA 2F69A 1GL5A 3EH2A 4JJNK 2EAYA 4IIMA 2NUTA 4AG1C 1G3YA 1M2VB 3AT1B 4VUBA 5GAN5 5HK3A 4BY6C 1W2BP 2EGAA 1W4SA 2A37A 4X1VA 5D6WA 1M9SA 1D3BA 4FCYA 4CC3A 2SRCA 2P0PA 4F14A 2XDDA 1VQLT 3CCUQ 1GCPA 4ZTFA 1NEGA 2VB6A 2JZ2A 3DKMA 3VS7A 2R58A 2LC3A 4NS5A 2HEQA 1ZQ1A 3L2UA 2EGCA 4QQDA 2CP6A 1JEIA 1QLYA 3VKIA 3VU3C 1UFFA 2RK2A 4F17A 2YRDA 4TVRA 1RAGB 3SDZA 3H0HA 4X34A 2DEQA 3TEEA 4PKCC 3EGUA 3PFSA 5L8RE 5KYYA 1YJ9A 1WXTA 1QVGP 2LJ3A 4KH1B 3CC2A 4F7UG 5KCOA 1SKUB 3CXCS 3CC4T 2PVDB 2P4TA 5D6XA 1YIJT 5LJ3j 4XTXA 3URGA 9ATCB 1VQ7T 2QASA 1VQKQ
chains in the Genus database with same CATH topology
4PL6A 4C0DC 1M1KC 3LW5E 4C8QE 4RCBA 4HA8A 3CEYA 2PVGB 2QTXA 3A8GB 1K8AU 2LX9A 5CQXA 4QW2A 1WJQA 3ER0A 2RHZA 2DXUA 2JOYA 3FJPA 1WPYA 3NFCA 3CC4A 3A5ZB 3HSBA 3MEAA 1YIJA 2IVWA 2JTMA 3QYGB 5GANh 3EFRA 4J6YA 2LRQA 4ZTJA 2DXCA 3OBWA 3CCJA 4CRIA 3I56A 4MMKA 1YJWA 4DOVA 4HT8A 4F7UF 4PJOC 4C92F 2EQKA 4M7DC 2E1HA 1B34B 1UGQB 1I8FA 3HPWA 4M7DA 3O8VA 3BY7A 2EIFA 1LOJA 4E47A 3NTHA 3T9NA 1LNXA 2HBPA 2BUDA 5LL6S 4KBMB 2FB7A 3SB2A 4BB7A 2E65A 3C94A 3EAEA 5DM7R 4JRQA 4E7IA 3MP8A 3V7RA 1MHNA 4A54A 1BI1A 1WNLA 2PUKB 3QJ6A 3HRTA 4C92D 4A4GA 4J8OA 4FM4B 3VYGA 4OB0B 3PIOA 4M7AE 2YLBA 2XG8D 3GNFB 2RJDA 2DTHA 2DKGA 5KCHA 3TREA 4XTYA 3OS1A 2P0KA 3N5BB 3ZBDA 1P92A 5FU7C 3NTKA 4ZGEB 1VQOA 2L89A 4XK8E 3CCLT 3JCMg 2FHDA 2K5IA 3FDRA 5FU6C 1IREB 4C8QC 2ZPGB 1BYMA 2A3LA 2WSCE 3X20B 4II1A 4IUPA 4JS5A 3CBOA 5AYFA 2LC4A 4C5HA 5GAOn 4MZTA 2VXFA 4DOWA 2XU8A 1X01A 2HD0A 3J81E 2O4XA 2RI2A 3OS5A 4M77G 3CCUA 4RKUE 2DPPB 4M77B 2JVVA 5CKHA 4OGCA 3JCMc 3VV0A 1WQWA 4JUVA 3L2WA 2PQWA 3JRZA 2OTLT 3UT1A 3RIRA 4LDWA 3BW1A 3MEWA 5GAOq 3OYFA 1Q81C 1K9MC 1Y96A 1VQMT 4Y28E 4HCZA 2AHJB 5CKDA 2O4XB 5KH6A 2B8AA 4M75D 3G71T 1M1KU 2E6NA 3OYIA 5I2SA 1G3WA 2E12A 2X35A 3R6OA 3NTIA 5HY6A 1W2BA 4M78C 2Y4YA 4C5IA 4M78A 2RJEA 3QZ5B 3SWNC 5A0GA 1Y96B 3SWNA 3H6ZA 5M9OA 3M4GA 3OYEA 1NJIU 3OY9A 3RERA 2Y90A 1RL2A 3QG1A 1YI2T 2ZPIB 2DVEA 2LDMA 3LH0A 5IN1A 3SFMA 3X28B 2ZZDA 4EMHA 5C0MA 1KQ2A 2HNIA 4UC4A 1Q86U 3QSUA 5DY9A 2RB6A 5CR2A 5I2MA 1VQKT 2RK1A 5GMKi 2QQBA 2OTJA 1Y7XA 2DJZA 4M77F 1QVFS 3QDRB 5DLOA 2MWPA 2V8JA 3X24B 1VQ4T 1JBMA 2C06A 1VQLA 5LJ5d 3G4ST 3S3OA 5GAOr 2L3RA 4O6JA 3OYGA 5I21A 5LJ5f 2KY9A 1JJ2A 3CMAA 2M1HA 5LJ5e 3JCMV 3OMCA 2ZPEB 2LQKA 4IUVA 2M9UA 2XIDA 2EQMA 5IT9E 4M7AC 4F7UA 4MDXA 4M7DE 4C92A 1WGSA 2ZGWA 5GMKj 4PJOD 1VQ6T 1UB4A 1OYXA 3JCMP 2GQVA 3MHXA 3OYNA 2CZ6B 2DXTA 2RHIA 3CCET 1N27A 2RM4A 2X4JA 4Y91A 2DO3A 3CCVA 5LJ3d 3JB9F 3E19A 2KSSA 1Q82C 1H641 2KQWA 4C0GA 2NLUA 4C92G 4ZGJB 3CCST 4C92B 3CD6A 2P0QA 1FX7A 3OB9A 2EJFA 2GF7A 3X25B 1KG1A 1YJNA 5FRMA 1KQSA 1VQ9T 4A53A 1S72T 1BIBA 2DIGA 3WVDB 3PGGA 1TH7A 1UGRB 3A8HB 4EMGA 1XQHA 1JRIA 3OA6A 5GANj 2F5TX 3JCMb 3PTAA 2MI6A 3UDCA 3CCSA 3QZ9B 1JB0E 1R8OB 3JB9D 4XQ3A 1Q81U 1K9MU 2DZ9A 4C8QD 4A4KA 4E7KA 2LTOA 3WVEB 1SSFA 2RHUA 3LGFA 2PUOB 4N4HA 1NPPA 3TU4K 1B34A 1YHQT 2R5AA 4L59A 3CCRT 2VYTA 2YRVA 3G6ET 1VQ7A 1YBYA 3OBYA 3KUFA 4GLKA 1AHJB 3QIIA 1JJ2S 3LWHA 5A0LA 3OYCA 4M75G 4M75B 4ELYC 3LWIA 3M57A 3L2RA 4N0AC 3CMET 5GAMh 4IUTA 4N0AA 3OYHA 4XTZA 4PLLA 5KE2A 4BDZA 1M8VA 4HCBA 1OZ3A 3G7ZA 2R5MA 3CBMA 3J7AF 2YHTA 2CGHA 3VUBA 1X75C 1YHQA 2PU9B 4NOYA 4M78E 3MO8A 2DXBA 4KUDK 5CQYA 2EYQA 4MZMA 5GAN8 2CZ0B 4P5NA 3FB9A 3INZA 4B9WA 3A8LB 4RMOA 2RHYA 1VQPT 2WSEE 4XTUA 1X6OA 4HT9A 1G3SA 4PLIA 2RI3A 3HP9A 3JSCA 3CMEA 1KQSS 2L5QA 4QQGA 5GAN3 4BD3A 5KE3A 3MP6A 3SD4A 1WJRA 2RI5A 4N4GA 2FYKA 2QA4T 1KHIA 4M77C 3CPWA 2DAQA 3S3MA 4M77A 2RO0A 4FU6A 2VXEA 2CZ1B 1OI1A 3DLMA 2OAUA 2X4XA 3LGLA 3QXEB 2RJCA 2YLCA 3MEVA 4ME7A 3L2ZA 2HQEA 4M75F 4ZGDB 4FIBA 2KDSA 5J26A 4BI3A 3RKWA 4BE1A 1H3ZA 2GFAA 4PJOG 4LDUA 4OGEA 4PJOB 3L2QA 1Q82U 4LDVA 1VQNT 1KQ1A 4JLGA 3V7CA 3BDLA 2K57A 4A4EA 4L6V5 2QQ9A 3OSSC 4F7UE 2XK0A 4C92E 2EKOA 2F5KA 3ME9A 4M7AD 4Q5WA 3H8ZA 3QPHA 3M55A 2EQUA 3JCMd 1ZBXA 3CCMT 3CCLA 3OMGA 3X26B 1MGQA 3OW2A 3JCMf 2HAXA 2K5FA 1XTDA 4ZN1A 2QEXT 4XAXB 3JCMe 2DTIA 2LCCA 2QA4A 2ZPHB 4JLIA 3LLRA 3VJPA 2VV5A 1VQNA 3A8MB 5DLQE 1NE8A 2OTLA 2LT1A 3RMSA 2LQ8A 2QQSA 3HRSA 1NPRA 3S6WA 5GAOp 2JTFA 2BIVA 2E70A 2EJGA 5GAN6 3CCMA 3JB9G 2RJFA 1VQMA 4C5GA 3QKJA 4J6WA 1UEBA 1QP2A 3E1SA 3GNGA 3G71A 1KC8C 2XDPA 1OZ2A 4PJOF 3PMTA 3CPWS 3OS2A 2VGMA 5FRNA 1PSEA 1O9SA 3FLGA 3OYJA 2E10A 3KBGA 3PMIA 1V29B 4OB3B 2I2LA 4NL3A 3L2VA 1XOVA 3DLLA 1YI2A 5J39A 2FL7A 4EMKA 1FXXA 2QQAA 3JB9I 3DB3A 4ZN3A 4PNOA 4BY6B 3CPFA 5GMKm 1VQKA 3CC7T 5GMKe 4BACA 4BI4A 2ZCFB 3P8DA 4EDUA 3EFSA 3OYMA 1D3BB 1LJOA 5GANg 3MEUA 2HQXA 1EIFA 3DB4A 4OB2B 1DJ7B 4RCCA 4C92C 1GXIE 1BI0A 3Q1JA 4BDYA 3C4SA 5D6YA 4QVDA 4M7DD 3V7SA 4EMKB 1VUBA 1VQ4A 3RESA 3OYAA 3OW2S 3G4SA 4J5YA 4JS4A 3MP1A 5GAMg 4M7AG 4WF2A 4C0FA 4OP0A 2WACA 4C8QF 1YJ9T 4GY5A 1W2BS 2K2VA 2L8DA 5GANf 1M1GA 2CKKA 3HFNA 1QVGA 3CC2T 1VQ6A 3OYBA 1BIAA 2DD5A 4LDYA 5GANe 4ATOA 2BKDN 2WSFE 5CKFA 4IURA 5GAN4 3L1AA 1K73C 4J83A 1NZ9A 2GCXA 1G5VA 3WXMB 4M77E 3CCEA 3P8BB 4D6WA 2M0OA 2LT4A 2FVUA 2G3RA 2IG0A 4FL6A 1UGSB 5GAMe 2H3JA 4ELZC 4LD6A 3OYKA 5CO7A 4R56A 4M75C 2VUBA 1PSFA 3M5AA 2DZCA 4M75A 4RG8A 4X9CA 3QBYA 2A7YA 2KAFA 5GMKl 1RI0A 2K5LA 4E7LA 1KHCA 5GAMj 1KD1C 2RD1A 1U1TA 1VQ9A 1YCYA 4IKFA 3FRNA 1N9RA 1S72A 3GIBA 5LJ5h 2CS7A 1FWZA 5A0DA 1Y07A 3JCMQ 3RKYA 1QP3A 2RHXA 3VUZA 1G3TA 4LDXA 1VIFA 1U8RA 2XDBA 5HK0A 3CCJT 2MAMA 2MF2A 3LYIA 5GAOm 3I56T 2XI9A 5EG2A 1YJWT 3PNWC 3AHUA 3HKSA 5C6SA 1XNIA 1BI3A 3RKXA 4X9DA 4DQ2A 4FT2A 2VC8A 2D9TA 2JN0A 5CAIA 3KXTA 2GFUA 2V8IA 1M5Q1 1KC8U 3GP8A 3CCRA 3JB9J 3G6EA 4YTLA 5CIUA 2QXFA 3JB9H 3JCMW 5LJ3h 1O75A 3FEOA 4M78D 3PIPA 1NJIC 2Y4XA 5CVIA 2K4YA 4MMLA 3L42A 4J6XA 3M53A 3OQ5A 3UPUA 4BE2A 1VQ5T 4C0DB 3ZEHA 4JRIA 1Q86C 2DK3A 1M4ZA 5A2QE 1QVGS 3MCAB 1VIEA 4L5GA 3RUXA 5CCAA 3OYYA 4QVZA 4M7AF 2DD4A 1WQ7A 4PJOA 2K3XA 4J7IA 3JAME 4RG2A 2XD0A 3OS0A 4QVCA 1Q7YU 2LNVA 3E9GA 1VQPA 1N6AA 4BI8B 2JUFA 3HL8A 4JRPA 4KUIA 4OMFB 1VQ5A 3V8JA 2E64A 2CYZB 3C12A 4MDWA 3S3NA 4M7DG 2XHCA 4XU2A 4XU3A 4M7DB 4J7FA 4BE0A 4O5VA 5FLXE 4OB1B 2KVQG 5GAN7 5GAOl 3CCQT 3BFMA 4OVAA 1VQOT 5CKBA 3CCUT 4N4IA 3CBPA 2PVOB 3A8OB 1K73U 5HKCA 2CZ7B 5IAYA 3M4YA 2E41A 1QVFA 1M90C 4FT4A 3UWNA 4BUGA 1VQ8T 4V2SA 4XU0A 3M54A 3RMQA 2VGNA 1BKBA 3OYLA 4C8QA 4IUUA 3ZFJA 2LVMA 2JNGA 1N8RC 3CCQA 3E9FA 2XICA 2F69A 2DIQA 4Z02A 4EPCA 2D6FA 2MMPA 5GAN2 3QO3A 4FSXA 4KULA 3JCMJ 1KD1U 4JJNK 2EAYA 5FU7B 1ZHIA 4XTVA 4C8QG 2QEXA 3HRUA 1BI2A 1G3YA 2X4YA 4VUBA 5FU6B 4C8QB 1VQ8A 5GAN5 2OTJT 1WJSA 5CKEA 4BY6C 5HK3A 1W4SA 2KK4A 4A4HA 1K8AC 2KMTA 4M7DF 4OF1A 2DTOA 4M75E 1U1SA 4E7HA 5D6WA 1M9SA 1D3BA 2K3YA 4JDSA 5J3BA 3M58A 2EFIA 3JCMX 4MZPA 3QHSA 4EMKC 4CI0C 1I81A 3J80E 2P0PA 3LX7A 1YITT 2O01E 2QI2A 3M56A 3FIFA 3I55T 3CXCA 3GPLA 2XDDA 2QQRA 1VQLT 4XU1A 1Y71A 2ZPBB 4IUQA 5CK9A 5LJ5g 1M1FA 4ZTFA 4R55A 1HK9A 3CMAT 3C95A 4M78G 4A4FA 3JCMh 4M78B 2E6ZA 3FC3A 3SWNB 4LD9K 3OSVA 2EWNA 4C5EA 2JZ2A 3DKMA 4C0ZA 3HFOA 2EJ9A 1YITA 3BDUA 2R58A 2EQJA 3TCJA 3I55A 3CC7A 2QDYB 4NS5A 3V8KA 3GF5A 1ZQ1A 3L2UA 4DA4A 4QQDA 1I4K1 5GANd 3ASKA 4B9XA 3CCVT 2V8KA 3F70A 1UGPB 4JRKA 2RA2A 2E5QA 3V8LA 3VKIA 3VU3C 5LJ3g 3HHTB 3CD6T 3GLXA 4KT0E 3META 3QUIA 3PT9A 2RK2A 2MWOA 2ZPFB 3QJYA 3VYHB 3GOXA 4TVRA 4PJOE 1N9SA 4M7AA 5GAMd 3SDZA 1YJNT 5LJ5j 4X34A 4NL2A 2DEQA 4M77D 3M59A 4PKCC 3TEEA 5GAMf 2M16A 4HCCA 3PFSA 4QQ6A 5L8RE 1YJ9A 2X4WA 1QVPA 3QYHB 1M90U 1Q7YC 3CC2A 4F7UG 1IZ6A 4M7AB 3M9QA 4F7UB 5LJ3f 5GMKh 2D0QB 2XKOC 4M78F 2LCLA 5KCOA 5LJ3e 4E7JA 1N8RU 3OYDA 1QW1A 1I5LA 3CXCS 3CC4T 5FROA 2RH2A 2PVDB 2P4TA 5D6XA 3P8HA 5LJ3j 4XTXA 3URGA 1HXDA 4HKEA 1YIJT 1VQ7T 2R57A 4XTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9G A;  3OMC A;  4PL6 A;  4IUV A;  2QQS A;  3S6W A;  2EQM A;  2JTF A;  2BIV A;  1WGS A;  3CEY A;  1OYX A;  2RJF A;  3S3N A;  4C5G A;  4QW2 A;  1WJQ A;  2RHZ A;  3QKJ A;  2RHI A;  4BE0 A;  1N27 A;  3MEA A;  2XDP A;  1OZ2 A;  4OVA A;  3PMT A;  2LRQ A;  4N4I A;  3OS2 A;  4ZTJ A;  2NLU A;  5FRN A;  4CRI A;  3FLG A;  3OYJ A;  3PMI A;  5IAY A;  3OB9 A;  2GF7 A;  3UWN A;  3L2V A;  5J39 A;  5FRM A;  2EQK A;  3OYL A;  3DB3 A;  2DIG A;  3O8V A;  4IUU A;  2LVM A;  4BAC A;  3P8D A;  4EDU A;  3OYM A;  3E9F A;  3NTH A;  3OA6 A;  2DIQ A;  4Z02 A;  3MEU A;  2HQX A;  3DB4 A;  3Q1J A;  4BDY A;  3C4S A;  2BUD A;  5D6Y A;  4E7K A;  2LTO A;  1SSF A;  2RHU A;  3EAE A;  3LGF A;  4N4H A;  3OYA A;  2X4Y A;  4E7I A;  3MP8 A;  1MHN A;  1WJS A;  3MP1 A;  2R5A A;  3QJ6 A;  4L59 A;  2VYT A;  4A4H A;  2YRV A;  2WAC A;  4A4G A;  3KUF A;  4E7H A;  5D6W A;  4GY5 A;  3QII A;  2K3Y A;  3OYC A;  2EFI A;  2RJD A;  5KCH A;  2L8D A;  2CKK A;  3OS1 A;  2P0K A;  3OYB A;  3L2R A;  3NTK A;  3OYH A;  2L89 A;  2BKD N;  4IUT A;  5KE2 A;  2FHD A;  3LX7 A;  3FDR A;  4IUR A;  4PLL A;  4BDZ A;  1OZ3 A;  2R5M A;  1G5V A;  4II1 A;  4IUP A;  2QQR A;  4C5H A;  2M0O A;  4IUQ A;  3MO8 A;  2O4X A;  2RI2 A;  4ZTF A;  2G3R A;  2IG0 A;  4FL6 A;  4B9W A;  3L2W A;  2RHY A;  2PQW A;  4LD6 A;  4A4F A;  3OYK A;  3UT1 A;  3FC3 A;  3OYN A;  3QBY A;  4E7L A;  1RI0 A;  4C5E A;  2JZ2 A;  1KHC A;  2RI3 A;  3MEW A;  4PLI A;  3OYF A;  4IKF A;  4HCZ A;  4QQG A;  2R58 A;  2EQJ A;  4BD3 A;  5KE3 A;  2O4X B;  3MP6 A;  4NS5 A;  3SD4 A;  1WJR A;  3L2U A;  4QQD A;  5KH6 A;  2B8A A;  3ASK A;  4B9X A;  2RI5 A;  4N4G A;  2E6N A;  3S3M A;  2RHX A;  3F70 A;  2DAQ A;  2X35 A;  3OYI A;  2E5Q A;  2RO0 A;  3NTI A;  4FU6 A;  1OI1 A;  3DLM A;  3MET A;  4C5I A;  2X4X A;  2RJE A;  3LGL A;  3LYI A;  2MWO A;  5M9O A;  3GOX A;  2RJC A;  3H6Z A;  3MEV A;  3PNW C;  1XNI A;  5C6S A;  2HQE A;  3OYE A;  2D9T A;  5J26 A;  3OY9 A;  4BE1 A;  1H3Z A;  2GFU A;  2LDM A;  2GFA A;  3LH0 A;  4X34 A;  5IN1 A;  5C0M A;  3L2Q A;  4UC4 A;  5CIU A;  2M16 A;  3PFS A;  4QQ6 A;  3BDL A;  3FEO A;  4A4E A;  2XK0 A;  2EKO A;  2F5K A;  3L42 A;  2X4W A;  3ME9 A;  3OQ5 A;  4BE2 A;  4Q5W A;  3ZEH A;  3H8Z A;  3M9Q A;  2EQU A;  3OMG A;  2MWP A;  5KCO A;  4E7J A;  3OYD A;  4QVZ A;  3S3O A;  2LCC A;  5FRO A;  2L3R A;  3LLR A;  5D6X A;  2K3X A;  3P8H A;  3OYG A;  4RG2 A;  3OS0 A;  2R57 A;  2M1H A; 
#chains in the Genus database with same CATH topology
 1X69 A;  1U3O A;  2KW9 A;  4C8Q E;  1WJQ A;  2RHZ A;  3FJP A;  2EYX A;  3NFC A;  3MEA A;  1X2K A;  3NHN A;  4CRI A;  2V26 A;  4LN2 A;  4PJO C;  1I07 A;  2E1H A;  3O8V A;  1TS9 A;  4E47 A;  1KJW A;  1W1F A;  1ZUY A;  1Q95 G;  2GBQ A;  2HBP A;  2BUD A;  5LL6 S;  2FB7 A;  3RDV A;  2E65 A;  3I9Q A;  1Y57 A;  3QJ6 A;  2PUK B;  1QQJ A;  4CC2 A;  1VQ7 Q;  3D7S B;  2CSI A;  2RJD A;  5KCH A;  1OV3 A;  4XTY A;  5FU7 C;  3CCL T;  2K5I A;  2BZ8 A;  2WSC E;  3X20 B;  1AWO A;  1BCO A;  1YHQ Q;  2QA4 T;  4MZT A;  4DOW A;  1X01 A;  3J81 E;  4M77 G;  1HJD A;  4RKU E;  2JVV A;  4J9C A;  1WQW A;  5KYX A;  3CME Q;  1E7O A;  4HCZ A;  4JPB W;  2QGG A;  5KH6 A;  4M75 D;  2F2V A;  3OYI A;  2E12 A;  2KT8 A;  4M78 C;  1H9E A;  5M9O A;  3SWN A;  2ED1 A;  2QNF A;  1RL2 A;  2CP5 A;  2ZPI B;  3LH0 A;  3X28 B;  1M8V A;  2ZZD A;  5DY9 A;  2RB6 A;  2DLP A;  4DEY A;  3X24 B;  2LMJ A;  2DNU A;  2C06 A;  3G4S T;  3S3O A;  2QA4 Q;  1VQN Q;  6AT1 B;  5IT9 E;  2XID A;  4F7U A;  1ZBH A;  3JCM P;  2GQV A;  3MHX A;  2A36 A;  3GBQ A;  2RNA A;  3E19 A;  1Q82 C;  3CCS T;  4C92 G;  3CD6 A;  2RN8 A;  1KG1 A;  2GF7 A;  4E2F B;  5FRM A;  1NBE B;  1KQS A;  4A53 A;  2KNB B;  3WVD B;  2FO0 A;  1TH7 A;  3A8H B;  4EMG A;  3OA6 A;  5GAN j;  3JB9 D;  1JB0 E;  4XQ3 A;  1M8M A;  2LTO A;  4N4H A;  1SSF A;  2PUO B;  1NYF A;  2RNN A;  1KFZ A;  2RQV A;  3G4S Q;  4DBH A;  4L59 A;  4HVU A;  4GLK A;  3CQT A;  1N8R R;  1AD5 A;  3EGD B;  2YXY A;  5GAM h;  4N0A A;  3OYH A;  2RQW A;  4XTZ A;  3VUB A;  2JVW A;  2PU9 B;  4M78 E;  1TSF A;  5CQY A;  3NPF A;  2CZ0 B;  4RMO A;  2GTJ A;  3CC2 Q;  3JSC A;  3MP6 A;  3SD4 A;  1WJR A;  2HSP A;  2RI5 A;  4AG2 C;  2DAQ A;  4M77 A;  4FU6 A;  2X4X A;  3LGL A;  5IH2 A;  1GCQ A;  4M75 F;  4BI3 A;  2KR3 A;  4PJN A;  1H3Z A;  1VYT A;  2GFA A;  4LDU A;  4PJO B;  4JLG A;  3EFO A;  4A63 B;  3OSS C;  3RBB B;  1OU8 A;  2EKO A;  3ME9 A;  4M7A D;  3QWY A;  3QPH A;  2EQU A;  3THK A;  1RLP C;  3SHW A;  2K5F A;  2QDL A;  4J9E A;  1UHC A;  4ANJ A;  1GFD A;  3LLR A;  4AFS C;  3A8M B;  2OTL A;  2FRY A;  1NPR A;  5FW9 A;  2EJG A;  2M0Y A;  2RJF A;  4J9H A;  2E3I A;  1VQM A;  1IXD A;  4C5G A;  2X9H A;  2SEM A;  4QT7 A;  1UEB A;  2BE9 B;  3G71 A;  2LP5 A;  2XDP A;  2CH4 A;  2VGM A;  5FRN A;  4ZNX A;  2JW4 A;  1EN7 A;  3KBG A;  2NUT B;  5J39 A;  2FL7 A;  4EMK A;  2LZ6 B;  5GMK m;  2QYZ A;  3CC7 T;  3I5S A;  3P8D A;  3EFS A;  1D3B B;  5GAN g;  4LE9 A;  2HQX A;  3DB4 A;  1GXI E;  2FZC B;  4M7D D;  2L3Q A;  2JJ9 A;  2K7A A;  1H8K A;  3MJX A;  3RES A;  3MP1 A;  1TG0 A;  4C0F A;  1UJ0 A;  3M0S A;  1NYG A;  2K2V A;  2CKK A;  1QVG A;  1UDL A;  1BIA A;  2DD5 A;  5GAN e;  1K73 C;  1G5V A;  2LX7 A;  3H0I A;  3RNJ A;  1M27 C;  2A0F B;  2G3R A;  2IG0 A;  2DRK A;  2H3J A;  4ELZ C;  3M5A A;  1YFN A;  4RG8 A;  3OYN A;  1YNZ A;  2K5L A;  1WXB A;  3FRN A;  1S72 A;  1ZSG A;  1YIT Q;  3CC7 Q;  1FWZ A;  2KYM A;  2QNC A;  1G3T A;  5GAO m;  3I56 T;  5C6S A;  3RKX A;  3KXT A;  1X6B A;  1M5Q 1;  3JB9 J;  3JB9 H;  4YTL A;  5LJ3 h;  4OMN A;  3PIP A;  2K4Y A;  2F2W A;  1RAE B;  4BE2 A;  2A08 A;  4C0D B;  3ZEH A;  2RQU A;  2Z0W A;  1VIE A;  5KYU B;  2MK5 A;  4M7A F;  1RAB B;  3OS0 A;  4LUE A;  4QVC A;  1H92 A;  2LNV A;  3E9G A;  1MV0 B;  1GCQ C;  4OMF B;  1VYV A;  3C12 A;  1QCF A;  1SF9 A;  2XHC A;  3IQL A;  4JJC A;  4XU3 A;  4J7F A;  4O5V A;  2MPH A;  1UG1 A;  2CT4 A;  1KSW A;  3JV3 A;  3I56 Q;  4Z8A A;  5HKC A;  2CZ7 B;  1IB8 A;  2ESW A;  4C8Q A;  2F2X A;  1MMG A;  2DIQ A;  4EPC A;  2D6F A;  1D09 B;  3QO3 A;  4KUL A;  1KD1 U;  3A98 A;  1BCM A;  1Q82 R;  1ZHI A;  2QEX A;  3L0O A;  1VA7 A;  2A28 A;  1VQ8 A;  1V76 A;  2OTJ T;  2ATC B;  2KK4 A;  4A4H A;  2LNH B;  4OF1 A;  4M7D F;  4KGV B;  5J3B A;  2JXB A;  2HKN A;  5KYX B;  3QHS A;  4EMK C;  1PRL C;  2G6F X;  2QI2 A;  3M56 A;  3GPL A;  3I55 T;  3CXC A;  2O88 A;  2EBP A;  2ZPB B;  5CK9 A;  5LJ5 g;  1M1F A;  1K0S A;  4R55 A;  1HK9 A;  1AWJ A;  4M78 G;  4A4F A;  3SWN B;  2EWN A;  4C5E A;  4C0Z A;  3HFO A;  2EJ9 A;  2LJ0 A;  3BDU A;  2J6F A;  2QDY B;  5GAN d;  3CCV T;  2V8K A;  3F70 A;  2E5Q A;  1MNE A;  3QUI A;  2OTL Q;  3PT9 A;  2MWO A;  3VYH B;  3GOX A;  1X2Q A;  1E6H A;  1R0C B;  1YJN T;  1VQM Q;  3M59 A;  2M16 A;  4QQ6 A;  4ESR A;  3G71 Q;  3QYH B;  4M7A B;  1QCO A;  4F7U B;  2D0Q B;  1WZO A;  5FRO A;  2RH2 A;  1SHF A;  1ZSZ B;  2CH4 W;  4XTW A;  1C0M A;  2ZAE A;  4HA8 A;  4RCB A;  3CEY A;  4AFZ C;  2E3H A;  2QTX A;  2YUP A;  3A8G B;  3ER0 A;  1R0B G;  1SG5 A;  1WPY A;  3CC4 A;  3HSB A;  1YIJ A;  5GAN h;  2FEI A;  1EX4 A;  1WHL A;  1YJW A;  1WX6 A;  2MYS A;  4C92 F;  1PKT A;  1YJN Q;  3HPW A;  3BY7 A;  2EIF A;  1GKU B;  1LNX A;  2HCK A;  1AOJ A;  1ARK A;  1OUL A;  3MP8 A;  3V7R A;  1BI1 A;  1S72 Q;  3HRT A;  4RTZ A;  4A4G A;  4OB0 B;  4FSS A;  1XJW B;  2YLB A;  2XG8 D;  4AT1 B;  2P0K A;  3N5B B;  3EG9 A;  3ZBD A;  1P92 A;  3NTK A;  3E2U A;  3JCM g;  5FU6 C;  4C8Q C;  1BYM A;  1IRE B;  5FWC A;  2H3E B;  4DBR A;  4II1 A;  4IUP A;  4JS5 A;  4C5H A;  2PZ1 A;  2ROL A;  2RI2 A;  3OS5 A;  4M77 B;  3VV0 A;  4JUV A;  2PQW A;  3JRZ A;  4LDW A;  3OYF A;  5CKD A;  2O4X B;  3EFO B;  1K73 R;  2B8A A;  1M1K U;  5L23 A;  1T3L A;  2X35 A;  3R6O A;  3TSW A;  2DBM A;  2Y4Y A;  4C5I A;  4M78 A;  1ZUU A;  1Y96 B;  3BE3 A;  3NGP A;  4AFQ C;  8ATC B;  2Y90 A;  2DVE A;  3SFM A;  2COY A;  1KQ2 A;  3UAT A;  1VQK T;  5I2M A;  5GMK i;  2L2P A;  2DJZ A;  5IHK A;  2MWP A;  2MOX A;  2AK5 A;  5LJ5 d;  2CT3 A;  2JTE A;  4O6J A;  3OYG A;  5I21 A;  5LJ5 f;  2KY9 A;  1TUG B;  3CMA A;  2LQK A;  1GBR A;  2EQM A;  3VS6 A;  1WGS A;  2ZGW A;  5GMK j;  4PJO D;  1UB4 A;  3CCM Q;  2QEX Q;  1FMK A;  4FYX B;  2KQW A;  4C0G A;  2NLU A;  4ZGJ B;  1BBZ A;  4C92 B;  2P0Q A;  1OX8 A;  5IHN A;  4LUD A;  5HCK A;  1BB9 A;  4BIT A;  2C0I A;  1JEQ A;  3PGG A;  1UGR B;  4RTU A;  1WLP B;  3CCS A;  1K9M U;  2DZ9 A;  4PFP A;  5EC7 A;  3MPU B;  1C6V X;  1QWE A;  2DYI A;  1YHQ T;  2R5A A;  4PJJ A;  2YRV A;  3OBY A;  3KUF A;  1JJ2 S;  1U5S A;  1LVK A;  3LWH A;  3OYC A;  1WHH A;  4LNP A;  3CME T;  2RMO A;  4IUT A;  3G7Z A;  1D0X A;  2R5M A;  4KUD K;  2EYQ A;  2KVU A;  4P5N A;  2KEA A;  3FB9 A;  4B9W A;  1EZZ B;  2WSE E;  2D0N A;  1MMN A;  2RI3 A;  2EKH A;  3M0T A;  4QQG A;  4RTY A;  4QKU A;  4FW2 A;  4N4G A;  2F1L A;  1ZLM A;  1MND A;  2RO0 A;  2VXE A;  2YLC A;  4ME7 A;  1WYX A;  3MEV A;  4ZGD B;  5J26 A;  2HJQ A;  1RAI B;  4OGE A;  3L2Q A;  1VQN T;  1KQ1 A;  1OEB A;  3BDL A;  4A4E A;  2QQ9 A;  2YT6 A;  2XK0 A;  3EH1 A;  1SPK A;  4RTV A;  3ULR B;  3JCM d;  3M55 A;  1GJJ A;  1ZBX A;  3X26 B;  2J7I A;  1YJW Q;  3JCM f;  2GQI A;  1XTD A;  4ZN1 A;  2DTI A;  5GJW B;  1GBQ A;  2ZPH B;  3M0Q A;  1NE8 A;  1UEC A;  2LT1 A;  3TVT A;  2LQ8 A;  2PTK A;  1RLQ C;  1VQ5 Q;  3MKD A;  2BIV A;  2E70 A;  5GAN 6;  1JU5 C;  2CUB A;  4R0K A;  4JZ3 A;  2J6K A;  1OZ2 A;  4PJO F;  2ODC I;  3O5Z A;  3CPW S;  2O31 A;  1PSE A;  3CXC P;  3FLG A;  3REA B;  1NLO C;  3OYJ A;  2E10 A;  4OB3 B;  3L2V A;  1PWT A;  1YI2 A;  3JB9 I;  2HZY A;  4BY6 B;  5GMK e;  4BAC A;  4BI4 A;  3CCQ Q;  3MEU A;  1DJ7 B;  1TUC A;  3C4S A;  4QVD A;  1VQ4 A;  4OMQ A;  3OYA A;  1JJ2 P;  4JS4 A;  1YWP A;  2WAC A;  1YJ9 T;  1MV3 A;  1GRI A;  2L8D A;  3HFN A;  3CC2 T;  1VQ6 A;  2DE0 X;  1JJR A;  3OYB A;  2BKD N;  3L1A A;  2AZS A;  1PCX A;  3CCE A;  1K1Z A;  4D6W A;  2LT4 A;  2EQI A;  1JO8 A;  4R56 A;  4M75 C;  2J6O A;  1M3B A;  2VUB A;  2CRE A;  2DZC A;  3QBY A;  2DMO A;  1R77 A;  2LQN A;  1RI0 A;  1KHC A;  1KD1 C;  1VQ9 A;  1N9R A;  2GNC A;  2CS7 A;  2O9S A;  2YSQ A;  1QP3 A;  2RHX A;  4LDX A;  2HL5 C;  2XDB A;  5HK0 A;  2MF2 A;  3PNW C;  3HKS A;  1BI3 A;  1KC8 U;  3CCR A;  4KGX B;  3G6E A;  4Z88 A;  3FEO A;  1YJ9 Q;  1NJI C;  2Y4X A;  3L42 A;  3OQ5 A;  2CSQ A;  4E7S A;  1OQK A;  1Q86 C;  4KRT A;  3MCA B;  2DIL A;  2DD4 A;  2K3X A;  4J7I A;  5KYW A;  1TUD A;  1VQP A;  1BU1 A;  1N6A A;  2JUF A;  3HL8 A;  3TQ7 P;  2YUO A;  3V8J A;  2M02 A;  2E64 A;  2NYS A;  3G1J A;  1PNJ A;  4J9G A;  3S3N A;  4XU2 A;  2E5K A;  2EYY A;  4BE0 A;  5KYN A;  1G2B A;  2BZX A;  4JJD A;  2PVO B;  4HCK A;  2BZY A;  5ECA A;  2E41 A;  1QVF A;  3UWN A;  4BUG A;  4V2S A;  4XU0 A;  3M54 A;  3RMQ A;  1BKB A;  2K2M A;  2JNG A;  1SHG A;  2XIC A;  4Z02 A;  2MMP A;  5GAN 2;  2VKN A;  2KYB A;  4Z89 A;  5FU7 B;  4C8Q G;  1CKA A;  1T0H A;  2P4R A;  5CKE A;  2DL3 A;  2KMT A;  4M75 E;  1U1S A;  4E7H A;  1I5O B;  4JDS A;  3M58 A;  2EFI A;  4MZP A;  1I81 A;  3J80 E;  1UTI A;  3LX7 A;  1YIT T;  2O01 E;  3FIF A;  1LPL A;  3PE0 A;  2QQR A;  1IHV A;  4IUQ A;  2CUD A;  4LXC A;  1RUW A;  4M78 B;  3FC3 A;  4LD9 K;  3OSV A;  2EQJ A;  3TCJ A;  2HMA A;  3PVL A;  3I55 A;  1I4K 1;  3ASK A;  4B9X A;  2V1Q A;  1UGP B;  4JRK A;  2RA2 A;  3V8L A;  1UE9 A;  3HHT B;  3CD6 T;  3GLX A;  4KT0 E;  2LJ1 A;  2ZPF B;  1QWF A;  5LJ5 j;  3EHQ A;  4NL2 A;  1C1A A;  4M77 D;  1SSH A;  2LCS A;  1E6G A;  1MMA A;  1WFW A;  1M90 U;  1TXQ A;  1B3Q A;  1WXU A;  3M9Q A;  5LJ3 f;  5GMK h;  2XKO C;  4DEX A;  4E7J A;  1I5L A;  3TSZ A;  5KYY B;  1AZE A;  5IHI A;  1YI2 Q;  2DL8 A;  4HKE A;  2NWM A;  2YUN A;  1WDX A;  1M1K C;  2WQG A;  2RPN A;  1K8A U;  2JS2 A;  1VQ4 Q;  4QW2 A;  2DXU A;  1D1A A;  3A5Z B;  2IVW A;  2QG9 B;  3EFR A;  3EG0 A;  3NMZ C;  4J6Y A;  2LRQ A;  1PD0 A;  1D0Z A;  2DXC A;  3CCJ A;  4ZTJ A;  3CD6 Q;  2AT1 B;  4MMK A;  4DOV A;  4HT8 A;  4F7U F;  1VQ6 Q;  4M7D C;  2DVJ A;  3CCE Q;  4F04 B;  4KBM B;  4BB7 A;  3C94 A;  1PRM C;  5DM7 R;  3REB B;  4E7I A;  1MHN A;  4A54 A;  1WNL A;  4HXJ A;  3EG3 A;  4C92 D;  4FM4 B;  3M0R A;  5FWB A;  3GNF B;  2DTH A;  2DKG A;  3TRE A;  1OX9 A;  2L89 A;  4XK8 E;  2ZPG B;  1LCK A;  2A3L A;  2QGF B;  3CBO A;  5AYF A;  2LC4 A;  1RAH B;  2VXF A;  1VQO A;  2XU8 A;  3CCU A;  1Q7Y U;  2DET A;  3G6E Q;  3JCM c;  4M7A E;  3EG1 A;  4OGC A;  3L2W A;  2OTL T;  3UT1 A;  3RIR A;  3MEW A;  1K9M C;  3UF4 A;  1VQM T;  4Y28 E;  2AHJ B;  4KH0 B;  3G71 T;  2COW A;  5I2S A;  2L0A A;  2X3X D;  5HY6 A;  1VQP Q;  5A0G A;  3OYE A;  1NJI U;  3OY9 A;  3RER A;  4EMH A;  2ABL A;  1KD1 R;  2HNI A;  4UC4 A;  1Q86 U;  2JMC A;  2QQB A;  1Y7X A;  1ZBJ A;  2DL5 A;  2ENM A;  4M77 F;  1QVF S;  3I35 A;  3QDR B;  1OU9 A;  4D8K A;  2DER A;  1JBM A;  2C0O A;  3UA6 A;  1J3T A;  1VQL A;  5GAO r;  2KXC A;  2L3R A;  4PJM A;  1E7D A;  1JJ2 A;  2M1H A;  1RAA B;  2CDT A;  2H8H A;  5LJ5 e;  3OMC A;  1NJI R;  4IUV A;  1YWO A;  2KGT A;  2M9U A;  4M7D E;  4MDX A;  1M30 A;  4OMP A;  1QKX A;  2CZ6 B;  2MPX C;  2VWF A;  2RM4 A;  2DO3 A;  2GTO A;  1T0J A;  1FX7 A;  3OB9 A;  2EJF A;  1PC0 A;  4K11 A;  1S72 T;  4WCI A;  2DIG A;  1JRI A;  2F5T X;  1SEM A;  3PTA A;  1Q81 U;  3QZ9 B;  3EGD A;  4C8Q D;  2L3P A;  4A4K A;  3LGF A;  2RHU A;  4DBF A;  2OJ2 A;  1NPP A;  3TU4 K;  1B34 A;  1KK7 A;  4E7Z A;  1VQ7 A;  2L3S A;  2KBT A;  1ZUK A;  3QII A;  2CP3 A;  4M75 G;  5D7U A;  4ELY C;  3HTR A;  3LWI A;  1EFN A;  4KGZ B;  2BTT A;  4PLL A;  5KE2 A;  4BDZ A;  4HCB A;  1OZ3 A;  3CBM A;  2YHT A;  1YHQ A;  4NOY A;  2DXB A;  3VS3 A;  1M3A A;  1CSK A;  3INZ A;  2PNI A;  2AIR B;  4XTU A;  1ZS9 A;  2X51 A;  4PLI A;  3CME A;  3SEM A;  1AEY A;  2KRS A;  4HVW A;  5GAN 3;  5KE3 A;  2FYK A;  1KHI A;  3CPW A;  3S3M A;  2CZ1 B;  1VOM A;  1OI1 A;  3EHR A;  3QXE B;  2RJC A;  3L2Z A;  2HQE A;  1PM3 A;  4FIB A;  4BE1 A;  3RKW A;  4DBQ A;  3EG2 A;  1T3S A;  2K57 A;  4L6V 5;  1QVF P;  4C92 E;  3CCM T;  3CCL A;  1MGQ A;  1QKW A;  2FZG B;  2HAX A;  2QEX T;  3JCM e;  2QA4 A;  2VV5 A;  1VQN A;  5DLQ E;  1AWW A;  3RMS A;  2QQS A;  3S6W A;  1YN8 A;  5GAO p;  2JTF A;  3H41 A;  3JB9 G;  2LQW A;  3M0P A;  1IRX A;  4J6W A;  1QP2 A;  3E1S A;  4OMM A;  1KC8 C;  1D1B A;  1A0N B;  3PMT A;  4Y92 A;  8AT1 B;  4M4Z A;  1SRL A;  1O9S A;  1JQQ A;  3PMI A;  1V29 B;  3DLL A;  1Z9Z A;  1M1K R;  1FXX A;  2QQA A;  3DB3 A;  4ZN3 A;  4PNO A;  4PK4 A;  4EDU A;  2QK0 A;  3OYM A;  1LJO A;  4RUG A;  1VQO Q;  1EIF A;  4RCC A;  4OB2 B;  2K79 A;  5D6Y A;  3V7S A;  4EMK B;  1VUB A;  3VS5 A;  5I22 A;  3OW2 S;  3PVQ A;  3EGX A;  3G4S A;  1VQ8 Q;  4J5Y A;  5GAM g;  4WF2 A;  3QWX X;  4C8Q F;  1RAD B;  4CC7 A;  1IHW A;  1OOT A;  1HYO A;  2RQR A;  2DRM A;  4ATO A;  1RI9 A;  5CKF A;  5GAN 4;  4J83 A;  1NZ9 A;  2GCX A;  3WXM B;  2M0O A;  1Y0M A;  2KVD A;  1TU0 B;  5GAM e;  1UGS B;  3OYK A;  5CO7 A;  2EPD A;  1PSF A;  4M75 A;  4M7A G;  1UJY A;  2A7Y A;  4E7L A;  2FPF A;  4IKF A;  2RD1 A;  1YCY A;  3GIB A;  5LJ5 h;  5A0D A;  1VQL Q;  1Y07 A;  3JCM Q;  1VIF A;  1U8R A;  3VS4 A;  2MAM A;  3LYI A;  5EG2 A;  3AHU A;  1YJW T;  5CAI A;  4FT2 A;  2D9T A;  2BE7 D;  2FRW A;  2V8I A;  5AT1 B;  1K9M R;  5KYU A;  5CIU A;  1H9F A;  2QXF A;  3JCM W;  1O75 A;  4M78 D;  4ORZ A;  4J6X A;  3M53 A;  2DJQ A;  3UPU A;  1VQ5 T;  4PJL A;  2DK3 A;  5A2Q E;  3H0F A;  4E6R A;  3RUX A;  3OYY A;  2KRM A;  4QVZ A;  4BI8 B;  1Y02 A;  1B7T A;  4J9F A;  2CYZ B;  4MDW A;  1FYN A;  4HVV A;  1QMC A;  4M7D G;  2XMF A;  1VYU A;  5FLX E;  2KVQ G;  3CC4 Q;  3CCQ T;  2VVK A;  3VS1 A;  1YIJ Q;  1WHG A;  3A8O B;  3M4Y A;  1M90 C;  1G83 A;  4WTO B;  1PHT A;  4IUU A;  3ZFJ A;  2LVM A;  2CP2 A;  1WHJ A;  3E9F A;  1U06 A;  3FJ5 A;  4GLM A;  3JCM J;  1MMD A;  4FSX A;  3OW2 P;  1W6X A;  4XTV A;  3HRU A;  1BI2 A;  2X4Y A;  5FU6 B;  1PKS A;  4C8Q B;  4JZ4 A;  2HBW A;  1GFC A;  1WJS A;  1IGQ A;  4FYV B;  1AZG B;  1K8A C;  2DTO A;  2MIO A;  2K3Y A;  1UUE A;  1X43 A;  3JCM X;  4CI0 C;  1H1J S;  2P84 A;  4XU1 A;  2NUP A;  1Y71 A;  2G80 A;  2YDL A;  1RAF B;  2DK4 A;  3CMA T;  3C95 A;  3JCM h;  2E6Z A;  3A1P A;  2COZ A;  2JMA A;  3CCL Q;  2O9V A;  1YIT A;  2ECZ A;  3CC7 A;  3V8K A;  3GF5 A;  4DA4 A;  3KFV A;  1JEG A;  1TTH B;  3ZL7 C;  5LJ3 g;  3MET A;  1ACM B;  3QJY A;  4PJO E;  1N9S A;  4M7A A;  2AKK A;  5GAM d;  2DL7 A;  1FMW A;  2KFV A;  5GAM f;  4HCC A;  1ZX6 A;  4EIK A;  2X4W A;  1QVP A;  1ZSZ A;  1Q7Y C;  1IZ6 A;  2DX1 A;  4M78 F;  2LCL A;  5LJ3 e;  4D8D A;  4OMO A;  1N8R U;  3OYD A;  1QW1 A;  1IO6 A;  1RAC B;  3P8H A;  1HXD A;  2R57 A;  1BI0 A;  4IIO A;  1A62 A;  2HDA A;  1WIE A;  1JXM A;  3CMA Q;  4PL6 A;  4C0D C;  3LW5 E;  2PVG B;  2LX9 A;  2YUQ A;  5CQX A;  1PG5 B;  4J9I A;  2JOY A;  4FYY B;  2OAW A;  2VAS A;  2JTM A;  3QYG B;  2W10 A;  1WI7 A;  2EVR A;  3OBW A;  2E4H A;  3I56 A;  2EQK A;  1B34 B;  1UGQ B;  1I8F A;  4M7D A;  1LOJ A;  3NTH A;  2OI3 A;  3T9N A;  1H3H A;  1K9A A;  1KC8 R;  3CCS Q;  1KIK A;  3SB2 A;  4JRQ A;  1NM7 A;  3EAE A;  1Z9Q A;  3CPW P;  1YNS A;  4FW1 A;  2X3W D;  1UHF A;  4J8O A;  3VYG A;  1NG2 A;  3M0U A;  3PIO A;  1IGU A;  2HKQ B;  3OS1 A;  4ZGE B;  2FHD A;  1UGV A;  3FDR A;  1M2V A;  2K6D A;  5GAO n;  1B07 A;  2HD0 A;  2O4X A;  2DPP B;  5CKH A;  2KI7 A;  3EG9 B;  1CKB A;  2AZV A;  2W51 A;  3BW1 A;  5GAO q;  2ODG C;  1Q81 C;  1Y96 A;  2JT4 A;  1X6G A;  4RTT A;  4J9B A;  2E6N A;  1G3W A;  2RQT A;  2J06 A;  3NTI A;  2K9G A;  1W2B A;  2RJE A;  3QZ5 B;  3SWN C;  3H6Z A;  4B6M A;  4CC4 B;  3M4G A;  2KE9 A;  3QG1 A;  1YI2 T;  2OTJ A;  2LDM A;  5IN1 A;  5C0M A;  3QSU A;  5CR2 A;  2RK1 A;  1I0C A;  1K76 A;  5DLO A;  2V8J A;  1VQ4 T;  1W70 A;  2EGE A;  1TWB A;  1GL9 B;  2W0Z A;  2FZK B;  1TOV A;  3JCM V;  2ZPE B;  4M7A C;  1N5Z A;  4PFO A;  4C92 A;  1VQ6 T;  1OYX A;  2CP7 A;  2M51 A;  2DXT A;  2RHI A;  2RNO A;  3CCE T;  1N27 A;  2EYZ A;  2X4J A;  1HSQ A;  4Y91 A;  2JS0 A;  1ZSZ C;  5LJ3 d;  3CCV A;  3JB9 F;  2B86 A;  1WHK A;  2KSS A;  1H64 1;  3RR6 A;  3VRZ A;  2FPE A;  3X25 B;  1YJN A;  3EGX B;  1VQ9 T;  1BIB A;  1ZA1 B;  1XQH A;  3U23 A;  2J05 A;  4FYW B;  3JCM b;  2MI6 A;  3UDC A;  1R8O B;  2DFU A;  4E7K A;  3WVE B;  2FPD A;  1M2O A;  1M90 R;  2DEU A;  4JJB A;  4UZW A;  3CCR T;  2VYT A;  3G6E T;  1YBY A;  2DBK A;  1K4U S;  1AHJ B;  5A0L A;  4M75 B;  3M57 A;  3L2R A;  4N0A C;  2NUZ A;  1OPK A;  3J7A F;  2CGH A;  1NLP C;  1X75 C;  1E7L A;  3MO8 A;  4MZM A;  1M3C A;  5GAN 8;  2A8V A;  3A8L B;  1K8A R;  2RHY A;  1VQP T;  2HSE B;  1SRM A;  2I0N A;  1X6O A;  4HT9 A;  2JM8 A;  1G3S A;  3VS2 A;  2LD7 A;  3HP9 A;  2AKL A;  1VQ9 Q;  1KQS S;  2L5Q A;  4AFU C;  1ZA2 B;  4BD3 A;  1V1C A;  2DF6 A;  1F1B B;  4M77 C;  1FMV A;  1AT1 B;  2FG0 A;  3DLM A;  2OAU A;  1JXO A;  1AVZ C;  3UA7 A;  2D1X A;  1AWX A;  2KDS A;  3VRY A;  5GJV B;  4PJO G;  3CCR Q;  1Q82 U;  4LDV A;  2QAZ A;  3V7C A;  2DYB A;  1PD1 A;  4F7U E;  4RTX A;  1ABQ A;  2F5K A;  1ABO A;  4Q5W A;  3H8Z A;  3LH5 A;  3OMG A;  1V66 A;  3OW2 A;  7AT1 B;  4XAX B;  2LCC A;  3VJP A;  4JLI A;  4J9D A;  1YP5 A;  2O2O A;  1D0Y A;  2YRC A;  3R6N A;  1BK2 A;  3HRS A;  3CCM A;  1YCS B;  1Q7Y R;  1G8X A;  1WA7 A;  2HQH A;  3QKJ A;  3GNG A;  3OS2 A;  2DL4 A;  2I2L A;  4NL3 A;  1XOV A;  3H9N A;  4OML A;  3CPF A;  3VS0 A;  2V1R A;  1VQK A;  2ZCF B;  2DA9 A;  4C92 C;  3Q1J A;  4BDY A;  1OPL A;  1Q86 R;  4GBQ A;  2IIM A;  2ROT A;  2NUP B;  2EW3 A;  4OP0 A;  2DM1 A;  2YWW A;  2GGR A;  5I11 A;  1NEB A;  4GY5 A;  1W2B S;  5GAN f;  1M1G A;  2MCN A;  4LDY A;  2WSF E;  4IUR A;  2HL3 A;  4M77 E;  3C0C A;  3I5R A;  3P8B B;  2OTJ Q;  2KRN A;  2FVU A;  2JM9 A;  2KRO A;  4FL6 A;  4LD6 A;  1KQS P;  5GMK l;  2D8H A;  4X9C A;  2KAF A;  5GAM j;  1MUZ A;  1U1T A;  2KVE A;  3I55 Q;  2C0T A;  3RKY A;  3VUZ A;  3CCJ T;  2CP0 A;  2XI9 A;  1XNI A;  4DQ2 A;  4X9D A;  1S1N A;  2VC8 A;  2JN0 A;  2KT1 A;  2GFU A;  3GP8 A;  1Q81 R;  1QCN A;  1A63 A;  2OX7 A;  2QTV A;  5CVI A;  1X27 A;  4MML A;  3CCV Q;  4JRI A;  2EYW A;  1QVG S;  1M4Z A;  5CCA A;  4L5G A;  1WQ7 A;  4PJO A;  3JAM E;  4RG2 A;  2XD0 A;  4AMC A;  2IPO B;  4JRP A;  1I1J A;  4KUI A;  1VQ5 A;  4F16 A;  3QDF A;  2ED0 A;  4M7D B;  5KYW B;  1D1C A;  2RF0 A;  4OB1 B;  5GAN 7;  5GAO l;  5IXF A;  3BFM A;  4OVA A;  1VQO T;  1HD3 A;  5CKB A;  3CCU T;  1K0X A;  4N4I A;  3CBP A;  3CCJ Q;  2KXD A;  1K73 U;  5IAY A;  4PFZ A;  2D8J A;  2K3B A;  4FT4 A;  5IXB A;  1VQ8 T;  4RTW A;  2VGN A;  3OYL A;  1N8R C;  1WHM A;  3CCQ A;  1A8V A;  2F69 A;  1GL5 A;  3EH2 A;  4JJN K;  2EAY A;  4IIM A;  2NUT A;  4AG1 C;  1G3Y A;  1M2V B;  3AT1 B;  4VUB A;  5GAN 5;  5HK3 A;  4BY6 C;  1W2B P;  2EGA A;  1W4S A;  2A37 A;  4X1V A;  5D6W A;  1M9S A;  1D3B A;  4FCY A;  4CC3 A;  2SRC A;  2P0P A;  4F14 A;  2XDD A;  1VQL T;  3CCU Q;  1GCP A;  4ZTF A;  1NEG A;  2VB6 A;  2JZ2 A;  3DKM A;  3VS7 A;  2R58 A;  2LC3 A;  4NS5 A;  2HEQ A;  1ZQ1 A;  3L2U A;  2EGC A;  4QQD A;  2CP6 A;  1JEI A;  1QLY A;  3VKI A;  3VU3 C;  1UFF A;  2RK2 A;  4F17 A;  2YRD A;  4TVR A;  1RAG B;  3SDZ A;  3H0H A;  4X34 A;  2DEQ A;  3TEE A;  4PKC C;  3EGU A;  3PFS A;  5L8R E;  5KYY A;  1YJ9 A;  1WXT A;  1QVG P;  2LJ3 A;  4KH1 B;  3CC2 A;  4F7U G;  5KCO A;  1SKU B;  3CXC S;  3CC4 T;  2PVD B;  2P4T A;  5D6X A;  1YIJ T;  5LJ3 j;  4XTX A;  3URG A;  9ATC B;  1VQ7 T;  2QAS A;  1VQK Q; 
#chains in the Genus database with same CATH homology
 4PL6 A;  4C0D C;  1M1K C;  3LW5 E;  4C8Q E;  4RCB A;  4HA8 A;  3CEY A;  2PVG B;  2QTX A;  3A8G B;  1K8A U;  2LX9 A;  5CQX A;  4QW2 A;  1WJQ A;  3ER0 A;  2RHZ A;  2DXU A;  2JOY A;  3FJP A;  1WPY A;  3NFC A;  3CC4 A;  3A5Z B;  3HSB A;  3MEA A;  1YIJ A;  2IVW A;  2JTM A;  3QYG B;  5GAN h;  3EFR A;  4J6Y A;  2LRQ A;  4ZTJ A;  2DXC A;  3OBW A;  3CCJ A;  4CRI A;  3I56 A;  4MMK A;  1YJW A;  4DOV A;  4HT8 A;  4F7U F;  4PJO C;  4C92 F;  2EQK A;  4M7D C;  2E1H A;  1B34 B;  1UGQ B;  1I8F A;  3HPW A;  4M7D A;  3O8V A;  3BY7 A;  2EIF A;  1LOJ A;  4E47 A;  3NTH A;  3T9N A;  1LNX A;  2HBP A;  2BUD A;  5LL6 S;  4KBM B;  2FB7 A;  3SB2 A;  4BB7 A;  2E65 A;  3C94 A;  3EAE A;  5DM7 R;  4JRQ A;  4E7I A;  3MP8 A;  3V7R A;  1MHN A;  4A54 A;  1BI1 A;  1WNL A;  2PUK B;  3QJ6 A;  3HRT A;  4C92 D;  4A4G A;  4J8O A;  4FM4 B;  3VYG A;  4OB0 B;  3PIO A;  4M7A E;  2YLB A;  2XG8 D;  3GNF B;  2RJD A;  2DTH A;  2DKG A;  5KCH A;  3TRE A;  4XTY A;  3OS1 A;  2P0K A;  3N5B B;  3ZBD A;  1P92 A;  5FU7 C;  3NTK A;  4ZGE B;  1VQO A;  2L89 A;  4XK8 E;  3CCL T;  3JCM g;  2FHD A;  2K5I A;  3FDR A;  5FU6 C;  1IRE B;  4C8Q C;  2ZPG B;  1BYM A;  2A3L A;  2WSC E;  3X20 B;  4II1 A;  4IUP A;  4JS5 A;  3CBO A;  5AYF A;  2LC4 A;  4C5H A;  5GAO n;  4MZT A;  2VXF A;  4DOW A;  2XU8 A;  1X01 A;  2HD0 A;  3J81 E;  2O4X A;  2RI2 A;  3OS5 A;  4M77 G;  3CCU A;  4RKU E;  2DPP B;  4M77 B;  2JVV A;  5CKH A;  4OGC A;  3JCM c;  3VV0 A;  1WQW A;  4JUV A;  3L2W A;  2PQW A;  3JRZ A;  2OTL T;  3UT1 A;  3RIR A;  4LDW A;  3BW1 A;  3MEW A;  5GAO q;  3OYF A;  1Q81 C;  1K9M C;  1Y96 A;  1VQM T;  4Y28 E;  4HCZ A;  2AHJ B;  5CKD A;  2O4X B;  5KH6 A;  2B8A A;  4M75 D;  3G71 T;  1M1K U;  2E6N A;  3OYI A;  5I2S A;  1G3W A;  2E12 A;  2X35 A;  3R6O A;  3NTI A;  5HY6 A;  1W2B A;  4M78 C;  2Y4Y A;  4C5I A;  4M78 A;  2RJE A;  3QZ5 B;  3SWN C;  5A0G A;  1Y96 B;  3SWN A;  3H6Z A;  5M9O A;  3M4G A;  3OYE A;  1NJI U;  3OY9 A;  3RER A;  2Y90 A;  1RL2 A;  3QG1 A;  1YI2 T;  2ZPI B;  2DVE A;  2LDM A;  3LH0 A;  5IN1 A;  3SFM A;  3X28 B;  2ZZD A;  4EMH A;  5C0M A;  1KQ2 A;  2HNI A;  4UC4 A;  1Q86 U;  3QSU A;  5DY9 A;  2RB6 A;  5CR2 A;  5I2M A;  1VQK T;  2RK1 A;  5GMK i;  2QQB A;  2OTJ A;  1Y7X A;  2DJZ A;  4M77 F;  1QVF S;  3QDR B;  5DLO A;  2MWP A;  2V8J A;  3X24 B;  1VQ4 T;  1JBM A;  2C06 A;  1VQL A;  5LJ5 d;  3G4S T;  3S3O A;  5GAO r;  2L3R A;  4O6J A;  3OYG A;  5I21 A;  5LJ5 f;  2KY9 A;  1JJ2 A;  3CMA A;  2M1H A;  5LJ5 e;  3JCM V;  3OMC A;  2ZPE B;  2LQK A;  4IUV A;  2M9U A;  2XID A;  2EQM A;  5IT9 E;  4M7A C;  4F7U A;  4MDX A;  4M7D E;  4C92 A;  1WGS A;  2ZGW A;  5GMK j;  4PJO D;  1VQ6 T;  1UB4 A;  1OYX A;  3JCM P;  2GQV A;  3MHX A;  3OYN A;  2CZ6 B;  2DXT A;  2RHI A;  3CCE T;  1N27 A;  2RM4 A;  2X4J A;  4Y91 A;  2DO3 A;  3CCV A;  5LJ3 d;  3JB9 F;  3E19 A;  2KSS A;  1Q82 C;  1H64 1;  2KQW A;  4C0G A;  2NLU A;  4C92 G;  4ZGJ B;  3CCS T;  4C92 B;  3CD6 A;  2P0Q A;  1FX7 A;  3OB9 A;  2EJF A;  2GF7 A;  3X25 B;  1KG1 A;  1YJN A;  5FRM A;  1KQS A;  1VQ9 T;  4A53 A;  1S72 T;  1BIB A;  2DIG A;  3WVD B;  3PGG A;  1TH7 A;  1UGR B;  3A8H B;  4EMG A;  1XQH A;  1JRI A;  3OA6 A;  5GAN j;  2F5T X;  3JCM b;  3PTA A;  2MI6 A;  3UDC A;  3CCS A;  3QZ9 B;  1JB0 E;  1R8O B;  3JB9 D;  4XQ3 A;  1Q81 U;  1K9M U;  2DZ9 A;  4C8Q D;  4A4K A;  4E7K A;  2LTO A;  3WVE B;  1SSF A;  2RHU A;  3LGF A;  2PUO B;  4N4H A;  1NPP A;  3TU4 K;  1B34 A;  1YHQ T;  2R5A A;  4L59 A;  3CCR T;  2VYT A;  2YRV A;  3G6E T;  1VQ7 A;  1YBY A;  3OBY A;  3KUF A;  4GLK A;  1AHJ B;  3QII A;  1JJ2 S;  3LWH A;  5A0L A;  3OYC A;  4M75 G;  4M75 B;  4ELY C;  3LWI A;  3M57 A;  3L2R A;  4N0A C;  3CME T;  5GAM h;  4IUT A;  4N0A A;  3OYH A;  4XTZ A;  4PLL A;  5KE2 A;  4BDZ A;  1M8V A;  4HCB A;  1OZ3 A;  3G7Z A;  2R5M A;  3CBM A;  3J7A F;  2YHT A;  2CGH A;  3VUB A;  1X75 C;  1YHQ A;  2PU9 B;  4NOY A;  4M78 E;  3MO8 A;  2DXB A;  4KUD K;  5CQY A;  2EYQ A;  4MZM A;  5GAN 8;  2CZ0 B;  4P5N A;  3FB9 A;  3INZ A;  4B9W A;  3A8L B;  4RMO A;  2RHY A;  1VQP T;  2WSE E;  4XTU A;  1X6O A;  4HT9 A;  1G3S A;  4PLI A;  2RI3 A;  3HP9 A;  3JSC A;  3CME A;  1KQS S;  2L5Q A;  4QQG A;  5GAN 3;  4BD3 A;  5KE3 A;  3MP6 A;  3SD4 A;  1WJR A;  2RI5 A;  4N4G A;  2FYK A;  2QA4 T;  1KHI A;  4M77 C;  3CPW A;  2DAQ A;  3S3M A;  4M77 A;  2RO0 A;  4FU6 A;  2VXE A;  2CZ1 B;  1OI1 A;  3DLM A;  2OAU A;  2X4X A;  3LGL A;  3QXE B;  2RJC A;  2YLC A;  3MEV A;  4ME7 A;  3L2Z A;  2HQE A;  4M75 F;  4ZGD B;  4FIB A;  2KDS A;  5J26 A;  4BI3 A;  3RKW A;  4BE1 A;  1H3Z A;  2GFA A;  4PJO G;  4LDU A;  4OGE A;  4PJO B;  3L2Q A;  1Q82 U;  4LDV A;  1VQN T;  1KQ1 A;  4JLG A;  3V7C A;  3BDL A;  2K57 A;  4A4E A;  4L6V 5;  2QQ9 A;  3OSS C;  4F7U E;  2XK0 A;  4C92 E;  2EKO A;  2F5K A;  3ME9 A;  4M7A D;  4Q5W A;  3H8Z A;  3QPH A;  3M55 A;  2EQU A;  3JCM d;  1ZBX A;  3CCM T;  3CCL A;  3OMG A;  3X26 B;  1MGQ A;  3OW2 A;  3JCM f;  2HAX A;  2K5F A;  1XTD A;  4ZN1 A;  2QEX T;  4XAX B;  3JCM e;  2DTI A;  2LCC A;  2QA4 A;  2ZPH B;  4JLI A;  3LLR A;  3VJP A;  2VV5 A;  1VQN A;  3A8M B;  5DLQ E;  1NE8 A;  2OTL A;  2LT1 A;  3RMS A;  2LQ8 A;  2QQS A;  3HRS A;  1NPR A;  3S6W A;  5GAO p;  2JTF A;  2BIV A;  2E70 A;  2EJG A;  5GAN 6;  3CCM A;  3JB9 G;  2RJF A;  1VQM A;  4C5G A;  3QKJ A;  4J6W A;  1UEB A;  1QP2 A;  3E1S A;  3GNG A;  3G71 A;  1KC8 C;  2XDP A;  1OZ2 A;  4PJO F;  3PMT A;  3CPW S;  3OS2 A;  2VGM A;  5FRN A;  1PSE A;  1O9S A;  3FLG A;  3OYJ A;  2E10 A;  3KBG A;  3PMI A;  1V29 B;  4OB3 B;  2I2L A;  4NL3 A;  3L2V A;  1XOV A;  3DLL A;  1YI2 A;  5J39 A;  2FL7 A;  4EMK A;  1FXX A;  2QQA A;  3JB9 I;  3DB3 A;  4ZN3 A;  4PNO A;  4BY6 B;  3CPF A;  5GMK m;  1VQK A;  3CC7 T;  5GMK e;  4BAC A;  4BI4 A;  2ZCF B;  3P8D A;  4EDU A;  3EFS A;  3OYM A;  1D3B B;  1LJO A;  5GAN g;  3MEU A;  2HQX A;  1EIF A;  3DB4 A;  4OB2 B;  1DJ7 B;  4RCC A;  4C92 C;  1GXI E;  1BI0 A;  3Q1J A;  4BDY A;  3C4S A;  5D6Y A;  4QVD A;  4M7D D;  3V7S A;  4EMK B;  1VUB A;  1VQ4 A;  3RES A;  3OYA A;  3OW2 S;  3G4S A;  4J5Y A;  4JS4 A;  3MP1 A;  5GAM g;  4M7A G;  4WF2 A;  4C0F A;  4OP0 A;  2WAC A;  4C8Q F;  1YJ9 T;  4GY5 A;  1W2B S;  2K2V A;  2L8D A;  5GAN f;  1M1G A;  2CKK A;  3HFN A;  1QVG A;  3CC2 T;  1VQ6 A;  3OYB A;  1BIA A;  2DD5 A;  4LDY A;  5GAN e;  4ATO A;  2BKD N;  2WSF E;  5CKF A;  4IUR A;  5GAN 4;  3L1A A;  1K73 C;  4J83 A;  1NZ9 A;  2GCX A;  1G5V A;  3WXM B;  4M77 E;  3CCE A;  3P8B B;  4D6W A;  2M0O A;  2LT4 A;  2FVU A;  2G3R A;  2IG0 A;  4FL6 A;  1UGS B;  5GAM e;  2H3J A;  4ELZ C;  4LD6 A;  3OYK A;  5CO7 A;  4R56 A;  4M75 C;  2VUB A;  1PSF A;  3M5A A;  2DZC A;  4M75 A;  4RG8 A;  4X9C A;  3QBY A;  2A7Y A;  2KAF A;  5GMK l;  1RI0 A;  2K5L A;  4E7L A;  1KHC A;  5GAM j;  1KD1 C;  2RD1 A;  1U1T A;  1VQ9 A;  1YCY A;  4IKF A;  3FRN A;  1N9R A;  1S72 A;  3GIB A;  5LJ5 h;  2CS7 A;  1FWZ A;  5A0D A;  1Y07 A;  3JCM Q;  3RKY A;  1QP3 A;  2RHX A;  3VUZ A;  1G3T A;  4LDX A;  1VIF A;  1U8R A;  2XDB A;  5HK0 A;  3CCJ T;  2MAM A;  2MF2 A;  3LYI A;  5GAO m;  3I56 T;  2XI9 A;  5EG2 A;  1YJW T;  3PNW C;  3AHU A;  3HKS A;  5C6S A;  1XNI A;  1BI3 A;  3RKX A;  4X9D A;  4DQ2 A;  4FT2 A;  2VC8 A;  2D9T A;  2JN0 A;  5CAI A;  3KXT A;  2GFU A;  2V8I A;  1M5Q 1;  1KC8 U;  3GP8 A;  3CCR A;  3JB9 J;  3G6E A;  4YTL A;  5CIU A;  2QXF A;  3JB9 H;  3JCM W;  5LJ3 h;  1O75 A;  3FEO A;  4M78 D;  3PIP A;  1NJI C;  2Y4X A;  5CVI A;  2K4Y A;  4MML A;  3L42 A;  4J6X A;  3M53 A;  3OQ5 A;  3UPU A;  4BE2 A;  1VQ5 T;  4C0D B;  3ZEH A;  4JRI A;  1Q86 C;  2DK3 A;  1M4Z A;  5A2Q E;  1QVG S;  3MCA B;  1VIE A;  4L5G A;  3RUX A;  5CCA A;  3OYY A;  4QVZ A;  4M7A F;  2DD4 A;  1WQ7 A;  4PJO A;  2K3X A;  4J7I A;  3JAM E;  4RG2 A;  2XD0 A;  3OS0 A;  4QVC A;  1Q7Y U;  2LNV A;  3E9G A;  1VQP A;  1N6A A;  4BI8 B;  2JUF A;  3HL8 A;  4JRP A;  4KUI A;  4OMF B;  1VQ5 A;  3V8J A;  2E64 A;  2CYZ B;  3C12 A;  4MDW A;  3S3N A;  4M7D G;  2XHC A;  4XU2 A;  4XU3 A;  4M7D B;  4J7F A;  4BE0 A;  4O5V A;  5FLX E;  4OB1 B;  2KVQ G;  5GAN 7;  5GAO l;  3CCQ T;  3BFM A;  4OVA A;  1VQO T;  5CKB A;  3CCU T;  4N4I A;  3CBP A;  2PVO B;  3A8O B;  1K73 U;  5HKC A;  2CZ7 B;  5IAY A;  3M4Y A;  2E41 A;  1QVF A;  1M90 C;  4FT4 A;  3UWN A;  4BUG A;  1VQ8 T;  4V2S A;  4XU0 A;  3M54 A;  3RMQ A;  2VGN A;  1BKB A;  3OYL A;  4C8Q A;  4IUU A;  3ZFJ A;  2LVM A;  2JNG A;  1N8R C;  3CCQ A;  3E9F A;  2XIC A;  2F69 A;  2DIQ A;  4Z02 A;  4EPC A;  2D6F A;  2MMP A;  5GAN 2;  3QO3 A;  4FSX A;  4KUL A;  3JCM J;  1KD1 U;  4JJN K;  2EAY A;  5FU7 B;  1ZHI A;  4XTV A;  4C8Q G;  2QEX A;  3HRU A;  1BI2 A;  1G3Y A;  2X4Y A;  4VUB A;  5FU6 B;  4C8Q B;  1VQ8 A;  5GAN 5;  2OTJ T;  1WJS A;  5CKE A;  4BY6 C;  5HK3 A;  1W4S A;  2KK4 A;  4A4H A;  1K8A C;  2KMT A;  4M7D F;  4OF1 A;  2DTO A;  4M75 E;  1U1S A;  4E7H A;  5D6W A;  1M9S A;  1D3B A;  2K3Y A;  4JDS A;  5J3B A;  3M58 A;  2EFI A;  3JCM X;  4MZP A;  3QHS A;  4EMK C;  4CI0 C;  1I81 A;  3J80 E;  2P0P A;  3LX7 A;  1YIT T;  2O01 E;  2QI2 A;  3M56 A;  3FIF A;  3I55 T;  3CXC A;  3GPL A;  2XDD A;  2QQR A;  1VQL T;  4XU1 A;  1Y71 A;  2ZPB B;  4IUQ A;  5CK9 A;  5LJ5 g;  1M1F A;  4ZTF A;  4R55 A;  1HK9 A;  3CMA T;  3C95 A;  4M78 G;  4A4F A;  3JCM h;  4M78 B;  2E6Z A;  3FC3 A;  3SWN B;  4LD9 K;  3OSV A;  2EWN A;  4C5E A;  2JZ2 A;  3DKM A;  4C0Z A;  3HFO A;  2EJ9 A;  1YIT A;  3BDU A;  2R58 A;  2EQJ A;  3TCJ A;  3I55 A;  3CC7 A;  2QDY B;  4NS5 A;  3V8K A;  3GF5 A;  1ZQ1 A;  3L2U A;  4DA4 A;  4QQD A;  1I4K 1;  5GAN d;  3ASK A;  4B9X A;  3CCV T;  2V8K A;  3F70 A;  1UGP B;  4JRK A;  2RA2 A;  2E5Q A;  3V8L A;  3VKI A;  3VU3 C;  5LJ3 g;  3HHT B;  3CD6 T;  3GLX A;  4KT0 E;  3MET A;  3QUI A;  3PT9 A;  2RK2 A;  2MWO A;  2ZPF B;  3QJY A;  3VYH B;  3GOX A;  4TVR A;  4PJO E;  1N9S A;  4M7A A;  5GAM d;  3SDZ A;  1YJN T;  5LJ5 j;  4X34 A;  4NL2 A;  2DEQ A;  4M77 D;  3M59 A;  4PKC C;  3TEE A;  5GAM f;  2M16 A;  4HCC A;  3PFS A;  4QQ6 A;  5L8R E;  1YJ9 A;  2X4W A;  1QVP A;  3QYH B;  1M90 U;  1Q7Y C;  3CC2 A;  4F7U G;  1IZ6 A;  4M7A B;  3M9Q A;  4F7U B;  5LJ3 f;  5GMK h;  2D0Q B;  2XKO C;  4M78 F;  2LCL A;  5KCO A;  5LJ3 e;  4E7J A;  1N8R U;  3OYD A;  1QW1 A;  1I5L A;  3CXC S;  3CC4 T;  5FRO A;  2RH2 A;  2PVD B;  2P4T A;  5D6X A;  3P8H A;  5LJ3 j;  4XTX A;  3URG A;  1HXD A;  4HKE A;  1YIJ T;  1VQ7 T;  2R57 A;  4XTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...