1KHRA

Crystal structure of vat(d) in complex with virginiamycin and coenzyme a
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
206
structure length
206
Chain Sequence
MGPNPMKMYPIEGNKSVQFIKPILEKLENVEVGEYSYYDSKNGETFDKQILYHYPILNDKLKIGKFCSIGPGVTIIMNGANHRMDGSTYPFNLFGNGWEKHMPKLDQLPIKGDTIIGNDVWIGKDVVIMPGVKIGDGAIVAANSVVVKDIAPYMLAGGNPANEIKQRFDQDTINQLLDIKWWNWPIDIINENIDKILDNSIIREVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Vat(D): an acetyltransferase that inactivates streptogramin group A antibiotics.
pubmed doi rcsb
molecule keywords STREPTOGRAMIN A ACETYLTRANSFERASE
molecule tags Transferase/antibiotic
source organism Enterococcus faecium
total genus 60
structure length 206
sequence length 206
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.-:
pdb deposition date 2001-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 1khrA00
1MR9A 3R5CA 1QRLA 3BFPA 3TIOA 5AFUV 1YP3A 3TDTA 3VBPA 1G95A 2RIJA 4HUSA 4H7OA 3EEVA 1Z90A 3KWDA 1HM9A 2IU8A 3GOSA 3ST8A 4E6TA 4J18A 5F42A 3FSXA 4KQLA 2WLDA 2QIVX 5L6VA 1QRGA 2V0IA 2FKOA 4EAAA 1TDTA 2W0VA 4AA7A 3OW5A 3BSSA 4HCQA 4FCEA 3VBMA 1KQAA 2I5KA 3C8VA 3I3AA 3NZ2A 3FS8A 1QRFA 4ISXA 4M99A 4EA9A 3DHOA 3FSYA 3R5AA 3EH0A 2OI7A 1KRRA 4KPZA 1MRLA 1QRMA 3R5DA 4M28A 4R37A 3SPTA 2JF3A 4G3PA 4M2BA 2Q4JA 3D98A 5E3PA 5DEMA 2NPOA 3DJ4A 3IXCA 2W0WA 5ADXU 2JF2A 5U2KA 1QREA 4KPXA 1KRUA 3I3XA 2OI6A 3DK5A 5DEPA 2GGOA 3BXYA 3VBIA 1HV9A 2QIAA 3BSYA 2IUAA 4IHFA 1MR7A 4E1KA 3R1WA 4E6UA 3TISA 5E3QA 3V4EA 5ADXV 1SSTA 1XHDA 2WLFA 3R8YA 1FWYA 3VBLA 2QKXA 3Q1XA 3HSQA 3VBJA 4DCLA 3FSBA 2P2OA 4N6BA 3D8VA 2V0KA 1KGTA 3R3IA 2ICXA 2WLGA 3FWWA 2VHEA 4HZDA 1S80A 4EA8A 2IU9A 2OEGA 3KWEA 3P47A 3SRTA 4KNRA 3GVDA 4HURA 3T57A 3BRKX 3ECTA 4E75A 1KHRA 1KK6A 4R36A 4MZUA 2AQ9A 1YP4A 4EGGA 1J2ZA 4IHHA 3P1BA 4G3SA 4M9CA 4K6RA 1T3DA 1KK4A 1V67A 3PMOA 1OCXA 1YP2A 1SSQA 2ICYA 2VD4A 4N6AA 5DG3A 3VBNA 3MQGA 4AC3A 4E79A 4J09A 3KWCA 3GUEA 1SSMA 3CJ8A 1QQ0A 1KRVA 3BSWA 2IC7A 1V3WA 1HM8A 1G97A 3FTTA 4M2AA 3VNPA 4EQYA 4R7PA 1LXAA 5E3RA 3VBKA 2V0HA 3HJJA 4HZCA 2WLCA 4MYOA 1KGQA 5L6SA 3R0SA 2XATA 2OEFA 3TWDA 4G3QA 4MFGA 4KNXA 5AFUU 3TK8A 4IHGA 1FXJA 4N27A 3IGJA 2WLEA 3TV0A 2V0JA 4N69A 1XATA 1HM0A 3JQYA 2GGQA 3R2WA 3R3RA 3FSCA 3OTZA 3OU9A 1KK5A 3FOQA 2TDTA 3F1XA 4G87A 4M98A 4EA7A 1THJA 3R5BA 2V0LA 3EG4A 3MC4A 3MQHA 3OTMA 3OUPA 4AAWA 2OI5A 4EABA
chains in the Genus database with same CATH superfamily
1MR9A 3R5CA 1QRLA 3BFPA 3TIOA 5AFUV 1YP3A 3TDTA 3VBPA 1G95A 2RIJA 4HUSA 4H7OA 3EEVA 1Z90A 3OH0A 3SUCA 3KWDA 1HM9A 2IU8A 3GOSA 3ST8A 4E6TA 4J18A 5F42A 3FSXA 4KQLA 2WLDA 3OH4A 2QIVX 5L6VA 1QRGA 2V0IA 1EWWA 2FKOA 4EAAA 1TDTA 2W0VA 4AA7A 3OW5A 3BSSA 4HCQA 4FCEA 3VBMA 1KQAA 2I5KA 3C8VA 3I3AA 3NZ2A 3FS8A 1QRFA 4ISXA 4M99A 4EA9A 3DHOA 3FSYA 3R5AA 3EH0A 2OI7A 1KRRA 4KPZA 1MRLA 1QRMA 3R5DA 4M28A 4R37A 3SPTA 2JF3A 4G3PA 4M2BA 2Q4JA 3D98A 5E3PA 5DEMA 2NPOA 3DJ4A 3IXCA 2W0WA 5ADXU 2JF2A 5U2KA 1QREA 4KPXA 1KRUA 3I3XA 2OI6A 3DK5A 5DEPA 2GGOA 3BXYA 3VBIA 1HV9A 2QIAA 3BSYA 2IUAA 4IHFA 1MR7A 3GQ7A 4E1KA 3R1WA 4E6UA 3TISA 5E3QA 3V4EA 5ADXV 1SSTA 1XHDA 2WLFA 3OH2A 1L0SA 3R8YA 1FWYA 3VBLA 2QKXA 3Q1XA 3HSQA 3OH1A 3VBJA 4DCLA 3FSBA 2P2OA 4N6BA 3D8VA 2V0KA 1KGTA 3R3IA 2ICXA 2WLGA 3FWWA 2VHEA 4HZDA 1S80A 4EA8A 2IU9A 2OEGA 3GQAA 3KWEA 3OGZA 3P47A 3SRTA 4KNRA 3GVDA 3OH3A 4HURA 3T57A 3BRKX 3ECTA 4E75A 1KHRA 1KK6A 4R36A 3GQ9A 4MZUA 2AQ9A 1YP4A 4EGGA 1J2ZA 4IHHA 3P1BA 4G3SA 4M9CA 1N4IA 4K6RA 1T3DA 1KK4A 1V67A 3PMOA 1OCXA 1YP2A 1SSQA 2ICYA 2VD4A 4N6AA 5DG3A 3VBNA 3MQGA 4AC3A 4E79A 4J09A 3KWCA 3GUEA 1SSMA 3CJ8A 1QQ0A 1KRVA 3BSWA 2IC7A 1V3WA 1HM8A 1G97A 3FTTA 4M2AA 3VNPA 4EQYA 4R7PA 1LXAA 5E3RA 3VBKA 2V0HA 3HJJA 4HZCA 2WLCA 4MYOA 1KGQA 5L6SA 3R0SA 2XATA 1Z2FA 2OEFA 3TWDA 4G3QA 4MFGA 4KNXA 5AFUU 3TK8A 4IHGA 1FXJA 4N27A 3IGJA 2WLEA 3TV0A 2V0JA 4N69A 1XATA 1HM0A 3JQYA 2GGQA 3GQ8A 3R2WA 3R3RA 1M8NA 3FSCA 3OTZA 3OU9A 1KK5A 3FOQA 2TDTA 3F1XA 4G87A 4M98A 4EA7A 1THJA 3R5BA 2V0LA 3EG4A 3MC4A 3MQHA 3OTMA 3OUPA 4AAWA 2OI5A 4EABA
chains in the Genus database with same CATH topology
1MR9A 3R5CA 1QRLA 3BFPA 3TIOA 5AFUV 1YP3A 3TDTA 3VBPA 1G95A 2RIJA 4HUSA 4H7OA 3EEVA 1Z90A 3KWDA 1HM9A 2IU8A 3GOSA 3ST8A 4E6TA 4J18A 5F42A 3FSXA 4KQLA 2WLDA 2QIVX 5L6VA 1QRGA 2V0IA 2FKOA 4EAAA 1TDTA 2W0VA 4AA7A 3OW5A 3BSSA 4HCQA 4FCEA 3VBMA 1KQAA 2I5KA 3C8VA 3I3AA 3NZ2A 3FS8A 1QRFA 4ISXA 4M99A 4EA9A 3DHOA 3FSYA 3R5AA 3EH0A 2OI7A 1KRRA 4KPZA 1MRLA 1QRMA 3R5DA 4M28A 4R37A 3SPTA 2JF3A 4G3PA 4M2BA 2Q4JA 3D98A 5E3PA 5DEMA 2NPOA 3DJ4A 3IXCA 2W0WA 5ADXU 2JF2A 5U2KA 1QREA 4KPXA 1KRUA 3I3XA 2OI6A 3DK5A 5DEPA 2GGOA 3BXYA 3VBIA 1HV9A 2QIAA 3BSYA 2IUAA 4IHFA 1MR7A 4E1KA 3R1WA 4E6UA 3TISA 5E3QA 3V4EA 5ADXV 1SSTA 1XHDA 2WLFA 3R8YA 1FWYA 3VBLA 2QKXA 3Q1XA 3HSQA 3VBJA 4DCLA 3FSBA 2P2OA 4N6BA 3D8VA 2V0KA 1KGTA 3R3IA 2ICXA 2WLGA 3FWWA 2VHEA 4HZDA 1S80A 4EA8A 2IU9A 2OEGA 3KWEA 3P47A 3SRTA 4KNRA 3GVDA 4HURA 3T57A 3BRKX 3ECTA 4E75A 1KHRA 1KK6A 4R36A 4MZUA 2AQ9A 1YP4A 4EGGA 1J2ZA 4IHHA 3P1BA 4G3SA 4M9CA 4K6RA 1T3DA 1KK4A 1V67A 3PMOA 1OCXA 1YP2A 1SSQA 2ICYA 2VD4A 4N6AA 5DG3A 3VBNA 3MQGA 4AC3A 4E79A 4J09A 3KWCA 3GUEA 1SSMA 3CJ8A 1QQ0A 1KRVA 3BSWA 2IC7A 1V3WA 1HM8A 1G97A 3FTTA 4M2AA 3VNPA 4EQYA 4R7PA 1LXAA 5E3RA 3VBKA 2V0HA 3HJJA 4HZCA 2WLCA 4MYOA 1KGQA 5L6SA 3R0SA 2XATA 2OEFA 3TWDA 4G3QA 4MFGA 4KNXA 5AFUU 3TK8A 4IHGA 1FXJA 4N27A 3IGJA 2WLEA 3TV0A 2V0JA 4N69A 1XATA 1HM0A 3JQYA 2GGQA 3R2WA 3R3RA 3FSCA 3OTZA 3OU9A 1KK5A 3FOQA 2TDTA 3F1XA 4G87A 4M98A 4EA7A 1THJA 3R5BA 2V0LA 3EG4A 3MC4A 3MQHA 3OTMA 3OUPA 4AAWA 2OI5A 4EABA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MR9 A;  3R5C A;  1QRL A;  3BFP A;  3TIO A;  5AFU V;  1YP3 A;  3TDT A;  3VBP A;  1G95 A;  2RIJ A;  4HUS A;  4H7O A;  3EEV A;  1Z90 A;  3KWD A;  1HM9 A;  2IU8 A;  3GOS A;  3ST8 A;  4E6T A;  4J18 A;  5F42 A;  3FSX A;  4KQL A;  2WLD A;  2QIV X;  5L6V A;  1QRG A;  2V0I A;  2FKO A;  4EAA A;  1TDT A;  2W0V A;  4AA7 A;  3OW5 A;  3BSS A;  4HCQ A;  4FCE A;  3VBM A;  1KQA A;  2I5K A;  3C8V A;  3I3A A;  3NZ2 A;  3FS8 A;  1QRF A;  4ISX A;  4M99 A;  4EA9 A;  3DHO A;  3FSY A;  3R5A A;  3EH0 A;  2OI7 A;  1KRR A;  4KPZ A;  1MRL A;  1QRM A;  3R5D A;  4M28 A;  4R37 A;  3SPT A;  2JF3 A;  4G3P A;  4M2B A;  2Q4J A;  3D98 A;  5E3P A;  5DEM A;  2NPO A;  3DJ4 A;  3IXC A;  2W0W A;  5ADX U;  2JF2 A;  5U2K A;  1QRE A;  4KPX A;  1KRU A;  3I3X A;  2OI6 A;  3DK5 A;  5DEP A;  2GGO A;  3BXY A;  3VBI A;  1HV9 A;  2QIA A;  3BSY A;  2IUA A;  4IHF A;  1MR7 A;  4E1K A;  3R1W A;  4E6U A;  3TIS A;  5E3Q A;  3V4E A;  5ADX V;  1SST A;  1XHD A;  2WLF A;  3R8Y A;  1FWY A;  3VBL A;  2QKX A;  3Q1X A;  3HSQ A;  3VBJ A;  4DCL A;  3FSB A;  2P2O A;  4N6B A;  3D8V A;  2V0K A;  1KGT A;  3R3I A;  2ICX A;  2WLG A;  3FWW A;  2VHE A;  4HZD A;  1S80 A;  4EA8 A;  2IU9 A;  2OEG A;  3KWE A;  3P47 A;  3SRT A;  4KNR A;  3GVD A;  4HUR A;  3T57 A;  3BRK X;  3ECT A;  4E75 A;  1KHR A;  1KK6 A;  4R36 A;  4MZU A;  2AQ9 A;  1YP4 A;  4EGG A;  1J2Z A;  4IHH A;  3P1B A;  4G3S A;  4M9C A;  4K6R A;  1T3D A;  1KK4 A;  1V67 A;  3PMO A;  1OCX A;  1YP2 A;  1SSQ A;  2ICY A;  2VD4 A;  4N6A A;  5DG3 A;  3VBN A;  3MQG A;  4AC3 A;  4E79 A;  4J09 A;  3KWC A;  3GUE A;  1SSM A;  3CJ8 A;  1QQ0 A;  1KRV A;  3BSW A;  2IC7 A;  1V3W A;  1HM8 A;  1G97 A;  3FTT A;  4M2A A;  3VNP A;  4EQY A;  4R7P A;  1LXA A;  5E3R A;  3VBK A;  2V0H A;  3HJJ A;  4HZC A;  2WLC A;  4MYO A;  1KGQ A;  5L6S A;  3R0S A;  2XAT A;  2OEF A;  3TWD A;  4G3Q A;  4MFG A;  4KNX A;  5AFU U;  3TK8 A;  4IHG A;  1FXJ A;  4N27 A;  3IGJ A;  2WLE A;  3TV0 A;  2V0J A;  4N69 A;  1XAT A;  1HM0 A;  3JQY A;  2GGQ A;  3R2W A;  3R3R A;  3FSC A;  3OTZ A;  3OU9 A;  1KK5 A;  3FOQ A;  2TDT A;  3F1X A;  4G87 A;  4M98 A;  4EA7 A;  1THJ A;  3R5B A;  2V0L A;  3EG4 A;  3MC4 A;  3MQH A;  3OTM A;  3OUP A;  4AAW A;  2OI5 A;  4EAB A; 
#chains in the Genus database with same CATH topology
 1MR9 A;  3R5C A;  1QRL A;  3BFP A;  3TIO A;  5AFU V;  1YP3 A;  3TDT A;  3VBP A;  1G95 A;  2RIJ A;  4HUS A;  4H7O A;  3EEV A;  1Z90 A;  3OH0 A;  3SUC A;  3KWD A;  1HM9 A;  2IU8 A;  3GOS A;  3ST8 A;  4E6T A;  4J18 A;  5F42 A;  3FSX A;  4KQL A;  2WLD A;  3OH4 A;  2QIV X;  5L6V A;  1QRG A;  2V0I A;  1EWW A;  2FKO A;  4EAA A;  1TDT A;  2W0V A;  4AA7 A;  3OW5 A;  3BSS A;  4HCQ A;  4FCE A;  3VBM A;  1KQA A;  2I5K A;  3C8V A;  3I3A A;  3NZ2 A;  3FS8 A;  1QRF A;  4ISX A;  4M99 A;  4EA9 A;  3DHO A;  3FSY A;  3R5A A;  3EH0 A;  2OI7 A;  1KRR A;  4KPZ A;  1MRL A;  1QRM A;  3R5D A;  4M28 A;  4R37 A;  3SPT A;  2JF3 A;  4G3P A;  4M2B A;  2Q4J A;  3D98 A;  5E3P A;  5DEM A;  2NPO A;  3DJ4 A;  3IXC A;  2W0W A;  5ADX U;  2JF2 A;  5U2K A;  1QRE A;  4KPX A;  1KRU A;  3I3X A;  2OI6 A;  3DK5 A;  5DEP A;  2GGO A;  3BXY A;  3VBI A;  1HV9 A;  2QIA A;  3BSY A;  2IUA A;  4IHF A;  1MR7 A;  3GQ7 A;  4E1K A;  3R1W A;  4E6U A;  3TIS A;  5E3Q A;  3V4E A;  5ADX V;  1SST A;  1XHD A;  2WLF A;  3OH2 A;  1L0S A;  3R8Y A;  1FWY A;  3VBL A;  2QKX A;  3Q1X A;  3HSQ A;  3OH1 A;  3VBJ A;  4DCL A;  3FSB A;  2P2O A;  4N6B A;  3D8V A;  2V0K A;  1KGT A;  3R3I A;  2ICX A;  2WLG A;  3FWW A;  2VHE A;  4HZD A;  1S80 A;  4EA8 A;  2IU9 A;  2OEG A;  3GQA A;  3KWE A;  3OGZ A;  3P47 A;  3SRT A;  4KNR A;  3GVD A;  3OH3 A;  4HUR A;  3T57 A;  3BRK X;  3ECT A;  4E75 A;  1KHR A;  1KK6 A;  4R36 A;  3GQ9 A;  4MZU A;  2AQ9 A;  1YP4 A;  4EGG A;  1J2Z A;  4IHH A;  3P1B A;  4G3S A;  4M9C A;  1N4I A;  4K6R A;  1T3D A;  1KK4 A;  1V67 A;  3PMO A;  1OCX A;  1YP2 A;  1SSQ A;  2ICY A;  2VD4 A;  4N6A A;  5DG3 A;  3VBN A;  3MQG A;  4AC3 A;  4E79 A;  4J09 A;  3KWC A;  3GUE A;  1SSM A;  3CJ8 A;  1QQ0 A;  1KRV A;  3BSW A;  2IC7 A;  1V3W A;  1HM8 A;  1G97 A;  3FTT A;  4M2A A;  3VNP A;  4EQY A;  4R7P A;  1LXA A;  5E3R A;  3VBK A;  2V0H A;  3HJJ A;  4HZC A;  2WLC A;  4MYO A;  1KGQ A;  5L6S A;  3R0S A;  2XAT A;  1Z2F A;  2OEF A;  3TWD A;  4G3Q A;  4MFG A;  4KNX A;  5AFU U;  3TK8 A;  4IHG A;  1FXJ A;  4N27 A;  3IGJ A;  2WLE A;  3TV0 A;  2V0J A;  4N69 A;  1XAT A;  1HM0 A;  3JQY A;  2GGQ A;  3GQ8 A;  3R2W A;  3R3R A;  1M8N A;  3FSC A;  3OTZ A;  3OU9 A;  1KK5 A;  3FOQ A;  2TDT A;  3F1X A;  4G87 A;  4M98 A;  4EA7 A;  1THJ A;  3R5B A;  2V0L A;  3EG4 A;  3MC4 A;  3MQH A;  3OTM A;  3OUP A;  4AAW A;  2OI5 A;  4EAB A; 
#chains in the Genus database with same CATH homology
 1MR9 A;  3R5C A;  1QRL A;  3BFP A;  3TIO A;  5AFU V;  1YP3 A;  3TDT A;  3VBP A;  1G95 A;  2RIJ A;  4HUS A;  4H7O A;  3EEV A;  1Z90 A;  3KWD A;  1HM9 A;  2IU8 A;  3GOS A;  3ST8 A;  4E6T A;  4J18 A;  5F42 A;  3FSX A;  4KQL A;  2WLD A;  2QIV X;  5L6V A;  1QRG A;  2V0I A;  2FKO A;  4EAA A;  1TDT A;  2W0V A;  4AA7 A;  3OW5 A;  3BSS A;  4HCQ A;  4FCE A;  3VBM A;  1KQA A;  2I5K A;  3C8V A;  3I3A A;  3NZ2 A;  3FS8 A;  1QRF A;  4ISX A;  4M99 A;  4EA9 A;  3DHO A;  3FSY A;  3R5A A;  3EH0 A;  2OI7 A;  1KRR A;  4KPZ A;  1MRL A;  1QRM A;  3R5D A;  4M28 A;  4R37 A;  3SPT A;  2JF3 A;  4G3P A;  4M2B A;  2Q4J A;  3D98 A;  5E3P A;  5DEM A;  2NPO A;  3DJ4 A;  3IXC A;  2W0W A;  5ADX U;  2JF2 A;  5U2K A;  1QRE A;  4KPX A;  1KRU A;  3I3X A;  2OI6 A;  3DK5 A;  5DEP A;  2GGO A;  3BXY A;  3VBI A;  1HV9 A;  2QIA A;  3BSY A;  2IUA A;  4IHF A;  1MR7 A;  4E1K A;  3R1W A;  4E6U A;  3TIS A;  5E3Q A;  3V4E A;  5ADX V;  1SST A;  1XHD A;  2WLF A;  3R8Y A;  1FWY A;  3VBL A;  2QKX A;  3Q1X A;  3HSQ A;  3VBJ A;  4DCL A;  3FSB A;  2P2O A;  4N6B A;  3D8V A;  2V0K A;  1KGT A;  3R3I A;  2ICX A;  2WLG A;  3FWW A;  2VHE A;  4HZD A;  1S80 A;  4EA8 A;  2IU9 A;  2OEG A;  3KWE A;  3P47 A;  3SRT A;  4KNR A;  3GVD A;  4HUR A;  3T57 A;  3BRK X;  3ECT A;  4E75 A;  1KHR A;  1KK6 A;  4R36 A;  4MZU A;  2AQ9 A;  1YP4 A;  4EGG A;  1J2Z A;  4IHH A;  3P1B A;  4G3S A;  4M9C A;  4K6R A;  1T3D A;  1KK4 A;  1V67 A;  3PMO A;  1OCX A;  1YP2 A;  1SSQ A;  2ICY A;  2VD4 A;  4N6A A;  5DG3 A;  3VBN A;  3MQG A;  4AC3 A;  4E79 A;  4J09 A;  3KWC A;  3GUE A;  1SSM A;  3CJ8 A;  1QQ0 A;  1KRV A;  3BSW A;  2IC7 A;  1V3W A;  1HM8 A;  1G97 A;  3FTT A;  4M2A A;  3VNP A;  4EQY A;  4R7P A;  1LXA A;  5E3R A;  3VBK A;  2V0H A;  3HJJ A;  4HZC A;  2WLC A;  4MYO A;  1KGQ A;  5L6S A;  3R0S A;  2XAT A;  2OEF A;  3TWD A;  4G3Q A;  4MFG A;  4KNX A;  5AFU U;  3TK8 A;  4IHG A;  1FXJ A;  4N27 A;  3IGJ A;  2WLE A;  3TV0 A;  2V0J A;  4N69 A;  1XAT A;  1HM0 A;  3JQY A;  2GGQ A;  3R2W A;  3R3R A;  3FSC A;  3OTZ A;  3OU9 A;  1KK5 A;  3FOQ A;  2TDT A;  3F1X A;  4G87 A;  4M98 A;  4EA7 A;  1THJ A;  3R5B A;  2V0L A;  3EG4 A;  3MC4 A;  3MQH A;  3OTM A;  3OUP A;  4AAW A;  2OI5 A;  4EAB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...