1KHRA

Crystal structure of vat(d) in complex with virginiamycin and coenzyme a
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
206
structure length
206
Chain Sequence
MGPNPMKMYPIEGNKSVQFIKPILEKLENVEVGEYSYYDSKNGETFDKQILYHYPILNDKLKIGKFCSIGPGVTIIMNGANHRMDGSTYPFNLFGNGWEKHMPKLDQLPIKGDTIIGNDVWIGKDVVIMPGVKIGDGAIVAANSVVVKDIAPYMLAGGNPANEIKQRFDQDTINQLLDIKWWNWPIDIINENIDKILDNSIIREVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STREPTOGRAMIN A ACETYLTRANSFERASE
publication title Crystal structure of Vat(D): an acetyltransferase that inactivates streptogramin group A antibiotics.
pubmed doi rcsb
source organism Enterococcus faecium
molecule tags Transferase/antibiotic
total genus 60
structure length 206
sequence length 206
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.-:
pdb deposition date 2001-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 1khrA00
2OEFA 1SSMA 1QRFA 1SSQA 4N27A 1SSTA 4E6TA 3ECTA 3VBLA 3OW5A 4IHFA 3T57A 3P47A 3KWCA 1THJA 3VNPA 4HCQA 4E75A 3FSCA 4G3SA 2GGOA 1KRVA 2FKOA 2IUAA 2JF3A 3R5AA 1YP3A 1J2ZA 3FSBA 3OU9A 4K6RA 2JF2A 2W0VA 4N6BA 2AQ9A 1G97A 2ICXA 4KPXA 3VBKA 4IHGA 2QIVX 2OI7A 1KGQA 1KQAA 4EA8A 3I3AA 4EGGA 5DEMA 2WLCA 4KQLA 4EQYA 5ADXV 1OCXA 4FCEA 4G87A 4AC3A 3FSYA 3BRKX 2IC7A 3TK8A 3R5BA 3GOSA 2RIJA 3Q1XA 3CJ8A 3D98A 3R3RA 4R36A 5AFUU 3C8VA 2QKXA 3HSQA 3R1WA 1FXJA 2V0KA 4M2AA 4M9CA 5DG3A 5U2KA 3MQGA 1XATA 4EABA 1HM9A 3TV0A 1QREA 4HURA 5AFUV 4E1KA 4MZUA 3BXYA 3ST8A 4HUSA 3D8VA 3GVDA 3VBIA 3GUEA 1KRRA 1MR9A 3FWWA 5E3QA 4N69A 5L6VA 1S80A 3IXCA 3EEVA 1LXAA 5E3PA 4MYOA 1XHDA 1YP2A 1KK5A 2IU8A 4E6UA 2WLEA 4M98A 2WLDA 3F1XA 3R2WA 3R8YA 4KPZA 2OI6A 3EG4A 3DHOA 1KHRA 2OI5A 1V67A 2P2OA 3FOQA 1QRLA 3FTTA 4G3PA 2WLFA 3I3XA 2V0LA 3R5DA 3TISA 3VBMA 3BSYA 2V0HA 3BSSA 1QRMA 3MQHA 4H7OA 1HM8A 1YP4A 3OTMA 1T3DA 2WLGA 3PMOA 5E3RA 3HJJA 4DCLA 1G95A 3IGJA 3KWEA 3OTZA 2NPOA 4EA9A 4EAAA 4G3QA 3DK5A 3TWDA 1HV9A 3R3IA 1FWYA 2TDTA 4ISXA 4HZCA 1Z90A 3P1BA 4J09A 1KK6A 3MC4A 1KGTA 1MR7A 1KK4A 1QQ0A 2I5KA 4R7PA 5DEPA 3VBPA 1TDTA 3BSWA 4M28A 3NZ2A 3VBNA 2V0JA 3KWDA 3V4EA 3JQYA 4EA7A 5ADXU 2Q4JA 3DJ4A 3FSXA 3R0SA 4M99A 1V3WA 3OUPA 4J18A 2OEGA 2XATA 4HZDA 2V0IA 4KNRA 3EH0A 1QRGA 3SPTA 3R5CA 4KNXA 4AAWA 5L6SA 1MRLA 4N6AA 5F42A 3TIOA 4E79A 4AA7A 3BFPA 3TDTA 2VHEA 2IU9A 1KRUA 3FS8A 2GGQA 4R37A 3SRTA 1HM0A 4MFGA 2W0WA 2VD4A 4IHHA 2QIAA 2ICYA 3VBJA 4M2BA
chains in the Genus database with same CATH superfamily
2OEFA 1SSMA 1QRFA 1SSQA 4N27A 1SSTA 4E6TA 3ECTA 3VBLA 3OW5A 4IHFA 3T57A 3P47A 3KWCA 1THJA 3VNPA 4HCQA 4E75A 3FSCA 4G3SA 2GGOA 1KRVA 2FKOA 2IUAA 2JF3A 3R5AA 1YP3A 1J2ZA 3FSBA 3OU9A 4K6RA 2JF2A 2W0VA 3GQ9A 4N6BA 2AQ9A 1G97A 3OH3A 2ICXA 4KPXA 3VBKA 4IHGA 1Z2FA 2QIVX 2OI7A 1KGQA 1KQAA 4EA8A 3OGZA 3I3AA 4EGGA 5DEMA 2WLCA 4KQLA 4EQYA 5ADXV 1OCXA 4FCEA 4G87A 4AC3A 3FSYA 3BRKX 2IC7A 3TK8A 3R5BA 3GOSA 2RIJA 3Q1XA 3CJ8A 3D98A 3R3RA 4R36A 5AFUU 3C8VA 2QKXA 1M8NA 3HSQA 3R1WA 1FXJA 2V0KA 4M2AA 4M9CA 3OH2A 5DG3A 3MQGA 1XATA 5U2KA 4EABA 1HM9A 3TV0A 1QREA 4HURA 5AFUV 4E1KA 4MZUA 3BXYA 3ST8A 4HUSA 3D8VA 3GVDA 3VBIA 3GUEA 1KRRA 1MR9A 3FWWA 5E3QA 4N69A 5L6VA 1S80A 3IXCA 3EEVA 1LXAA 5E3PA 4MYOA 1XHDA 1YP2A 3GQ8A 1KK5A 2IU8A 4E6UA 2WLEA 4M98A 2WLDA 3F1XA 3R2WA 3SUCA 3R8YA 4KPZA 2OI6A 3EG4A 3DHOA 1KHRA 2OI5A 1V67A 2P2OA 3OH0A 3FOQA 1QRLA 3FTTA 4G3PA 2WLFA 3I3XA 2V0LA 3R5DA 3TISA 3VBMA 3BSYA 2V0HA 3BSSA 1QRMA 3MQHA 4H7OA 1HM8A 1YP4A 3OTMA 1T3DA 2WLGA 3PMOA 5E3RA 3HJJA 4DCLA 1G95A 3IGJA 3KWEA 3OTZA 2NPOA 4EA9A 4EAAA 4G3QA 3DK5A 3TWDA 1HV9A 3R3IA 1FWYA 2TDTA 4ISXA 4HZCA 1Z90A 3P1BA 4J09A 1N4IA 1KK6A 3GQAA 1KGTA 1MR7A 1KK4A 1QQ0A 2I5KA 3MC4A 4R7PA 5DEPA 3VBPA 1TDTA 3BSWA 4M28A 1EWWA 3NZ2A 3VBNA 2V0JA 3KWDA 3V4EA 3JQYA 4EA7A 5ADXU 2Q4JA 3DJ4A 3FSXA 3R0SA 4M99A 1V3WA 3OUPA 4J18A 2OEGA 2XATA 4HZDA 2V0IA 4KNRA 3EH0A 1L0SA 1QRGA 3R5CA 4KNXA 3SPTA 4AAWA 5L6SA 3OH4A 1MRLA 4N6AA 5F42A 3TIOA 4E79A 4AA7A 3BFPA 3TDTA 2VHEA 2IU9A 1KRUA 3FS8A 2GGQA 4R37A 3SRTA 1HM0A 4MFGA 2W0WA 3GQ7A 2VD4A 3OH1A 4IHHA 2QIAA 2ICYA 3VBJA 4M2BA
chains in the Genus database with same CATH topology
2OEFA 1SSMA 1QRFA 1SSQA 4N27A 1SSTA 4E6TA 3ECTA 3VBLA 3OW5A 4IHFA 3T57A 3P47A 3KWCA 1THJA 3VNPA 4HCQA 4E75A 3FSCA 4G3SA 2GGOA 1KRVA 2FKOA 2IUAA 2JF3A 3R5AA 1YP3A 1J2ZA 3FSBA 3OU9A 4K6RA 2JF2A 2W0VA 4N6BA 2AQ9A 1G97A 2ICXA 4KPXA 3VBKA 4IHGA 2QIVX 2OI7A 1KGQA 1KQAA 4EA8A 3I3AA 4EGGA 5DEMA 2WLCA 4KQLA 4EQYA 5ADXV 1OCXA 4FCEA 4G87A 4AC3A 3FSYA 3BRKX 2IC7A 3TK8A 3R5BA 3GOSA 2RIJA 3Q1XA 3CJ8A 3D98A 3R3RA 4R36A 5AFUU 3C8VA 2QKXA 3HSQA 3R1WA 1FXJA 2V0KA 4M2AA 4M9CA 5DG3A 5U2KA 3MQGA 1XATA 4EABA 1HM9A 3TV0A 1QREA 4HURA 5AFUV 4E1KA 4MZUA 3BXYA 3ST8A 4HUSA 3D8VA 3GVDA 3VBIA 3GUEA 1KRRA 1MR9A 3FWWA 5E3QA 4N69A 5L6VA 1S80A 3IXCA 3EEVA 1LXAA 5E3PA 4MYOA 1XHDA 1YP2A 1KK5A 2IU8A 4E6UA 2WLEA 4M98A 2WLDA 3F1XA 3R2WA 3R8YA 4KPZA 2OI6A 3EG4A 3DHOA 1KHRA 2OI5A 1V67A 2P2OA 3FOQA 1QRLA 3FTTA 4G3PA 2WLFA 3I3XA 2V0LA 3R5DA 3TISA 3VBMA 3BSYA 2V0HA 3BSSA 1QRMA 3MQHA 4H7OA 1HM8A 1YP4A 3OTMA 1T3DA 2WLGA 3PMOA 5E3RA 3HJJA 4DCLA 1G95A 3IGJA 3KWEA 3OTZA 2NPOA 4EA9A 4EAAA 4G3QA 3DK5A 3TWDA 1HV9A 3R3IA 1FWYA 2TDTA 4ISXA 4HZCA 1Z90A 3P1BA 4J09A 1KK6A 3MC4A 1KGTA 1MR7A 1KK4A 1QQ0A 2I5KA 4R7PA 5DEPA 3VBPA 1TDTA 3BSWA 4M28A 3NZ2A 3VBNA 2V0JA 3KWDA 3V4EA 3JQYA 4EA7A 5ADXU 2Q4JA 3DJ4A 3FSXA 3R0SA 4M99A 1V3WA 3OUPA 4J18A 2OEGA 2XATA 4HZDA 2V0IA 4KNRA 3EH0A 1QRGA 3SPTA 3R5CA 4KNXA 4AAWA 5L6SA 1MRLA 4N6AA 5F42A 3TIOA 4E79A 4AA7A 3BFPA 3TDTA 2VHEA 2IU9A 1KRUA 3FS8A 2GGQA 4R37A 3SRTA 1HM0A 4MFGA 2W0WA 2VD4A 4IHHA 2QIAA 2ICYA 3VBJA 4M2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OEF A;  1SSM A;  1QRF A;  1SSQ A;  4N27 A;  1SST A;  4E6T A;  3ECT A;  3VBL A;  3OW5 A;  4IHF A;  3T57 A;  3P47 A;  3KWC A;  1THJ A;  3VNP A;  4HCQ A;  4E75 A;  3FSC A;  4G3S A;  2GGO A;  1KRV A;  2FKO A;  2IUA A;  2JF3 A;  3R5A A;  1YP3 A;  1J2Z A;  3FSB A;  3OU9 A;  4K6R A;  2JF2 A;  2W0V A;  4N6B A;  2AQ9 A;  1G97 A;  2ICX A;  4KPX A;  3VBK A;  4IHG A;  2QIV X;  2OI7 A;  1KGQ A;  1KQA A;  4EA8 A;  3I3A A;  4EGG A;  5DEM A;  2WLC A;  4KQL A;  4EQY A;  5ADX V;  1OCX A;  4FCE A;  4G87 A;  4AC3 A;  3FSY A;  3BRK X;  2IC7 A;  3TK8 A;  3R5B A;  3GOS A;  2RIJ A;  3Q1X A;  3CJ8 A;  3D98 A;  3R3R A;  4R36 A;  5AFU U;  3C8V A;  2QKX A;  3HSQ A;  3R1W A;  1FXJ A;  2V0K A;  4M2A A;  4M9C A;  5DG3 A;  5U2K A;  3MQG A;  1XAT A;  4EAB A;  1HM9 A;  3TV0 A;  1QRE A;  4HUR A;  5AFU V;  4E1K A;  4MZU A;  3BXY A;  3ST8 A;  4HUS A;  3D8V A;  3GVD A;  3VBI A;  3GUE A;  1KRR A;  1MR9 A;  3FWW A;  5E3Q A;  4N69 A;  5L6V A;  1S80 A;  3IXC A;  3EEV A;  1LXA A;  5E3P A;  4MYO A;  1XHD A;  1YP2 A;  1KK5 A;  2IU8 A;  4E6U A;  2WLE A;  4M98 A;  2WLD A;  3F1X A;  3R2W A;  3R8Y A;  4KPZ A;  2OI6 A;  3EG4 A;  3DHO A;  1KHR A;  2OI5 A;  1V67 A;  2P2O A;  3FOQ A;  1QRL A;  3FTT A;  4G3P A;  2WLF A;  3I3X A;  2V0L A;  3R5D A;  3TIS A;  3VBM A;  3BSY A;  2V0H A;  3BSS A;  1QRM A;  3MQH A;  4H7O A;  1HM8 A;  1YP4 A;  3OTM A;  1T3D A;  2WLG A;  3PMO A;  5E3R A;  3HJJ A;  4DCL A;  1G95 A;  3IGJ A;  3KWE A;  3OTZ A;  2NPO A;  4EA9 A;  4EAA A;  4G3Q A;  3DK5 A;  3TWD A;  1HV9 A;  3R3I A;  1FWY A;  2TDT A;  4ISX A;  4HZC A;  1Z90 A;  3P1B A;  4J09 A;  1KK6 A;  3MC4 A;  1KGT A;  1MR7 A;  1KK4 A;  1QQ0 A;  2I5K A;  4R7P A;  5DEP A;  3VBP A;  1TDT A;  3BSW A;  4M28 A;  3NZ2 A;  3VBN A;  2V0J A;  3KWD A;  3V4E A;  3JQY A;  4EA7 A;  5ADX U;  2Q4J A;  3DJ4 A;  3FSX A;  3R0S A;  4M99 A;  1V3W A;  3OUP A;  4J18 A;  2OEG A;  2XAT A;  4HZD A;  2V0I A;  4KNR A;  3EH0 A;  1QRG A;  3SPT A;  3R5C A;  4KNX A;  4AAW A;  5L6S A;  1MRL A;  4N6A A;  5F42 A;  3TIO A;  4E79 A;  4AA7 A;  3BFP A;  3TDT A;  2VHE A;  2IU9 A;  1KRU A;  3FS8 A;  2GGQ A;  4R37 A;  3SRT A;  1HM0 A;  4MFG A;  2W0W A;  2VD4 A;  4IHH A;  2QIA A;  2ICY A;  3VBJ A;  4M2B A; 
#chains in the Genus database with same CATH topology
 2OEF A;  1SSM A;  1QRF A;  1SSQ A;  4N27 A;  1SST A;  4E6T A;  3ECT A;  3VBL A;  3OW5 A;  4IHF A;  3T57 A;  3P47 A;  3KWC A;  1THJ A;  3VNP A;  4HCQ A;  4E75 A;  3FSC A;  4G3S A;  2GGO A;  1KRV A;  2FKO A;  2IUA A;  2JF3 A;  3R5A A;  1YP3 A;  1J2Z A;  3FSB A;  3OU9 A;  4K6R A;  2JF2 A;  2W0V A;  3GQ9 A;  4N6B A;  2AQ9 A;  1G97 A;  3OH3 A;  2ICX A;  4KPX A;  3VBK A;  4IHG A;  1Z2F A;  2QIV X;  2OI7 A;  1KGQ A;  1KQA A;  4EA8 A;  3OGZ A;  3I3A A;  4EGG A;  5DEM A;  2WLC A;  4KQL A;  4EQY A;  5ADX V;  1OCX A;  4FCE A;  4G87 A;  4AC3 A;  3FSY A;  3BRK X;  2IC7 A;  3TK8 A;  3R5B A;  3GOS A;  2RIJ A;  3Q1X A;  3CJ8 A;  3D98 A;  3R3R A;  4R36 A;  5AFU U;  3C8V A;  2QKX A;  1M8N A;  3HSQ A;  3R1W A;  1FXJ A;  2V0K A;  4M2A A;  4M9C A;  3OH2 A;  5DG3 A;  3MQG A;  1XAT A;  5U2K A;  4EAB A;  1HM9 A;  3TV0 A;  1QRE A;  4HUR A;  5AFU V;  4E1K A;  4MZU A;  3BXY A;  3ST8 A;  4HUS A;  3D8V A;  3GVD A;  3VBI A;  3GUE A;  1KRR A;  1MR9 A;  3FWW A;  5E3Q A;  4N69 A;  5L6V A;  1S80 A;  3IXC A;  3EEV A;  1LXA A;  5E3P A;  4MYO A;  1XHD A;  1YP2 A;  3GQ8 A;  1KK5 A;  2IU8 A;  4E6U A;  2WLE A;  4M98 A;  2WLD A;  3F1X A;  3R2W A;  3SUC A;  3R8Y A;  4KPZ A;  2OI6 A;  3EG4 A;  3DHO A;  1KHR A;  2OI5 A;  1V67 A;  2P2O A;  3OH0 A;  3FOQ A;  1QRL A;  3FTT A;  4G3P A;  2WLF A;  3I3X A;  2V0L A;  3R5D A;  3TIS A;  3VBM A;  3BSY A;  2V0H A;  3BSS A;  1QRM A;  3MQH A;  4H7O A;  1HM8 A;  1YP4 A;  3OTM A;  1T3D A;  2WLG A;  3PMO A;  5E3R A;  3HJJ A;  4DCL A;  1G95 A;  3IGJ A;  3KWE A;  3OTZ A;  2NPO A;  4EA9 A;  4EAA A;  4G3Q A;  3DK5 A;  3TWD A;  1HV9 A;  3R3I A;  1FWY A;  2TDT A;  4ISX A;  4HZC A;  1Z90 A;  3P1B A;  4J09 A;  1N4I A;  1KK6 A;  3GQA A;  1KGT A;  1MR7 A;  1KK4 A;  1QQ0 A;  2I5K A;  3MC4 A;  4R7P A;  5DEP A;  3VBP A;  1TDT A;  3BSW A;  4M28 A;  1EWW A;  3NZ2 A;  3VBN A;  2V0J A;  3KWD A;  3V4E A;  3JQY A;  4EA7 A;  5ADX U;  2Q4J A;  3DJ4 A;  3FSX A;  3R0S A;  4M99 A;  1V3W A;  3OUP A;  4J18 A;  2OEG A;  2XAT A;  4HZD A;  2V0I A;  4KNR A;  3EH0 A;  1L0S A;  1QRG A;  3R5C A;  4KNX A;  3SPT A;  4AAW A;  5L6S A;  3OH4 A;  1MRL A;  4N6A A;  5F42 A;  3TIO A;  4E79 A;  4AA7 A;  3BFP A;  3TDT A;  2VHE A;  2IU9 A;  1KRU A;  3FS8 A;  2GGQ A;  4R37 A;  3SRT A;  1HM0 A;  4MFG A;  2W0W A;  3GQ7 A;  2VD4 A;  3OH1 A;  4IHH A;  2QIA A;  2ICY A;  3VBJ A;  4M2B A; 
#chains in the Genus database with same CATH homology
 2OEF A;  1SSM A;  1QRF A;  1SSQ A;  4N27 A;  1SST A;  4E6T A;  3ECT A;  3VBL A;  3OW5 A;  4IHF A;  3T57 A;  3P47 A;  3KWC A;  1THJ A;  3VNP A;  4HCQ A;  4E75 A;  3FSC A;  4G3S A;  2GGO A;  1KRV A;  2FKO A;  2IUA A;  2JF3 A;  3R5A A;  1YP3 A;  1J2Z A;  3FSB A;  3OU9 A;  4K6R A;  2JF2 A;  2W0V A;  4N6B A;  2AQ9 A;  1G97 A;  2ICX A;  4KPX A;  3VBK A;  4IHG A;  2QIV X;  2OI7 A;  1KGQ A;  1KQA A;  4EA8 A;  3I3A A;  4EGG A;  5DEM A;  2WLC A;  4KQL A;  4EQY A;  5ADX V;  1OCX A;  4FCE A;  4G87 A;  4AC3 A;  3FSY A;  3BRK X;  2IC7 A;  3TK8 A;  3R5B A;  3GOS A;  2RIJ A;  3Q1X A;  3CJ8 A;  3D98 A;  3R3R A;  4R36 A;  5AFU U;  3C8V A;  2QKX A;  3HSQ A;  3R1W A;  1FXJ A;  2V0K A;  4M2A A;  4M9C A;  5DG3 A;  5U2K A;  3MQG A;  1XAT A;  4EAB A;  1HM9 A;  3TV0 A;  1QRE A;  4HUR A;  5AFU V;  4E1K A;  4MZU A;  3BXY A;  3ST8 A;  4HUS A;  3D8V A;  3GVD A;  3VBI A;  3GUE A;  1KRR A;  1MR9 A;  3FWW A;  5E3Q A;  4N69 A;  5L6V A;  1S80 A;  3IXC A;  3EEV A;  1LXA A;  5E3P A;  4MYO A;  1XHD A;  1YP2 A;  1KK5 A;  2IU8 A;  4E6U A;  2WLE A;  4M98 A;  2WLD A;  3F1X A;  3R2W A;  3R8Y A;  4KPZ A;  2OI6 A;  3EG4 A;  3DHO A;  1KHR A;  2OI5 A;  1V67 A;  2P2O A;  3FOQ A;  1QRL A;  3FTT A;  4G3P A;  2WLF A;  3I3X A;  2V0L A;  3R5D A;  3TIS A;  3VBM A;  3BSY A;  2V0H A;  3BSS A;  1QRM A;  3MQH A;  4H7O A;  1HM8 A;  1YP4 A;  3OTM A;  1T3D A;  2WLG A;  3PMO A;  5E3R A;  3HJJ A;  4DCL A;  1G95 A;  3IGJ A;  3KWE A;  3OTZ A;  2NPO A;  4EA9 A;  4EAA A;  4G3Q A;  3DK5 A;  3TWD A;  1HV9 A;  3R3I A;  1FWY A;  2TDT A;  4ISX A;  4HZC A;  1Z90 A;  3P1B A;  4J09 A;  1KK6 A;  3MC4 A;  1KGT A;  1MR7 A;  1KK4 A;  1QQ0 A;  2I5K A;  4R7P A;  5DEP A;  3VBP A;  1TDT A;  3BSW A;  4M28 A;  3NZ2 A;  3VBN A;  2V0J A;  3KWD A;  3V4E A;  3JQY A;  4EA7 A;  5ADX U;  2Q4J A;  3DJ4 A;  3FSX A;  3R0S A;  4M99 A;  1V3W A;  3OUP A;  4J18 A;  2OEG A;  2XAT A;  4HZD A;  2V0I A;  4KNR A;  3EH0 A;  1QRG A;  3SPT A;  3R5C A;  4KNX A;  4AAW A;  5L6S A;  1MRL A;  4N6A A;  5F42 A;  3TIO A;  4E79 A;  4AA7 A;  3BFP A;  3TDT A;  2VHE A;  2IU9 A;  1KRU A;  3FS8 A;  2GGQ A;  4R37 A;  3SRT A;  1HM0 A;  4MFG A;  2W0W A;  2VD4 A;  4IHH A;  2QIA A;  2ICY A;  3VBJ A;  4M2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...