The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
47
|
sequence length |
139
|
structure length |
132
|
Chain Sequence |
DRLTNKFQLALADAQSLALGHDNQFIEPLHLMSALLNQEGGSVSPLLTSAGINAGQLRTDINQALNRLPQVQPSQDLVRVLNLCDKLAQKRGDNFISSELFVLAALESRGTLADILKAAGATTANITQAIEQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The Crystal Structure of E. coli Hsp100 ClpB N Terminal Domain, Implication to Peptide Binding Function of ClpB
rcsb |
molecule tags |
Chaperone
|
source organism |
Escherichia coli
|
molecule keywords |
CLPB PROTEIN
|
total genus |
47
|
structure length |
132
|
sequence length |
139
|
chains with identical sequence |
B, C, D
|
ec nomenclature | |
pdb deposition date | 2001-12-01 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF02861 | Clp_N | Clp amino terminal domain, pathogenicity island component |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Double Clp-N motif | Clp, N-terminal domain |
#chains in the Genus database with same CATH superfamily 4HH6 A; 1MBV A; 5HBN A; 4HH5 A; 1MBU A; 3WDD A; 1KHY A; 1R6B X; 1R6C X; 3ZRJ A; 1R6O A; 1R6Q A; 3FH2 A; 2Y1Q A; 2Y1R A; 3FES A; 1MG9 B; 3WDC A; 1MBX A; 1K6K A; 4P15 A; 3WDB A; 4Y0B A; 3ZRI A; 4UQW A; 4IRF A; 4IOD A; 1KSF X; 3WDE A; 2K77 A; 4Y0C A; 1LZW B; 1QVR A; 3PXG A; 5GUI A; #chains in the Genus database with same CATH topology 4HH6 A; 1MBV A; 5HBN A; 4HH5 A; 1MBU A; 3WDD A; 1KHY A; 1R6B X; 1R6C X; 3ZRJ A; 1R6O A; 1R6Q A; 3FH2 A; 2Y1Q A; 2Y1R A; 3FES A; 1MG9 B; 3WDC A; 1MBX A; 1K6K A; 4P15 A; 3WDB A; 4Y0B A; 3ZRI A; 4UQW A; 4IRF A; 4IOD A; 1KSF X; 3WDE A; 2K77 A; 4Y0C A; 1LZW B; 1QVR A; 3PXG A; 5GUI A; #chains in the Genus database with same CATH homology 4HH6 A; 1MBV A; 5HBN A; 4HH5 A; 1MBU A; 3WDD A; 1KHY A; 1R6B X; 1R6C X; 3ZRJ A; 1R6O A; 1R6Q A; 3FH2 A; 2Y1Q A; 2Y1R A; 3FES A; 1MG9 B; 3WDC A; 1MBX A; 1K6K A; 4P15 A; 3WDB A; 4Y0B A; 3ZRI A; 4UQW A; 4IRF A; 4IOD A; 1KSF X; 3WDE A; 2K77 A; 4Y0C A; 1LZW B; 1QVR A; 3PXG A; 5GUI A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...