1KJ2H

Murine alloreactive scfv tcr-peptide-mhc class i molecule complex
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
276
structure length
276
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Allogeneic H-2Kb MHC Class I Molecule
publication title A T cell receptor CDR3beta loop undergoes conformational changes of unprecedented magnitude upon binding to a peptide/MHC class I complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 70
structure length 276
sequence length 276
chains with identical sequence I
ec nomenclature
pdb deposition date 2001-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kj2H02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1kj2H01
4E41E 2Q7YA 3PE9A 5FKAB 4PV9B 3NZHL 2LAAA 1S3KL 2UY7A 3NACH 4YXKL 3SJVE 1NMCB 4UQ2B 1KB9K 5HHOE 4EUPH 1QG3A 5IESH 1Z0NA 5F21B 2PO6D 3HNTH 4KMTL 1J87A 3BSZH 3NVQA 2EH8H 3FO2B 5IP4A 2HRPH 2WINB 4E5XB 3RL2A 4NKMB 5E2WL 3IF1B 5F7UA 4NZRL 2CGRH 1OARH 4U6HA 4HIIA 4NN6B 4BQBA 3IS1X 1IFHL 1NLDH 3P40A 4PJ9D 4KRNA 3SKUD 1KB9J 5E00B 4XCNA 1JPST 3GSQB 5C2UB 1T04B 2WBJD 2H1PL 4DVBB 3DURA 5C3TA 3WIIL 1OTTD 1BLNA 2ICES 5DFVC 5F9OL 5IWLA 4HLZG 2GITB 3VWKC 1A7QL 3PGDA 3SE3A 3ZZ1A 3MCKB 4A6YL 2BMKA 2KH2B 5D2LB 1A02N 1EHNA 3B9DA 4ZD3H 2EEBA 5IUSA 1HE7A 2A6DB 4LCWD 4LHQB 3NIFF 3SDDD 1MI5E 1ZT4A 3AY4A 1Z0MA 5CINL 3TGXA 4NQVA 4Y2DA 5EU6D 1E27B 3U9UB 4L3CA 5C0CB 2ADFH 3TNNA 5ESAB 4U3CA 1C1EL 3OAYK 3VW3H 2WQ8A 4DUXA 1FGVH 4ONFH 2A6IA 5LVEA 3PF2A 4PGEB 4WVRA 4ZOCA 3S34H 3D2UA 1W2KT 3LIZL 4P46D 2UZIL 4KKAC 5F1OB 4RMQA 4IHOB 2OX5A 1CD9B 1WCBB 3OKMA 1KN4H 4PJCF 4N1HB 1J1PL 1IGIH 4LSPL 3NIDF 4OCWH 2NY6D 3MUY1 4W6WB 4XBEL 1JYXA 4TNWF 3DRQA 2QHRH 2VQ1B 2E7LC 1ZSDB 2E5EA 2H32H 2VIRA 4Y1AD 5ITBL 3O41B 4MS8C 1G7LB 3OKYA 1BQLL 3GSUA 5E1HB 2FJHA 1HHGA 4LRIA 4EVNB 2DBLL 1OW0A 1A6PA 1EZVX 2Z92B 3KPRB 3KS0J 1ZGLB 5JR1H 5L88H 1CFSA 1KCGC 3QRFM 4JY4B 1XGYL 4LOUC 2ZSWA 4LCWB 1HZHH 3SDDB 3L95A 2N7AA 1X5KA 5EU6B 3D39D 1QSFD 4PRNA 4HV8A 3VU2A 7CGTA 5D5ME 5EB9A 4L1HA 5F1KC 4DKDC 4CW1B 4UTBH 5KBNC 3B8SA 1NDMA 3K3QA 1T20B 3JWDH 2Z8VC 3VFMA 1DTUA 1MVUA 5TDPB 4L4VE 1CZ8H 1J88A 1EO5A 4RAHA 2E6PA 2P44B 5ID1A 1MHCB 3W0WD 3OXRA 4Q9RH 2FBJL 5F89A 4Y8AA 2F54A 2NY6B 4JREB 4HH9B 1U58B 4KQ4L 1PZ5A 4GG6F 5GRJL 2WUBH 2JJVA 4EDWH 4G8EA 1DQJB 1K3ZA 3RY6C 3MLZH 2EKJA 2GTWB 1D5BA 1IAIL 2VLRD 3SO5A 5D7IB 3B2UC 5IROA 4OFYD 3QUZD 1I85C 2F74B 5HDQL 1MJ7L 1JPFB 3IDJB 3GBNL 3ZT5A 5FYKL 2UZXB 2Z4QB 1A1MB 3BPCB 4G6FD 2OTUA 2DOCA 3I6GA 2EDJA 1EHLL 4BK4A 5JW4M 3MV8E 4PY7A 1KJ2L 1AKJB 4OFVA 2P45B 1QSFB 3V6OE 2B2XL 4HWEL 4POZC 4Y5XB 3OKLB 4M1GL 1S9KC 4CGTA 1P4BH 2AAVA 1IT9L 4JFEE 4NQXA 1DBJH 2RCSH 2CUIA 4FQ1L 3FQXA 1GZPA 4Z7UE 1FNFA 2HT3C 3U0WL 4KJPC 4HS3A 4URTB 4TSCL 1P2CA 3KR3H 3K2MC 1QSED 4U7SA 3VWKB 4JKPH 3OAZH 3SKJL 4M7LL 3W0WB 2DL9A 5C0GA 3WLWD 3UTSB 1MCJA 2F58L 1D6VL 4G3YL 5BS0E 1XF1A 4LVNC 4L9LA 2H2PD 3QIBC 5IK3A 3C08L 1PX4A 5EO1B 2E8YA 3BEWA 3HTLX 3RTQA 1C16B 3EYOA 2ENSA 1CL7L 1OAZH 4FP8H 4O9HH 1CQYA 1Z3GH 4R7DA 1OGAA 3WO4C 4O02L 2EKSB 3MJ7A 4AQOA 3VA6A 2R15A 1NGPL 1B9ZA 4HQQH 4G9FB 2ZKHL 4P2RE 4GKSB 1SJXA 4G6FB 4PJGA 2ZG3A 5I1AA 2W0KA 2ESVE 4ODTL 4NKOB 4OZGB 2IGFH 2K7QA 3ZDXF 2FJFB 2GY5A 1CE6B 5INDA 4QNPE 4YXLL 4LDOB 2E9JA 4F3FA 3GIZH 2YEZB 3HC4H 2Q8BL 1BJMA 4TNVF 4R90L 4R6UA 3HMXL 3QDGE 4ELKA 4O2EA 3V8OA 3BX7C 4HHAA 3TFKC 1RK1A 3M1BB 4EI6A 3P9LB 3BD5A 3ZT7A 1RIHH 2UWEF 2W0PA 1K8IA 3NZHH 1S3KH 1U8LB 3A0OA 4YXKH 4M7JL 4N8VA 1WEJL 4PBXA 2BSSB 3QIUC 5FKPA 3MBXH 1FFPB 2NR6C 2IH3B 1V3MA 3RZCD 4KMTH 1CE1L 3VXSD 3IU4L 5IBUG 4ZFFA 3JTCA 5FYKE 1LEKA 2RJMA 1ZA6B 1FL6A 3PGCA 4JHAL 4XP6L 3FOLA 5E2WH 4NZRH 4PV8B 4CADB 1PLGH 1FBIL 3VDBA 1IFHH 1UCTA 3HNVL 3AY4C 1A6AA 1H8NA 4GBXA 3S88H 4NO3A 2G2RB 1OQXA 4PTTA 1G9MC 2X4SB 4PJBE 5FF6B 4UBDD 2DLHA 3LKNB 3SKOB 1KCUH 3BH9B 3I3BA 2WIMA 4D8PB 1HWGB 1OSPL 4PJFA 2I9LA 4WUKL 2P24B 5J1TC 3GI8L 2ICEB 5CSZB 4ODBD 4NWTL 4QOKE 3D85B 3TN0C 4FQJH 3S98A 2GJ6D 4PRIA 4P3DA 4F7TB 3WFEL 1AI1L 5CD3B 3MXWH 5CINH 3X13A 4J4PD 5TQ2L 3Q6GL 3T3PE 3PWPD 5F6IB 5JQ6L 4GG6A 1CGSH 4F57L 1FL5B 4ZSOE 1C1EH 3DTXA 3EYQD 2DM7A 2ICWJ 4XTRD 1QFWH 1WQVT 3O3EA 5DGRA 3LIZH 2D7NA 2UZIH 3BWAA 4U1MB 1HH9A 4CU7A 1RJZB 2ATKB 1RI8A 3TO4A 5JIHA 5E9DD 5HI3D 1AHWA 4JFXB 4LRIC 5KSUA 5BVJB 2VDOL 2W65A 2AVGA 3CUPA 1VHPA 1J1PH 5LKNA 5H94B 4NN5B 2FH8A 2HTKD 5IGXL 4NO2A 1A2YA 4KK8C 1M7XA 3DLQR 3NTCH 4WFGD 3T4YB 4LLQB 4WW1B 1X5LA 4IMLA 4YWGH 5C6TL 4YFEA 4LCYB 2BRRH 1BQLH 2Q20A 3H7LA 5SWZE 1G7PA 1AXSB 4X80H 1ZVSB 2DBLH 4R2GD 4W4OC 2ZOKB 5EBWA 4KVNH 2W9DL 4ERSH 2GQHA 1FYTE 4MNHA 1YNTB 1OD9A 3AREC 2GJ6B 5BRZE 1N59A 3RWCB 1BFSA 1KB5A 3ZHLA 4PRDB 2YS4A 1T0MB 1NCBL 5DMIL 3PWPB 2GTZA 3OPZL 1QFHA 4KKLC 4BSWA 3TF7A 3AC0A 4X4MA 4YDIL 1DBKH 3X12B 1F00I 1IAOB 2J7LA 3QO0A 4Y2DD 3A6BL 3WO4B 4DGIL 3IS0X 1WAAE 4KDWA 1ETZA 1RU9L 4PPTA 2Q7YB 5C0NC 2HVJA 5DFWH 1AJ7L 5DJ2A 4Y7MA 2GHWB 2W92A 3D2UD 4OD1L 3TPKA 4DKEL 5KVEL 2FBJH 1JNJA 3UAJD 1FQ9C 2X9XA 2B20A 4GRWE 2JIXA 5I9QB 3R06A 4KQ4H 1PDKA 5GRJH 2I5YH 1QP1A 1MAJA 3RL2B 1CXHA 2WBKA 1SM3L 2WAHA 5HY9A 5LXGL 1IAIH 3JTSA 4U6HB 4HIIB 2VXUL 1NFKA 5HDQH 1MJ7H 4JGMA 5CS7A 2WP3O 3GBNH 3TA3A 3UYRL 4QY8A 2WQRA 3RPIA 3DURB 1KJMA 1BLNB 2EDLA 3DNKA 1HNGA 3U36A 3MGTA 3QHFL 3PJSA 3PGDB 1KJ2H 2BMKB 2J6EH 1F6FB 5B8CC 4RQQA 2XY2A 5HI4D 5E2JA 5FXCH 4XPFL 4Z0BL 3LEVL 1ZT4B 4GMTL 1XMWA 4NQVB 2BNUA 1IT9H 4Y2DB 2VDNL 4HCRH 3BDYL 5I8CA 3IFPA 3I2CL 1IAKA 4L3CB 3TNNB 3DRTA 2VH5L 2YUXA 2P47B 5J0BA 3RTQC 4TSCH 3QULA 4DAGL 2A6IB 3KAAA 4KROD 1OAKH 3S8WA 4KMLB 4WEBH 3SKJH 1EGJA 1BBDL 3D2UB 1QZ1A 3CVIL 3QEQA 4FA8A 1AXIB 2F58H 4G3YH 1E4JA 2DJSA 4ONGL 3C6LC 1XH3A 4BH8A 3U48A 1CR9L 3OKMB 3ARWA 3C08H 2CR6A 4LPWA 5CEXA 2F54D 5FM5M 5I15L 3DRQB 4EQ2A 1PQZA 4YEFA 4GLRH 4QEGA 1YY8A 4R0LA 2VIRB 2ZKHH 1NCCL 4IOFC 1PG7L 4GAJL 3BKCL 4MMZC 4UDUA 3UPAA 2BJML 3GSUB 2FJHB 1HHGB 1IGYA 5DEFA 1JYVA 4YXLH 3GSOA 2XY1A 1AGCA 3KPSA 1CFSB 2Q8BH 4R90H 3HMXH 3T0EA 5TF1L 3WD5L 2ZSWB 4N8CL 3L95B 5TDNA 4YQXH 4PRNB 4HV8B 3WNOA 1GC1C 2CSPA 2FYYB 3FB8A 1QSZA 2BOCA 4M7JH 1KPRA 4W6XB 1UXSA 4GBXC 1NDMB 4KROB 1LVEA 1W0YT 1CE1H 3VFMB 1MVUB 3IU4H 3QJHA 4DWHA 5FDYA 5EH1A 4JHAH 2OTPA 5ID1B 4XP6H 4NRXA 3VGEA 1GIGL 4Y4HD 3OXRB 3ULUL 1FBIH 3H9SE 1I8LC 4IOIA 5F89B 3O8XA 2F54B 5GIRA 4H88L 2Z0BA 5C0AD 3F12A 4M4PA 3WIHL 1PZ5B 4CNIA 1I7UB 1OGTA 1HYSC 4G8EB 1UWEH 5HXMA 3R8BB 3UEZA 3FCTA 1BFOA 1XGUA 3BGAA 4OLWL 1D5BB 1X6NA 1OSPH 4MQXC 4R96A 4HWUA 4WUKH 3QCUL 2B4CC 3GRWA 3HFMH 2HVKA 3VXPA 2OTUB 1X5ZA 4M5YL 4ZO9A 1SYSA 3I6GB 1KCRL 4XNYH 4Z76A 1AHWC 3WSQH 4MNGA 8CGTA 4QKXB 4PY7B 3Q6GH 5DUML 5JQ6H 5IJVA 1L0YA 4H5SA 4YC2B 3ZYIA 5GHWH 1YNKH 4F2MA 3Q5YA 4NO5A 1IAIM 5J56B 4AIOA 4NQXB 3EKCA 3FQXB 1FRGL 1GZPB 5CZXC 5D7KD 5DJYA 4TVSa 4NN7B 1BGXL 4G8GA 4HS3B 1I8MA 1OTUD 4LEOA 1P2CB 2A73A 4BUGA 4LSUL 2VDOH 4JM2C 1TPXC 5C0GB 3JV5A 3NIGE 3S5LA 1LQSR 1TNMA 2VQUA 1JGUL 3QDME 4L9LB 4Y5YC 4I9WD 4YHIA 4HKJA 2IBGA 3TF7C 5C6TH 3BEWB 3RTQB 3EYOB 3RDTA 4R7DB 2XKNA 3MJ7B 3TC9A 3NABL 4F8TA 4PJGB 5HPOA 5KVMC 3TIEA 4C55A 5I1AB 1IQDA 4P59L 5INDB 5BV7L 5DMIH 5ADPL 3OPZH 2PYEE 4F3FB 4IRZL 3ULUE 1T83A 2D4FA 2A2QT 6FABL 1MCPL 1FLRL 3P2TA 5FHBL 1S7SA 4ACPA 4ELKB 4O2EB 1CWVA 2LTQB 4HHAB 3QNZA 1RK1B 4DGIH 4EI6B 2EYTB 4KKCC 1RU9H 1IKNC 1F4HA 3ARDD 4NQTA 4NZDA 1AJ7H 4LIQL 5TPWL 4N8VB 1R3IL 4CU6A 5FKPB 5KSBA 3JBG7 5C08E 4OD1H 5J89A 5B39A 5DHVA 4DKEH 3RVVD 5KVEH 3TA3C 1MPAL 5LBSL 2IADA 4Q9BA 4ZFFB 4JGJA 3TEUA 1LEKB 3TO4D 3P4LA 1UKTA 3MJ8A 5SX5K 4YBQC 1FL6B 3PGCB 3FOLB 4Z95L 1SMOA 3N85L 4NC1C 5EA0L 3VMOA 3RWGA 2VXUH 4RCAA 3CLFH 2FEDC 4MNQE 1A6AB 4GBXB 1E4WH 4MCYA 4PTTB 3HNSH 3ZKMD 2DD8L 3LD8C 4J3OC 4TVPL 3QHFH 4X5LA 3KYOA 3GJFB 4PJFB 4LU5H 2VLMD 4M61A 2I9LB 1NAKL 1JNHA 3MLRL 3MYZA 3OKEA 5BVPH 4P3DB 4XPFH 4Z0BH 3GJEA 2V5YA 3K0WA 3X13B 1PG7X 2UVFA 2XKSA 1F3JA 3BDYH 2VITA 4GG6B 2AGJL 2VH5H 2VDRH 1HQ4A 1LWRA 3F7VA 4X4XA 1VEPA 3DTXB 3EDDA 2FO1A 1H3TA 4KAQH 4U0RB 2H9GA 1CGTA 4NOFA 3O3EB 1BBDH 5ITFA 2V5MA 3W81A 3BWAB 3SY0A 2AK1H 1HH9B 4R0LC 4UV7L 5I1IH 3CFEA 2FX7H 3TO4B 1YUHA 1CR9H 1EO8L 1AHWB 4KJQD 2E7BA 5KSUB 2W65B 1A6ZA 5IVXF 3CUPB 1FC1A 1OP9A 5I15H 4NO2B 1A2YB 3T0EC 5A2IH 4D3CL 3NOIA 5TE6H 1HQRA 3L5WA 4WHCA 3O9WD 4IMLB 3T0WA 3TBWA 1UH4A 1PG7H 2YMXL 5GS1A 3AB0B 2DTMH 3BKCH 3SDXA 4PD4K 1FFOA 4LIQE 3C5ZD 3TJEL 3MC0A 1G7PB 2NQCA 5EBWB 1CD8A 3WE6A 2ARJQ 2J8OA 3F65A 1BD2E 5DVLA 3MFGB 1MY7A 3DUSA 3P77A 4MNHB 2D9CA 1MAML 3N1QC 5FYJH 1N59B 5SV3A 1KB5B 3WD5H 4IOSD 4PREA 4LASL 4MJ2A 2VJXA 4X7TA 4G7VL 3KLDA 1SY6L 2LU7A 2GTZB 3MCG1 2DQIH 3MFFA 4BSWB 4UT9L 1INDL 3O8XC 5EZJA 4QRPE 3ZKQD 4HIEA 4DW2H 4PD4J 3QO0B 3O2VH 3BFOA 3ISWA 3VFSA 4WGWB 1G7IA 2P46B 2BNQE 1ETZB 4L8CA 4R8WL 2HVJB 4NQUA 2OZ4L 1F4YH 2Q6WA 5DJ2B 3STBA 1YNLL 4J12A 3V6BR 1GIGH 5M7QA 3MJ9H 3E6FA 3P11L 2W07A 1NBVL 4H88H 5DJ0A 5HSFA 1X9QA 1JIBA 2JIXB 4JY6A 3R06B 2YRPA 4HPOL 3SGDH 3WIHH 5JHLL 4NM8L 3EOTH 4D0BA 4ZUVB 4DGVH 3IB4A 5HY9B 5HGHA 3N1GC 3L3KA 1TZHA 3JTSB 4IRSA 4BQ6A 2EDBA 4XAWL 5LCVL 3Q5OA 1NMAL 3S3JA 3B9KD 3QCUH 2N1KA 3LRSA 1GYAA 2NY3D 3TA3B 5FECA 4QY8B 4M5YH 3RPIB 2OS7A 1KJMB 3WUWA 1KCRH 2JCCA 3U36B 3UTPD 3MGTB 1X7QA 3PJSB 1A1NA 3MUZ1 5DUMH 4OCYL 1CLCA 4PJXE 5EZLB 2HFGL 3VH8A 3F7RA 4RQQB 3WN5C 3BP4A 3UTQA 2BNUB 4N90E 5I8CB 1FRGH 4TOYL 2O5ZH 5HPMA 3IFPB 1IAKB 2DMKA 3DRTB 4RA0C 1TVBA 3AU1A 2FATL 2DQTH 2QQKL 2IAMA 2VDPH 4I2XE 3RDTC 3QULB 2EDQA 4LSUH 5ABDE 5CILL 3P73A 2ARJA 4NHUE 3CLEH 3BMVA 5JPMA 1JGUH 1QACA 4UMGA 1XH3B 4BH8B 5C0BA 2NYYD 4N0CC 3QXUA 4JKMA 1G6VK 1QRNE 4X6DE 3EHBC 5DFTA 5CEXB 1LE9A 1LEGA 4KZDL 1UVQA 2AXJA 4TSAL 1R0AL 5FGCE 3QUYD 4XX1E 3B9KB 1PQZB 1NFDE 5SWSD 3QWQB 3NABH 1MFAL 3DBXA 1YY8B 2NY3B 1RY7B 2WM0A 5J13C 5HJ3A 4UDUB 3VD5A 4LLVA 1C5BL 2NY5L 4ONHA 4P59H 4X6CF 1IGYB 3U4BL 5DEFB 5BV7H 5ADPH 1B0RA 3MGOA 4HD9A 3GSOB 4OF7A 1SEQH 3RJDA 1AGCB 3GMRA 3K46A 3KPSB 1MRCL 4P2QA 6FABH 3T0EB 1FLRH 4ZS6D 1P5VA 3RBSA 1OP3K 4HIHA 3UTTD 1YEKL 5TDNB 3P0GB 3KJ4C 3CCHA 1JWSA 1OT1A 1BM3L 3FB8B 1FO0L 4LIQH 2BOCB 1R3IH 5FYLD 1S8DA 1KPRB 3DPBA 5FHAL 1UXSB 3RA7L 1NAMA 5DK3A 2W59A 3ARPA 4RMUA 5JIPA 1LO3L 3JWOC 3EFDL 3I02A 1FE8L 4RX4D 5T5NG 4G8GD 3QJHB 4I0PD 4PJ8A 4XZUA 15C8H 4PG2A 5D7SL 5J06A 4NRXB 1YQVH 4EDXA 3IAQA 5B4MD 3N85H 5EA0H 2AKRA 4UT6H 2Q1EA 5HD8C 1XFPA 3FHAA 4GUPA 4NQCE 5GIRB 1A6TA 5FGSA 2DIJA 3F12B 1YN6A 4OM1H 4CNIB 3FT4A 4OTXL 4QTIL 1OGTB 2EDFA 1PKOA 3FCTB 1BFOB 3EW3B 1XGUB 1QEWA 3IAGC 3U82B 4TVPH 4WTXA 1B3JA 1NSNL 4R96B 1LNUA 1NAKH 4WNQA 1JYNA 4N5EA 5GJSL 3MLRH 2HVKB 3EYUH 5GRZA 1OCWH 4CRPA 3MRLB 5EIVA 1SVZA 4TTDC 5T3ZE 1SYSB 3G6AA 1NGQH 1YN7A 4Z76B 1NCNA 5I30L 4MNGB 1KEML 5H37H 2P48B 5IJVB 4H5SB 3QPQD 4F2MB 2YUVA 2FHCA 3KLAA 4Z8FH 4NO5B 1DQMH 3HE6A 1A14H 2I27N 3L5IA 1R5WA 1JTTA 4U4BA 1RHFA 2KL6A 1ZE3C 5DJYB 4XX1G 4FOMA 2YD4A 5GS1C 2BVUA 2OYPA 4G8GB 1KTDA 1I8MB 1EO8H 4LEOB 5JOFA 5JW4R 2A73B 4GH7B 3FFCD 4JFZH 5C9JA 2XTJE 5DUBA 4OIIH 3DARA 2VXVL 1Y18B 3S5LB 4FQXA 5JPNA 4XNQA 3SO3C 2OL3A 3HZVA 3F5WA 4PP1C 4YHIB 3CXHK 5CEYA 3T1WA 1BEYH 4F80A 5HGAA 4LSQL 4MXWL 2XN9A 4HBCL 1NPUA 2ADJA 3TJEH 3RDTB 4MWFB 4LFHD 5KS9A 4Q9CA 2R1YA 4GT7A 5T3XE 1OTSC 4IDJL 2XKNB 4JFHD 4XMLH 4MAUH 4NC0B 4TUKL 1MAMH 2CIKA 2A9NL 4YHML 3G9VA 1A21A 3TIEB 2E7CA 1IQDB 2ZCKL 4OIAA 4LASH 1BJ1H 1ZANL 3K8MA 4NPYA 2NY4D 4G7VH 3CXHJ 3E0GA 1CF8L 4UT9H 2IAND 4YHPA 4Q9QH 4N0RA 4YEEA 4XCCL 1S7SB 5FA3A 3WKML 1MCQA 5E56A 4APQC 3QNZB 5KOMC 4GW4A 1JGEA 1W0WA 3DXAA 5IW3A 2DI7A 4IRSC 1IM9D 2OZ4H 4JFFE 2H32A 3O2WL 3PDDA 5FM8A 4KGJA 5KSBB 5BOPA 1A3QA 1CK0L 4K07A 3UTZA 4HKXA 4P57A 5B39B 4F9LC 4PB9H 4W4NA 2IADB 4LSDA 1NBVH 2P5EA 3MJ8B 4HG4K 4YPGA 3QZWA 1FGNH 1D5IL 3UBXI 3R0NA 3R8QA 1CDCA 2H26A 2BXZA 4JHZA 1FORH 1A0QH 5IIEA 5DRZA 5D5MF 3RWGB 3UPCA 1NMAH 5EC1A 3EBAA 3WS6A 2XA8L 4C56A 4EKXA 3EYSH 4JVUA 4MCYB 1G6RL 5JHDE 1ZT1A 3BPOC 1T21A 3BPLB 1TZIA 3RKDC 3KYOB 1YEFH 4HG4J 4M61B 3RVUC 3E3QA 1JNHB 4K9EC 3OKEB 3NCFB 3GJEB 5C2BH 1F3JB 3E8UH 3VFRA 5FDWA 3UPRA 3QI9C 2VITB 4TOYH 3CMGA 4E41A 2YKLL 1HQ4B 2QQKH 4LHUG 3F7VB 4X4XB 3W5MA 3NCCB 2FDBP 1B2WL 3SJVA 2H9GB 4TRPL 4Q0XL 5ITFB 4FQHA 3SY0B 1XGQA 2AJYH 3CFEB 3PHOA 1ZGLP 1DBBH 1KACB 3H3BC 3MQIA 1YUHB 1RMFL 4HC1L 1A6ZB 2DKUA 3UZQA 4QCIA 4KZDH 4TSAH 3L7EA 1RUKL 4KJWC 3BH8B 4HW6A 3UJTL 3VGGA 1HQRB 3L5WB 2R8SL 1MFAH 4S1DC 1HDMA 4EI5D 4Z7UF 3S37L 4J3WA 5EIQA 5LJYH 3TBWB 2FECI 2DQGL 5GS1B 4IBLT 3SDXB 3ROOA 1C5BH 2NY5H 1FFOB 2NTSP 3WE6B 1PX3A 3DUSB 3MRDA 4KY1L 1MREL 1CN4A 3P77B 5L6YL 1MRCH 4PJ8C 2F53E 4U2YA 4PREB 3RWEA 3VXUA 1MI5A 4GRLD 4X7TB 3VXMA 5IBLD 3I9GH 3V4PL 3MFFB 5C86A 4FQCH 5EZJB 3GUTA 5CKAA 1VA9A 5EZIL 4HIEB 5FHAH 3HZMA 3RA7H 1S7WB 3G6JE 1F45A 3VFSB 1G7IB 2Q86A 3EFDH 1FE8H 3TV3L 3LDBC 4L8CB 2IAMD 2XICA 4DJMA 1LO0L 2HFEA 2Q6WB 4RFOL 5D7SH 3QCVH 4N5EC 4QNPF 3DETC 5L2KD 5GGTA 5F97E 2DN7A 4IRJD 4OI7A 3E6FB 2VMFA 5DJ0B 5TE4H 4JY6B 3TYGL 4LKXA 3CNKA 4OTXH 5CLTA 3FN3A 4D0BB 3RIAK 3EO9H 4QHMA 4OGAC 5HGHB 3L3KB 4QRRE 1TZHB 5ILTL 4KHTL 3TYFA 1VADA 2AJ3A 4GQ9L 3LSOA 1NSNH 3HE6C 1CCZA 3LRSB 2R39A 5IBTL 3GBLA 4ZUUA 2PXYA 2QHLA 4R4BA 5FECB 4Q6YA 4LKCA 3WUWB 2JCCB 5I30H 1X7QB 1A1NB 5HI5D 2B0SH 4FZEL 3DX7A 2ZG2A 3MRFA 4XPAL 4P2QD 3VH8B 4OZFG 4D0CA 4FQXC 4ZS7L 4ISVA 5DMGC 5DRWA 3BP4B 1II4E 3UTQB 4FXLA 4QRQA 5D6CA 3RIFF 1K9TA 1WF5A 2HFTA 5HPMB 3GBML 4PJBF 2XV6B 4BQCA 3BPOB 4O5LH 3NCEB 1HEZA 3MGAA 3AU1B 1UGNA 4L4VA 2IAMB 4Y4FA 2PCPA 3ETBF 4RGOL 3P73B 4CMHB 5IHBA 2J2ZA 4ZNEE 2ITDA 3FB5A 4A6YA 3CFBA 3F7QA 1A3LH 1ACYL 3KXFE 4QO1A 4ZMAT 5JPMB 4ENEC 4H8WC 3WFZA 3ULVL 4XVUD 4KZEL 1OT2A 3DSFH 3T3PF 3UZEA 1EAPA 4G9DA 1EBPA 1LE9B 2NX5E 4BQ8A 5EZOL 5E08H 4MXWH 1LEGB 4BKLA 1UVQB 3CDFA 4HBCH 4ODHL 5EULV 1W72L 1A1OA 4NQEE 2Y06H 4JLRA 4IDJH 2A74A 1C08A 5LGJA 3QDJA 1FIGL 3PWNA 1MOEA 4E9LA 3DBXB 4LNRA 4PFEA 2A9NH 3GMQA 4YHMH 3U7YH 2VXSL 4GKOA 5HJ3B 4LLVB 4ONHB 2EDDA 3STZA 2CRMA 1B0RB 4KWUA 2B39A 3MGOB 4P9ML 3QT2A 3GMRB 3QEUA 4P2QB 4D9QD 3TZVA 4XCCH 1QR1A 3WKMH 4HIHB 3D3VE 3CCHB 2GIYA 1JWSB 5JMOC 5E8DL 1SHMA 1CDBA 3SDAD 1S8DB 1I1AA 1JWUA 4JRXD 4CMMA 3WS6C 2VWEC 1NAMB 2M8XA 4H26B 1WICA 1VFMA 5JTWA 1KCSL 3I02B 1NANI 5IW6A 1LO5A 1OPGH 2IPUK 4PJ8B 1KPVA 4XZUB 5BS0A 2HMIC 1VEMA 2PR4H 3E3QC 4FFYL 1LO4H 4EDXB 3MUJA 3BD4A 2AKRB 2HRLA 5DMJB 5DGQA 5EU7E 3TBYA 1WGOA 2MNUA 1JHTA 4Q7DA 1A6TB 2UY6A 4L4TE 2OQJA 1YN6B 2XA8H 2NY1D 1NEZA 5D71L 3BP5A 3PL6C 4LVHB 1WAAF 1QEWB 2XN9D 1G7HA 4P2RA 5I74C 4ETQA 2ESVA 3SN6N 1LNUB 1TDQA 3X3GH 4WNQB 5L9DH 4ZAKD 2OR9H 5I1CL 3B5GA 2Z31A 1WFOA 3S37X 5IB4A 4YPJA 4GRWF 4U1LA 3G6AB 1K4CA 5D9SA 3ULVE 1WBZA 3QQ4A 3NZ8A 2UV3A 5FV2A 2YKLH 1IC5L 3S6CA 3KLAB 1ROWA 1B2WH 3WXVL 3HE6B 2QQLL 4Q0XH 2YC1A 4PJ5D 1R5WB 5CJOL 3DXAD 2YHGA 4MA3A 2JJTA 5GSVA 3LB6C 4KTYA 1OAXL 3VWJA 3ARGA 3BHBA 1KTDB 2NZ9C 5CMAA 5JOFB 2HLAA 5C9JB 4UQ3B 5DUBB 5D2NE 4DCQA 1KJ2A 2DM4A 4XPBL 2D4DA 4FQXB 3ARYA 1UWXH 3C2AL 2P5ED 5JPNB 2YN3A 2OL3B 3HZVB 1VACA 3VFNA 3F5WB 3UJTH 1BBJA 4X9GA 2R8SH 5CEYB 4HWBH 3S37H 1ZHLA 2YPLE 4HCRA 5HGAB 1C7TA 5C6WH 4PJBA 2XN9B 2ADJB 4I0KA 5KS9B 2R1YB 3W11C 3GSRA 2P5WA 2BVYA 2YA2A 4KY1H 4C4KT 1KIPA 2HT2C 2CIKB 4QOKA 5CJQL 3RVWD 2DDQL 4LDEB 4I3RH 4HT1L 5DVNA 1MCIA 3ARBA 5H8DA 5GS0L 12E8H 1EIBA 3V4PH 3MV11 3CU7A 3NA9L 4YHPB 4ESKA 3ILQD 3Q3GA 5EZIH 1MRFL 4HFUL 4WI9A 5FA3B 4G5ZH 5JA9A 3I6LE 4QHNA 4GW4B 1JGEB 1W0WB 2HJLA 3DXAB 3PP3H 4P5TA 4XVTL 1MJUL 1PY9A 2QADC 3TV3H 1AY1L 4YHNA 1ZLWK 3MJGX 4E41D 4J2XA 4XP1L 4QHKJ 1YMMA 2H32B 1J7VR 2EZ0C 4RFOH 3SJVD 1JPTL 5HHOD 5DZLA 3UTZB 5J4MA 4X6CB 3VI4E 3MREA 4HKXB 4P57B 2QKIA 4IMKA 1S9VA 1G84A 3C9NA 4EN3D 4P23A 4WDIA 2YUWA 2P5EB 2X44D 1IEAA 2RIKA 4YPGB 3QZWB 3GEWB 3TYGH 3HMXA 4RZCA 2EECA 3RQ3A 2H26B 3KJ6L 5JW4N 1T80A 4KHTH 3VG9B 2CKBL 4U7MA 4AZ8A 5IIEB 1ACZA 5DRZB 3O2DL 3DVGA 5E6ZA 1RIUL 3D87B 2ZZUT 5EC1B 3P0YL 3SHSA 2CQVA 4H20L 4C56B 4G6AC 4KKLD 1UQSA 1ZT1B 1T21B 4WUUE 4MDIA 3O45A 5BRZA 1TZIB 3C8KA 4Y4FC 3PWUA 4FZEH 3U2SA 4OFKA 2Y36H 4XPAH 1L7TH 3SCMA 4RAVA 4ZS7H 4BZYA 3T1FA 3W39A 2B1HL 4PJAA 3VD4A 1MI5D 2APVA 5ACLA 1UZ6E 5FDWB 3VFRB 4MQTB 2MTPA 4F15C 3UPRB 3IAPA 5K93A 5E70A 3GBMH 3U79A 4TSBL 4E41B 5IEHA 3M8OL 1FZJA 1H15A 3SJVB 2XWTA 1MIML 2R1WA 2PW2A 5FYJU 4G80A 4FQHB 2PTVA 3AGVA 3CFIC 3PHOB 4GMSL 4EN3B 3P0VH 5C07E 1QFUL 2FBOJ 4YIQA 4GSDH 4PBVC 3G5ZA 1TLKA 2V6HA 4QCIB 4JR9L 4NBXB 3SDCA 1RZKL 4ODHH 4DK3A 3L7EB 1W72H 4XWGL 3TZVC 5C0FA 2AJUH 4K94L 1VENA 2YD2A 2FL5A 1FIGH 4PJDA 1HDMB 4TPRL 5C0RL 4PRHA 3ROOB 1I1AC 5F9DC 4U49A 1AH1A 4RRPG 4HUKB 2PXYD 4K2UH 3MA7A 1M6OA 3NIGF 3MRDB 4JM4L 3ORJA 4Y89A 1N5YL 3RGVA 1EAJA 4OB5H 4ZOAA 1P7QA 2O61A 1ZKAA 3RWEB 1MI5B 3S3SA 3VXMB 3QH3A 1EK3A 3T65A 4PLJD 5E8DH 4F58H 2X42A 1CI5A 3C6LD 4DVRL 3GUTB 5FB8A 3HZMB 4MAYD 3PQYE 4WI5A 1VKXA 2Q86B 2XWJA 1KCSH 3TT3L 3HI6L 2FIKA 4L8SA 4L4VD 5E8NA 3P4OA 1YMHA 4GQPH 4FFYH 5EU4A 3WNKA 3ZSSA 4FQPA 3ULUF 4KPHL 2Z31C 4FQLH 3SGKC 2J12B 2QQNL 4LKXB 5D71H 4AENA 5I1KL 1CDGA 3LHPL 3KLSA 2C4FU 1TITA 4QHMB 3KPNA 4ZQKA 3DX8A 3TYFB 3CH1A 1VADB 1OY3B 2AJ3B 3LSOB 2VUOA 1RURL 1WZ1L 2ZUVA 4W6YB 4U1SA 1ZA3A 2PXYB 4R4BB 5I1CH 2EDNA 2YN5A 4LKCB 3VWJC 4X9FA 5E94A 3WS3A 3ARGC 5F70A 4MA1B 4KHXH 3RZWA 3MV8D 3DX7B 1EHXA 4POUB 5E03A 5DHXB 3MRFB 2CIIA 1IC5H 2VISA 4UIMA 4D0CB 5JORA 4ISVB 1E6JH 4X6BA 35C8L 3WXVH 1OWRM 1XF5A 5DRWB 3RU8H 2QQLH 1I9EA 4QRQB 5CJOH 5EU5A 2DQFA 2BFVL 3C5SA 4JFED 2GJZA 1CYGA 1BP3B 2EICA 1HEZB 5C0AE 1V7NL 4L4VB 3I75A 4Y4FB 4OLEA 2PCPB 1KG0A 5DQJA 2ITDB 3FB5B 4A6YB 2YBRA 3BT2H 3CFBB 4XPBH 3Q0HA 3ESUF 1HWHB 3C2AH 2YXMA 3OQ3B 2V9TA 4MXVF 3O6FA 4LDLB 4ZODA 4PJ7F 2VDML 5GZOD 1DQDL 5ICXA 1KV3A 3ARBC 4UI2A 4RBPK 4RGMB 1EAPB 4G9DB 4HIJA 3LN4A 4BKLB 2H8PA 1F4AA 4L3EE 1CIDA 4G6JL 4UOJA 1A1OB 4KU1A 4JLRB 2YWZA 2A74B 5IBUB 4OT1L 1C08B 2ATPA 2GT9B 5LGJB 3QDJB 3PWNB 4LNRB 3GMQB 2DDQH 4P2RD 4FFZH 5DO2C 5E8PA 3BGFB 5MENE 4LCCA 1FV1B 4YH6A 4HT1H 1LE5A 4KK6D 4ZDHA 1I1FA 3STZB 2HH0L 2JB5L 4LMQI 5CD5D 4S1QL 1ZT7A 4IMKC 1UEMA 3NA9H 3QEUB 3TZVB 3QDGD 2XT1B 3I3EA 4G6KH 1FAIL 4XVTH 5ALBL 1AY1H 1TZGH 3E6HA 2VZVA 5BMFL 3WXWL 4F7MA 4FMKA 1D5MA 2R9HC 1I1AB 5I16A 1JPTH 2LFGA 4CMMB 5D1ZD 1N6QL 1FLTX 3CK0H 4R3SA 3IDXH 4KXZH 4MJIA 2X1PA 3OXSA 5IW6B 4GKZA 3BRDA 5FYKD 4KDTA 1LO5B 3T8XB 2NXYC 1A9BA 1KPVB 4KI1A 5BS0B 3QDMA 4Y0GA 1BREA 4AEIL 1M1SA 4F33A 3KJ6H 2HKHH 5ECJE 3TBYB 2CKBH 2RGSA 3O2DH 3SCMC 3ZKSD 1JHTB 1RIUH 4X7SL 1PKQE 4MZ3A 2NY0D 4S0TD 2OQJB 2Y5TB 2E8ZA 4H20H 2HFFA 1NEZB 2HT4C 3BP5B 2KKQA 1Y0LA 4KI5C 3WDIA 4XNXL 1G7HB 4P2RB 4ETQB 3LKRA 2ESVB 4MJ5A 1A7PL 4KKCD 4NHCL 3V9FA 2PNDA 2PYEA 2Z31B 5I1HL 1T1WA 3UZVB 1RZ8A 5IB4B 1YPZE 3L3DA 4U1LB 1RZ7H 1K4CB 2B1HH 5D9SB 5HYJA 1WBZB 3QQ4B 1DLFH 1FVDA 3NZ8B 2FHFA 3WIHA 5JW5A 3FMGL 2R2BA 4KTEH 4YK4B 4TSBH 1MQ8A 3M8OH 3SDCC 1H0DA 2YWYA 3ARRA 3LRGA 4UT7L 4NM4L 2H45A 1DBAH 5E1AA 5T5NF 2YC1B 4WENB 3QCTL 1MIMH 1HXMB 4P0DA 2KUTA 1WWAX 2FX8H 4TN9A 1JHLL 1F4XH 4YDKH 4MA3B 5GSVB 4GMSH 3VWJB 1QFUH 3ARGB 3BHBB 2FEDD 1IGFL 3D48R 5CMAB 1W8NA 5C0JA 3BD3A 1X5HA 2HLAB 5GRVK 4HUUA 4PJXF 3LKOA 3FQTA 4DCQB 1KJ2B 5CAYB 1TJIL 4N0YL 4JR9H 3RGVC 1RZKH 4P23D 4MCZA 1AQKH 3QQ3A 4XWGH 1VACB 3VFNB 1CFVH 2NY0B 4HDIA 4MNQA 1BBJB 1UC6A 1LDPL 2BZDA 3K81A 4TPRH 1ZHLB 1T66C 5C0RH 1TENA 1OM3L 2XRAL 4PJBB 3HZKA 1BIHA 1J0JA 5SWZD 3TWCH 2VE6A 5F93C 4ELMA 3BKJL 3GSRB 4WWKA 2P5WB 3KLHC 4MD5A 1T1YA 4JM4H 1AO7E 1H3PH 1FYTD 1KIPB 1J86A 4L8SC 4QOKB 1L9NA 5BRZD 3LN5A 1ZEAL 3KG5A 4AYFA 1DQQA 3MLSL 2XZCL 4X6DF 1FIEA 5HHME 2W9EL 4XXCC 3IDYC 2P49B 3D0LA 3Q3GB 5AYUH 4MA8H 4JFOA 2R56L 4JRYE 2ZP0T 1NFDF 4QHNB 5I1EL 3KPPA 4LP4A 2HJLB 3TT3H 3HI6H 4HWZA 4P5TB 5AEAA 4OLUL 2BSTA 4YHNB 1DANT 1YMMB 2QV2A 5E4IA 3ZO0A 4JO2L 3MREB 2QKIB 1QD0A 5J1AB 3C9NB 4HZLA 4P23B 5JW3L 4BQ9A 1IEAB 3IU3A 3CMOH 5I1KH 4RZCB 3LHPH 3HG1A 3U7WL 3BP7A 5CBEA 3BAEL 1I9IH 3TJHA 1PW3A 3DVGB 5D1XA 3NMEA 4EZMA 4X9HA 2KZ1B 3H3PL 4GKNA 4X5XA 1DFBL 1FDLL 3VFPB 4YR6A 1UQSB 1FYTB 1A7BA 2IFFL 2NXYB 4MDIB 3O45B 4ZTOL 5BRZB 3C8KB 4V1DE 1WLHA 3PWUB 2OTWA 1EH9A 1H3WM 4LLYA 4WFHE 5ESQA 2MPAL 1U2HA 3ZE1E 4WO4A 3U2SB 4M7KL 3VD7A 3GJFH 3SCMB 4RAVB 2ZPKH 4R4FH 3REVA 3T1FB 2V7NA 3MUHL 3O6FC 3W39B 4PJAB 3LS5H 1WWWX 2BFVH 2X4PA 2Z8RA 4K3JL 4QWWC 1MCKA 5IEHB 4NO0A 1FZJB 1H8SA 1H15B 5DURD 1YEEL 2YK1L 4GAGL 2XWTB 1SEBA 2JJSC 2GSIA 2R1WB 2PW2B 5FYLL 3GMOA 3RVXD 1EVTC 3GNML 3Q6FA 2D7OA 1MFDH 3MBEA 4GRWB 3ZHDA 4YIQB 2VDMH 3BPNC 1L7IH 2ZOLA 3G5ZB 1RK0A 3FFDA 3SDCB 4RGNC 1MCOL 4G6JH 1GGCL 5I8KL 1B6DA 2AJVL 5C0FB 4NZTL 4OT1H 4YHKH 5DQDL 1T6VN 1RUAH 1P7KA 1YJDC 1JFMA 4PJDB 3MOBL 3AFLA 4PRHB 4LGPB 1AR1D 2R69L 4NFDA 1E6OL 3ZKXC 2JB5H 1M6OB 3RGVB 3VRIA 1E4XI 4KDTC 1Q9KA 2O61B 1FAIH 4LBEA 5FK9A 2IG2H 3QH3B 5ALBH 3T65B 3GKZA 1F2XK 2DBJA 3WXWH 2UZYB 5DURB 5FCUL 3FAXA 4HUXA 5FB8B 2R0LL 3STLA 4N0CD 3BXNB 2E7MA 1JGVL 1FNSH 1CICA 2EXYC 1VKXB 4NJ9L 2A6JA 2AV1A 2XWJB 1FCCA 1SYVB 3LPFA 2FIKB 1J9CT 4L8SB 1QNZL 1AC6A 1L0XA 1J05A 3P4OB 4P3CL 1YMHB 2Q87A 5KJRL 4AEIH 5EU4B 4OF5A 5DJAA 3QNXA 1J8HA 4WV1A 1YC7A 3H9SD 3IDYB 4X6FA 3VXOA 4D9RE 3V0VA 5I1DA 1HK6A 1N0XL 4AENB 1DBMH 4P4KA 5KVFH 3WHE0 3KPNB 5IHLB 4ZQKB 3DX8B 4MQSB 1XF3A 3CH1B 4XNXH 3SQBA 2EE3A 1BJ1J 5FEBA 2VZSA 3WO3B 2OZ4A 4L5FH 4AMKL 5FO8A 3VFTA 4XT1C 4U1SB 1KTRL 1ZA3B 4NHCH 3AM8A 4NRZA 4QXGL 3V7AE 2AK4E 3P3YA 5E94B 3WHXA 1V7ML 3WS3B 3VI3E 1J5OH 5ANME 1N6UA 4OZ4A 4XXDA 3FMGH 5J3HC 2CIIB 1DUZA 1YA5A 2VISB 4UIMB 4TULH 5JORB 4UT7H 3JVGA 4X6BB 4NM4H 3OWEA 2WP3T 1XF5B 1SBSL 4BJLA 3BEVB 4JFQB 4OFPA 3RNKB 3QCTH 5EU5B 2DQFB 3S35L 3C5SB 2GJZB 1JHLH 4KC3B 2YD1A 5L8KB 1AFVL 1IGFH 3I75B 3V6FA 3M17A 5IOPA 3W9EA 4DN4L 1KG0B 5DQJB 3NCJH 1TJIH 4N0YH 2YBRB 2E3VA 1EGJH 5DD0L 3QDMD 4NQCA 4YZFE 5HHXL 3RIAF 43C9A 3O6FB 1BWMA 1IL1A 4L9DA 1VGKA 1ITBB 5ICXB 1JP5A 5J9PA 2DYPA 5E2UH 4HIJB 1OM3H 2XRAH 3LN4B 2H8PB 1U8KA 2EE6A 2XIDA 2CPCA 5A40E 1JYWA 3MV7A 3GSXA 2JK5A 2ATPB 5L2JA 2H2SC 3OKNB 5L0QC 1D9KA 3KNBA 2W1NA 5KAQG 1ODAA 5E8PB 2V17L 4OCXL 4LCCB 2VLJA 1A9EA 1J0YA 1ZEAH 1AD9A 5D2LE 4HAFA 1LE5B 4ZDHB 1I1FB 3MLSH 2VDQH 1S78C 4R4ND 4KK9C 4H1LG 4QF1A 1RVFL 2W9EH 1ZT7B 2PYED 5BV7C 1A7NL 3FQRA 3ULUD 4RGNB 3DVIA 1MFEH 1U3ZA 2WLYA 3N9GL 1CGXA 5A1AA 1T89A 3ARQA 4V2CB 1IQWL 5I1EH 5C0CE 5GJTL 5D4QA 4OLUH 3E6HB 4RDQG 2PKDA 2HKFL 4XPHL 5D1XC 3S36L 4F7MB 2OI9A 1D5MB 5I16B 4KUZL 4HX1A 5C08D 4JO2H 5DD3H 5SX4I 1UM5L 4BSJA 4MJIB 3OAUH 1J12A 4JHWL 2I60L 3OXSB 1U8MA 4GKZB 5JW3H 1KJ3L 5DYOA 4U2ZA 1A9BB 2KQMA 5F3BA 3QDMB 3GGWB 3ULSA 4HBQA 4Y5VA 5F7DA 3HR6A 2QSQA 3V7AG 4F33B 4LHUA 1YEHH 5GZNC 3BAEH 4XWOD 4R97C 4KUCF 1EXUA 5E7BA 3G6JF 1A6WL 4MNQD 3T2OA 2HFFB 3W9DA 2BC4A 1MHPL 1DFBH 5K9QI 1FDLH 1CG9A 5H35A 2FRGP 2P8LA 4JPWL 1FPTL 3ILPA 3GZKA 4ZTOH 4LMQE 5JO5A 3LKRB 4JFDD 1TVHA 3KPRE 1OSZA 5ETUA 2MPAH 4MJ5B 3OF6A 4LPCA 4WWKD 2FB4L 5JNYA 3QRGL 2IEPA 4M7KH 4Q6IA 2ZUQC 1K6QL 2PYEB 3VXNA 1T1WB 1KENL 1RZ8B 3L3DB 1U3HD 1R5IA 5HYJB 3ARSA 4MZ2A 5JW5B 3EJJX 2R2BB 4K3JH 1DVFA 3VG0H 1U41A 1H0DB 4JB9L 2YK1H 3ARTA 5GRUH 2FEEI 3ZTJG 3GMMA 5CGYD 5FYLH 3ARFD 3TVMA 3GNMH 5C0JB 5KVDH 5GGRA 3V6ZA 1T04A 2X40A 4UINL 3LKOB 5HGGS 3FQTB 5IHZA 5JXEA 1JCKA 1Q1JL 4FRWA 3NH7L 1MCOH 1GGCH 4MCZB 5I8KH 2X05A 4U6YA 3QQ3B 5DEZA 2FNBA 3CGTA 5I0ZA 4NZTH 1M05A 4DQOL 4HDIB 4MNQB 5DQDH 1IBGL 2CH8A 2DI8A 3IKKA 5D7IE 3MOBH 3TJHD 2ZCLL 3K4DA 3BI9X 3HZKB 1DL7H 1ONQA 2NXZD 4MB3A 1CICC 2VE6B 1RD6A 4ELMB 4HLJA 4WWKB 4S10A 4MD5B 1BD2D 1T1YB 1ZTXL 1F5WA 4Y4KD 2HWZH 3P4NA 2ZSVB 4ZTPL 5IKCA 1PYWA 1FFRA 4WO4D 1DQQB 3O0RL 2PO6A 1U8QA 3O6LL 4WV1C 3FQNA 4XPTH 5IVOA 3D0LB 1C5DA 1GRWA 3QA3A 4QRPD 5FCUH 2R0LH 4JFOB 1NQBA 2GY7B 1NC2A 2VR9A 1NCDL 4P4KC 3KPPB 2B8OT 2CXGA 2IWGA 3D18A 4KRMB 4PGBA 4HWZB 1JL8A 5L0QB 1ZHBA 2BNQD 3IDIA 4WTWA 3MLXL 5LGHL 4PJ9A 4P3CH 2EDHA 3H9YA 4F37K 5JQHC 2C1PA 3B9EA 3UTSE 1DDHA 4OZFA 3MRMA 5FCSH 2WBJA 3AM8C 3UTOA 5BV7B 3JXAA 3S35X 2CRZA 4HZLB 4I48A 1BX2A 3MBED 3IU3B 1QRKA 2D31A 4J1UA 4O4YH 3HG1B 4BH7A 4YHZH 2BVTA 3BP7B 5IG7A 5CBEB 2Y07L 3MRNB 3TH3T 5D1XB 3GSNL 1JGDA 3NCYS 1LO2L 4LSTL 2NXZB 4AMKH 1R3JA 5I6XC 4G9FE 4GKNB 4X5XB 2L7UA 2HTLC 1G9NH 4QXGH 1J1OL 3FQWA 4OZGE 4PB0L 1V7MH 4NP4L 3RAJL 1R3HA 2F53A 4LLYB 5ESQB 3SGEI 4FQ2L 1F13A 3LKPA 4WO4B 4P46A 2F8OA 4BK5A 3CFCH 4LRNH 1B4RA 2LAGB 2JKXA 4BZ1H 1MRDH 4R97B 3REVB 4M1DL 2D0FA 3NA4A 2V7NB 3QUXC 2E7LE 5FOJA 1SQ2N 4L3AA 2VZ1A 4XPGL 2X4PB 4N90D 3S35H 4U3HA 1IGJA 1RJLA 1G6RA 4J3TA 1AFVH 3MROA 4ZFZA 3A6OA 1IMHC 2IQAA 4ZPTA 4DN4H 1E4XL 1SEBB 2GSIB 3FRPA 3GMOB 2ZUQB 4Y1AA 5DD0H 3MRQA 5FUZL 2F9BT 2XZZA 4ZXBA 5HHXH 3KPMA 3ULVF 1MUJB 1CXEA 3S36X 3MBEB 1VSCA 1Z5LA 1A7OL 3IDJA 1QRND 2ZOLB 3BPCA 5DD5H 1RK0B 1ORQA 3FFDB 3MV9E 4QRRA 5JZ7D 4YDJA 1T89C 4WI4A 4OZHE 2COQA 3ARZA 1P7KB 3D39A 3FAWA 3JUYA 4NNYA 1BQSA 5JOPE 1Q38A 1P7HL 2EYSA 2OI9C 4OCNC 4MXQA 5K9KB 4AT6A 3K74B 3MACL 1A7NH 3VRIB 5HDLA 3N9GH 1Q9KB 4JZOA 1YEJL 3IT8D 4LBEB 2UUDH 5FK9B 1BHGA 1FFNA 5GJTH 3MRBA 3NN8A 1X5GA 1H3GA 4WEUD 5E5UB 1ZLSH 4XPHH 5GRXG 4HUXB 4KUZH 3STLB 2W0FA 1CICB 2Y6SC 2A6JB 2AV1B 4RMWA 4JHWH 2I60H 2W91A 1EERB 2VLRA 4OFIA 3ZTNL 1OWWA 1KJ3H 3KXFA 3QUZA 1J05B 5I17A 1S9YA 4HS8L 4OZIA 4F7PA 2F5AH 5DJAB 2A83A 2R4SL 2FWOA 3QNXB 1J8HB 4WV1B 4AEEA 1S5IL 1P84K 3DV6A 4X6FB 1RUPL 4PJEE 3VXOB 4K8RD 1A6WH 1G9ML 2E9IA 4M93B 4KQ3L 4P4KB 3HE7A 2HJFA 3X14A 4JPWH 1FNHA 1DVFC 1FPTH 1XF3B 3BN9C 3SEPA 1TQBC 5CBAA 1M7DA 2AV7A 3VI4F 4GS7B 5FO8B 2FB4H 1J11A 3QRGH 3VFTB 1K6QH 1D9KD 4NN6C 5AYQA 4N0FA 4NRZB 2HP4A 5DMYA 4JRXE 1P84J 3WHXB 1QSEA 4KVCL 1LP9A 5DJ6B 5T3ZD 1QVOA 5GRYA 5DJCB 5TJWK 1AIFB 5ICYA 1A7RL 3B5TA 4OZ4B 4XXDB 3V8CA 5GGQH 1DUZB 2IPTH 4NKQB 4EOWL 4M4RA 4JZJA 5JOEA 5J6HA 5HHNA 2VNCA 1Q9OA 1UENA 4YXHL 1F3DJ 4OCMC 3V6FB 3M17B 2HYMA 3MRHA 1Q0XL 4GJTB 5GS2D 3S4SA 2EO9A 2X4TA 3W9EB 1KLUA 5IOPB 3P9MA 1I3GL 2XTJD 2X4OA 1B88A 3RUGA 3MO1A 3LQAL 4LK4A 1Q1JH 3OR7A 1CQKA 2D0GA 4NQCB 43C9B 4U0QB 4DQOH 1UZ6F 4KKNA 4UB0L 1IL1B 3CXDH 1VGKB 2Z91A 2W9LA 5J9PB 2PO6C 3GMNA 3PGFL 2CK0H 2A6KA 2ZCLH 4Z77A 3BRGC 1TTUA 1U8KB 3MRIA 4PBWD 4WW2A 4JDVB 4X4ZA 5T3XD 3MV7B 4H0HB 1HHHA 3EO0A 3GSXB 2JK5B 5L2JB 1D9KB 4HJJL 5CJXA 1ZTXH 5EOTA 5D8JL 4ZTPH 2R2CA 4PJ9C 1A9EB 4PJ5E 1AGBA 2QR0A 3IGAA 1AD9B 5IMMA 3OF6D 1F3RB 3RZCA 2FCBA 3O6LH 2WBJC 4QF1B 1DANU 3VXSA 3L3OA 1OTTC 3FQRB 1BFVH 1IC1A 2JELL 2NZ9D 5LAXA 1DCLA 5DD6A 2Z8SA 1R5VA 4MJ4A 1W72A 1NCDH 1J0KA 5DQ9A 5I18L 2OI9B 5LGHH 1T0PB 1WJ3A 4JFFD 4OAWA 3SDDC 3LV3B 3OJDA 4HX1B 2G9HA 5EORL 1SJHA 1RUQH 3TVMD 1KUMA 1GAFH 1TCMA 2VL5A 1U8MB 3OZ9L 2FZ3A 5DYOB 5F3BB 3ULSB 4Y5VB 5E2VL 5F7DB 5LQBL 3W11D 4LHUB 1SMAA 1YNTA 5JXED 1MIEL 2FEEL 2Y07H 3RWCA 3GSNH 3CAFA 1EXUB 4J4PA 4LSTH 1LO2H 3P30L 5IFAH 3W9DB 5F8RC 3PWPA 2BC4B 1CG9B 3MX0A 3I3DA 5H35B 2C3VA 2NY6C 5JHDD 2P8LB 2DWEA 3X12A 4CN4A 3EOYG 4PB0H 3ILPB 1QFPA 2EXWD 5JO5B 3RAJH 1TVHB 1OSZB 5ETUB 1KTKE 2GFBA 2APTA 5JNYB 4LLDA 1H5BA 4Q6IB 3LZFL 3RX8A 1T03L 3SDYL 3VXNB 3IDGA 4M1DH 5E9DA 1X5FA 1FNEA 1R5IB 3VFOA 1PG7W 1MCEA 1A3RH 4XPGH 4XHJD 3OTTA 3OHXA 3GHEL 3RWHB 4B50A 1DVFB 1S7XA 4RRPA 2VUYA 1NFIA 2VZTA 4JQIL 1TQBB 4WFEE 1YC8A 3O6ML 5I73B 1E4XH 1NC2D 3GMMB 4ZO8A 4Y5XC 4K23L 4KJYA 3TVMB 5CZVL 5FUZH 3BE1L 1NCTA 5CP3A 5CCKL 4W81A 1B4JL 5GGRB 1VFUA 3V6ZB 1A7OH 1YEGL 5IHZB 3V7MA 3K7UA 43CAA 5CP7A 3QWRD 4U6YB 2O5YL 4DZBB 3LOWA 2R0WH 2IJ0C 2YD7A 1M05B 1NCUA 3VD9A 1HH6A 5BOZG 2OL3H 3MV01 1QLEH 3DI2B 2FGZA 2WMPA 1P4IL 2G60L 2IFGA 1OP5K 4WUUA 4ALAH 5B3JE 1Q9WA 4IEFB 1ONQB 3DUHA 4P4RA 1RZIB 4RISL 1TTGA 2APBA 1UG9A 2ZWLT 3MACH 4HPYL 5EOCJ 1TMCA 3ALXA 3QUZC 4JO3H 3P4NB 5IKCB 2F53D 1YEJH 3OKDA 1PYWB 1XZ0A 1GC1L 4OGXH 1ZMYA 4GAYA 2V7HA 2PO6B 1U8QB 3FQNB 4UZGA 4PGJA 4M43L 1C5DB 3QA3B 4KUCD 3HKFA 3QAZC 1NC2B 3WBDA 3D18B 4PGBB 1YYLH 1ZHBB 3IDIB 2QTEA 3ZTNH 3FOMA 4LVOC 5L7XL 4PJ9B 3T0XA 4HLZH 3RHWK 5BO1L 3MLVH 4U1NA 2C1PB 4FTVE 1DDHB 4HJ0D 4OZFB 3NCBB 3MRMB 4PR5A 2WBJB 1U91A 1S5IH 2C3HA 3GHBH 2ZJSL 5F7YC 4ZXBD 4I48B 1BX2B 1W8OA 3QG6A 5GISL 4NJAL 1RHHA 3QQ9D 1F4WL 2D31B 4J1UB 4AL8L 4KQ3H 1T0NA 5K9JL 4BH7B 4FHBD 5DS8A 3WLWC 1PAMA 5IT2L 4ZPVA 1D5XA 5IG7B 1BF2A 4QRRD 3UC0L 1ZK9A 4M48L 2O93L 1INEL 2H2PC 3PUCA 1CXIA 4JZJC 1OGAE 2B4CL 1JGDB 4XNUL 3OAYH 3T2PA 1R3JB 2P8MA 5F72S 3NCMA 2FYYA 5GGVL 5T1DL 1QTYT 3FQWB 3ARXA 4KVCH 4MXQD 2AXFA 1R3HB 2F53B 4Z18A 1YY9C 4S11A 1QHOA 3LKPB 4P46B 4PG9A 1Z9MA 4E0RA 4N5UA 4EOWH 2WK2A 1K3IA 2CKBA 3WFCL 3O2DA 5F8QC 3LQZA 3PQYA 1BZQK 2VZ3A 4NNXA 5K9QG 3DYOA 3IJHA 4K3EH 1IGJB 1RJLB 3HC0A 3MRCA 1G6RB 3MROB 4YBLB 3GKWH 4ZFZB 1Q0XH 2DRUA 4WW2C 1I7UA 3A6CH 2IQAB 2ZCHL 4ZPTB 5F6IC 4HXBH 4OCRL 3PV7A 4Y1AB 3LQAH 5M94B 3WUZA 3B3IA 3MRQB 3KXFD 1YPZF 5CJXC 3ERYA 3KDMA 2VQTA 4ZXBB 3KPMB 2FJGA 1JF5A 5DUPH 4AEHL 4UDTA 1Z5LB 1T6WA 2XQYK 4OQTL 3RZCC 2A77L 2XQYG 3PGFH 1ZHKA 5IB1A 1ORQB 2NX5D 4QRRB 4GXVH 4YDJB 3OJMB 2B1AL 4NQED 1DUYA 3D39B 3EUUA 3HE7D 4HUMB 4NNYB 4MSWA 4NN5C 2E7HA 1HINL 3ZDZE 3K1DA 3G5YA 4HJJH 2EYSB 5C71A 2YA0A 3KPOA 4NNPH 1CLOL 1R3LA 1RZGA 4PJFE 5D8JH 3IFNL 1CLYL 4WIQA 3BUTA 2RR3A 3HI1A 4AT6B 2LABA 4HJGA 3NAAH 4PRIE 1VDGA 2MCPL 4UBDC 2AJXL 1ZHNA 4JPIA 4JZOB 1KBGL 3EDKA 3SE4A 4ZO7A 4Y4HA 2D7MA 2VXQL 1FFNB 2C7UA 1H3UA 2QLVB 3D3VD 3MRBB 3NN8B 5I18H 1P53A 4RA3A 5C0AA 4NCC2 4J4PC 2W0FB 5EO9A 4HWNA 3NGBC 5EORH 3MNZA 2VLRB 4I3SL 3MLYH 3EYQC 2OXGA 3KXFB 4X8JA 3QUZB 4XTRC 4WEMB 5I17B 5TQ0L 1IJ9A 5E2VH 1AXTH 1S9YB 4OZIB 4XC3H 4F7PB 2A83B 1H5BC 2FWOB 1MIEH 2MKLC 4WI3A 5GGTH 4ODSL 3DV6B 1FG9C 3O4LE 5HI3C 3BZDA 3P30H 3QAZB 4L4TD 2Q8AH 1EMTL 4L8BA 1UM4H 2CLZA 5HHPA 4EBQL 3HE7B 4PJCA 2HJFB 3X14B 2HTKC 3ZLQC 2X1OA 3F7PC 5I9QC 4LVOB 5CBAB 5MENA 3SKMB 1M7DB 2AV7B 4N8VG 2EYTA 4NCC1 5ACZA 3HAEG 3B5HA 1GOHA 1U6AL 3LZFH 3SE8L 3U30C 1T03H 3NPZB 2XA3A 4M1CC 4N0FB 1N7ML 1NCAL 2R9HD 4JO4L 1QSEB 1LP9B 3TBTA 3U6RA 4R2GC 1QVOB 3AS2A 3ULVD 2A0LD 1Z6JT 5ICYB 3GHEH 4X4ME 2R4RL 3GI9L 2EC9U 5I1JL 4XVSL 5IWLC 4JEGB 4JQIH 4JZJB 2X7LA 4J23A 3SE3C 5J6HB 5HHNB 1Q9OB 4EXPX 5KW9L 5L8JB 4S1RL 4OCSL 3ZKND 4JCMA 3BE1H 1CGUA 5CCKH 4UU9A 1XR9A 3NPSC 3MRHB 4Y2DC 3MMEA 1B4JH 3ZE1F 3S4SB 2X4TB 4JPKL 1KLUB 2E27L 3P9MB 2H1PH 1YEGH 2X4OB 5J1SC 3WIIH 3RUGB 2DICA 5F9OH 3MO1B 5MEOA 1OAQL 1U8IA 5KSAD 1WSST 3OR7B 5E7FA 1A7QH 2O5YH 3GJFA 4RWHA 3NFSL 4A6YH 1PKQA 2VRAA 3VFVA 4P48A 2Z91B 1CBVL 5HVWA 2DLGA 3GMNB 5HHQA 2YPLD 3C6SA 2A6KB 3WV0A 4Z77B 4YFDB 3MRIB 4FZ8L 4WW2B 3O81A 2DL2A 1HHHB 3EO0B 4OLXL 4HPYH 3K8KA 1HSAA 3ARDA 3C09B 3N1FC 1A6VL 5EOTB 3INUL 2MCG1 3IRPX 5ADOL 1AGBB 1U8NB 3IGAB 2QR0B 2EDTA 5IMMB 1MNUL 4HMCA 4NC1E 4WFFD 4GO6B 4NFCA 3RZCB 3OR6A 3VXSB 1I8IA 3L3OB 1VESA 3BQUD 4UUJA 5CFHA 2Y72A 5LAXB 5DD6B 1OW0C 1R5VB 4M6OL 3I6LD 1W72B 4LSPH 4R7NA 1FSKC 5C3LD 4WHYG 3ELAT 5DQ9B 4XBEH 5HI4C 3OSKA 5A2JH 3TESA 2DQJL 1MCWW 5AUMA 4XC1L 4OAWB 3R4DA 5BO1H 2XWBB 3OJDB 3QEQE 2G9HB 2FX9L 3FO0L 4DUWA 5BQ7A 5ITBH 1SJHB 2ZJSH 2VL5B 1C12B 1KCVL 2FZ3B 4K3GA 2OLDA 2X10A 4KROC 5IHUL 4AL8H 3ABZA 5K9JH 3EOBA 4OD2A 3UC0H 4M48H 1INEH 1XGYH 1CU4L 2EYRA 4XNUH 2YPKA 3JWNC 1A6UL 5KAQF 3NGBB 4FG6D 4JAMA 3PWVA 4LSRL 5GGVH 5T1DH 2SEBA 4JDZA 5E6ID 2C3VB 1AO7A 1I9RL 3PWJA 4Y2OA 2DWEB 3DHJA 4WUUD 1EUUA 2ZG1A 1QSVA 2GFBB 1ZLUK 1FVCA 4M9PA 4LLDB 1H5BB 2UVEA 3PABA 3T0EE 2D0HA 5T33L 5IROC 3IDGB 2YR3A 3WFCH 5E9DB 1VFAA 1FNEB 4RDQF 3VFOB 3PXJA 4KTDL 3ZDYE 3OHXB 4PLKD 4FABL 1S7XB 1KXVC 1NFIB 2ZCHH 4ZUVA 3O9WA 4YC2C 5DVOA 3U30B 2UWEA 1H3XA 3B2VL 4KJYB 1GSMA 3WYRA 1HSBA 3VI3F 3C5ZA 5CZKA 5C07D 3K80A 1QYGL 4R2GB 2AP2A 1OAUL 5FYKH 2A77H 1IVLA 4EIZC 4AIXA 5GS0D 2XYCA 4FFVD 4NN7C 1QPPA 2JJUA 3D1MC 5D72L 1V3LA 3C5JA 1N4XL 1EHLH 2EC8A 3BUYB 43CAB 5CP7B 2B1AH 1RZKC 4ODWA 3ESVF 1HH6B 4W70A 4Y4HC 5IF0A 1F90L 2B2XH 5EZLA 4HWEH 3DSNA 1HINH 2HAZA 4M1GH 1ND0A 5M95B 5B38G 4L9LC 1CLOH 2OR8A 4WUUB 3NPSB 1CLYH 1Q9WB 4XBGA 5DJDA 4OI8A 4FQ1H 4P4RB 4BSVA 3U0WH 1F02I 3HB3D 2AJXH 1TMCB 2J3SA 3IDMB 3TT1L 4XMKL 5I0DA 4MNGE 4YZFF 1KBGH 1JRHI 1S5HA 4NQDE 4M7LH 2EIZA 3OKDB 1XZ0B 2BY2A 2WWKO 2VXQH 4B7IA 4NIKB 4GAYB 2V7HB 1D6VH 3CSGA 2DQUL 4S1SL 4CVUA 5A3ID 3JWOL 3SBWA 2K7PA 3PQYD 1A47A 2ERJC 5JXAL 1CL7H 3X17A 3FOMB 3C8DA 3U9PL 3H42L 3B9KA 2LTQC 1EFXD 4O02H 5D2LF 4UNUA 4U1NB 2NW2A 1D5ZA 3TH4T 1KOAA 1NGPH 4PR5B 5FGBA 1INQA 3ZSTA 1U91B 4PS4L 3WFHA 4ODTH 1ED3A 1OTUC 3QG6B 2K1MA 1RHHB 4U33A 1DN0A 4JO1L 3QXAA 4G42A 1T0NB 4EBQH 1FSKB 5DS8B 4ZPVB 1D5XB 3EYFB 4M62L 4XGZA 3OGOE 4BELD 3FZUD 3T3ME 3SE8H 4E42A 2P8MB 1MHHA 2BHUA 4XNZC 1N7MH 1WEJH 4XAKE 3BRFA 1E0OB 3IRZA 3VXRD 1KCLA 3RL1A 2AXFB 1ZLVK 2R4RH 2C9AA 1U3YA 4PG9B 4E0RB 2E6QA 5I1JH 4XVSH 2EH7L 5IV2A 2CKBB 2NPLX 4KK5D 3LQZB 3PQYB 3QQNA 1CDJA 3K2UL 4Y16D 5KW9H 4NNXB 3F7YA 3IJHB 2XTLA 5J57B 4OCSH 5I8EB 4LARL 1FAKT 3HC0B 3HNVH 3MRCB 5KSBE 3QUYA 3J8F7 4XP5L 1PSKL 4H1LA 4JPKH 5SWSA 2PW1A 1V5JA 5D7JD 3O4OB 2A9ML 3ARDC 1OAQH 3FO1A 3I85A 3B3IB 4XI5D 2J5LC 2VLKE 4U0RC 2CDFA 3KDMB 3V79C 3NFSH 2FJGB 5ENWA 4XP4L 3GI8H 4NWTH 1CBVH 4UDTB 2WLZA 3RVVC 3EAKA 4GRWH 1IILE 4ZUTA 5IB1B 1ZHKB 3G5VA 3MRLA 1AI1H 3WFEH 5E24E 3TO4C 2CMRL 3UTTA 3TIDA 4L3ED 5TQ2H 2VZOA 3PHSA 1DUYB 1GGIL 4F57H 3V52L 4MSWB 3GK8L 3JV6A 4L29A 3G5YB 1A6VH 5D93B 5CWSA 3INUH 3KPOB 1R3LB 1RZGB 1G7QA 5MEND 1YEDA 1NEUA 1MNUH 3HI1B 5CJ5A 1JZ4A 4HJGB 2X89D 4RX4A 5MP6L 3P4MA 3AB0C 4D94A 3ZKMC 4I0PA 1ZHNB 5TF0A 3ZE0E 4JPIB 3C2SA 4MJ6A 4Y4HB 2C7UB 5D7IF 5IGXH 1Y18A 3OBAA 1NLBL 1KIUA 2DQHL 3ZYJA 4XC1H 5C0AB 1PEWA 1A4KA 2FX9H 5EO9B 3V5HA 3MNZB 3DMMA 1N5AA 3OG6B 3T0DA 5HGBA 3MOQA 4MWFA 4X8JB 3MJ6A 2W9DH 2RBLA 4XCYA 4NUJB 1FJ1B 2EDWA 1TQCC 2NY7L 3MODL 4KRPD 1MH5B 1HHKA 4I4WA 5IM7A 4KJQC 1NCBH 4L8BB 4AH2A 2ERJB 2AJSL 2CLZB 4LSRH 4N0UA 5HHPB 2VERN 4PJCB 4YDIH 3QXWA 2K3TA 3SDXE 3S97C 1BOYA 1I9RH 1EJOL 4MVBA 1HYRC 1Q72L 3A6BH 4K9EL 5MENB 5FAAA 1CTNA 5ACZB 1X4YA 3O9WC 5I1LB 5F1NA 5T33H 3EFFA 5B39G 5C92A 2KBGA 4F7CA 3C5ZC 3J7HA 4OBSA 3TBTB 3U6RB 3FFCA 1JPSL 3QG7L 1BMGA 3ME0A 1IC4L 2IF7A 3CH8A 4WI8A 4WWID 4BFEA 2X7LB 2JB6A 3DECA 1SM3H 4YHYB 5LXGH 3C60D 1OF2A 3B2VH 4XNZB 1JMXA 4OZGF 1REIA 1TJGL 1QLFA 2OR7A 3QFJE 2VLLB 1QYGH 4UU9B 1XR9B 1A22B 3MMEB 4C57C 2I25N 1OAUH 5D1QD 3UYRH 4RMVA 4KRPB 5D72H 5MEOB 3U0TA 1N4XH 1U8IB 2E6JA 4WTZA 3Q2CA 4JFDE 2HLFD 3BIKA 1PKQB 3VFVB 5FUCC 3CIQA 5HHQB 2IANA 3C6SB 3LEVH 1GXEA 4GMTH 3I6KA 2XXMB 4MXVE 1JNLL 4PJ7E 2VDNH 4S2SA 5HDBE 3I2CH 3WFDL 1IZKA 25C8L 3MSPA 1AO7D 1HSAB 3ARDB 1IM9A 1QFWI 2FH6A 2J5LB 2JCCE 4QHLA 5TFSL 4DAGH 1C7SA 3B9KC 3UMTA 4RNRA 5SX5H 5CEZE 3CVIH 1R24B 3V5KA 2NY3C 5FGBC 3OR6B 2F5BL 3BGMA 4ONGH 1I8IB 4P2OA 5HHMD 4UUJB 2PYFA 1KGCE 4NSKA 2IBZY 4OZHF 4WI6A 3VE0B 4JRYD 1UFUA 4PYHA 4OF3A 1I3RA 4KKBD 5T5FL 1J0IA 4R7NB 4N1EA 5JXAH 1JN6A 2CUHA 5AD0A 1GJIA 3NACL 3BH8A 5AUMB 3U9PH 4KGLA 4CN1A 3CFDA 5IESL 5BQ7B 1TTFA 1NCCH 4PLNC 3ZHKA 4P9HL 4PS4H 4GAJH 5MEQA 2GKIA 5C0BE 2BJMH 3H7BA 4Z9KB 5T1KD 5F7NC 2EH8L 2UUDK 4JG0L 2AEIT 2A38A 4PP2A 2FHBA 3THML 3EOBB 2CGRL 1OARL 3CSYA 4OD2B 4NUGL 4M62H 5TF1H 2EYRB 4N8CH 2YPKB 2C5DC 5CIPH 3BISA 3EJYD 4HUVA 3VA2C 4JAMB 3PWVB 4HGWA 2SEBB 3V2AR 4JDZB 5J7CC 3Q48A 1AO7B 1KLFA 3HLAB 3KWWA 3PWJB 4TYUA 1S7WA 4X7DC 4V1DD 3GM0A 1T5XA 1XIWD 3ALWA 3VFUA 4WFHD 3NFNB 4LLAA 1FVCB 1TQCB 3PABB 3UP1A 3CD4A 1DEEA 2HA1A 1YECL 1N3NA 2EH7H 1NKRA 4PJEF 1VFAB 5I76A 4XRCA 3GM8A 5J12C 3ULUH 3F58L 2ADFL 4LARH 2V2WA 1JHKL 4XP5H 3F62A 3VW3L 4H0IA 3U83A 4ZS6C 4U1IA 4X5WA 1IAII 4Z78A 2NY2D 3O9WB 4H8WL 1JRHL 4EI5A 3IKCB 4OLWH 1N6VA 2A9MH 2UWEB 1HSBB 3C5ZB 2XFXA 3WUWG 1KN4L 2ED8A 4HK3J 2HTLD 4L8DA 2X4UA 2FLBT 3C5JB 4I0PC 2OBGA 1OLZA 5EDXA 2DS4A 4CU8A 2IMNA 2QHRL 3HRZA 4ODWB 4G43A 4GRLA 3RRQA 2EDXA 5CJ8A 4U6XA 1GGIH 3L1OL 3V52H 5B4MC 3GK8H 5F7FA 5IF0B 2PN5A 1LILA 1ND0B 4K8RL 4A2MA 3WEXA 2CDEB 3EJZD 1JF6A 2QSTA 4XBGB 5DJDB 2BOBA 4ORZC 5JR1L 1BGXH 4BSVB 5AWNL 5CSGA 4JPVL 5FO9A 1S5HB 1XEDA 2EIZB 2E7LA 5L2KA 3MNWA 4IRJA 4S0UC 1T7VA 5T3ZL 4QHKI 2DQHH 3X3FL 5JW4Q 4K7PL 3DO3A 1FP5A 4UTBL 5EN2A 1IEHA 4V2BA 1A64A 2CD0A 3FRUA 3D69A 3BZEA 1I1CA 4P3WA 5DEGA 1FN4A 1T83C 4LL9A 2I9TA 3QPQC 4GLRI 1XT5A 4HFWA 2NW2B 1D5ZB 1CDHA 2IPKB 4Q9RL 3MODH 1MLCA 1INQB 1P5UA 3WFHB 1ED3B 3MV9A 1MFCL 1DN0B 3QXAB 4TTGA 4D9RD 2WUBL 1I7ZA 1LK3L 4G42B 4OZHA 5MI0B 4IRZH 5IVXA 1FFQA 3VGFA 1EJOH 3KYNA 3B6SA 1MCPH 1Q72H 2C3XA 5FHBH 4P49A 3VJ6A 4XGZB 2OP4L 2AABL 3RY4A 4E42B 1BQHG 1C8PA 1MHHB 3QIWD 3QO1A 1T7WA 5TPWH 4PUBL 5T3XL 2AK4D 2YSSA 1QA9B 3RL1B 1G9NC 4JG1L 1FNAA 4H26A 1JPSH 3QG7H 1YQ2A 1MPAH 5LBSH 2Q3ZA 3HCVA 3BPLC 1IC4H 2V5TA 5IV2B 1I85A 3GSNA 3ZYZA 4Z95H 2NY4C 1DBJL 2C1OA 2NZIA 2FR4A 3RHWF 3F7YB 3DX9A 2J4WL 1TJGH 3QUYB 1PGRB 4JKPL 4H1LB 1UEYA 1HHJA 5SWSB 2PW1B 3DMMD 1FHGA 3ET9F 3KYKL 5KN5A 3S9DB 2DD8H 1S7TA 3FO1B 4EUPG 1I1YA 1CXLA 2CDFB 4B41A 2GI7A 2WWMD 3WJJA 4PJEA 5ENWB 5J12B 2HN7A 2OJEA 5F6HJ 1OP3H 3OKOA 2C4FT 3IVKA 4ZUTB 3G5VB 4B5EA 1O0VA 5DF0A 1MF2L 3CDYA 2VWEE 5EOQL 1JNLH 1OAZL 4FP8L 3TIDB 3UTTB 4O9HL 4C56E 4O2CA 2YD6A 3PG2A 4OQ1A 2AGJH 5GQBA 4R26L 1VFOA 3JV6B 5F7MC 4L29B 4MVBD 5CWSB 3D9AL 1KYOK 3MUGA 3SDAA 1G7QB 4JRXA 1YEDB 2IGFL 3E3QE 3QIBA 1WITA 4N1CA 2GAZA 4X7FC 2ZNWA 4UV7H 5AAWA 1BVLA 2F5BH 5HYSG 3P4MB 4MA7L 4JVPA 4I0PB 4WU5A 5DI8A 1KFAL 4UQ3A 5BCAA 1N2RA 4MJ6B 1CGYA 4GXUM 5T5FH 5DJ8A 5C0CD 1WZKA 1RIHL 2BX5A 1RAMA 4LPXA 4D0DA 4D3CH 5B3JF 3NCYP 1KYOJ 3MBXL 5D6DA 1A4KB 2ED7A 1I3VA 1KF9B 2K9UA 3V5HB 4YLQT 3DMMB 1N5AB 2YMXH 4P9HH 5HGBB 1L6XA 4Z7QE 4JN2A 1KIRA 4JG0H 2P1YA 1KIQA 4Z5RA 3TFKA 4J3XA 4ZAKA 4Q2ZA 4XCYB 3PP4L 3THMH 1PLGL 1FVEA 2JLLA 4XMPL 2H6PA 1T7ZA 2LU4A 1HHKB 3IFOA 4NUGH 3QIUA 3LPGA 4I4WB 5IM7B 2GUOA 2BY1A 3S88L 1SY6H 2FGWL 4HUNB 4AH2B 4N0UB 2VN7A 1INDH 3GO1L 4N9GA 4O2FA 3RWFB 3TPUE 4Y19E 1KCUL 1WFTA 3KPRD 4PJ5A 3CJJA 3ECBA 4EI5C 5F1NB 4R8WH 3DHMA 4FQJL 5FA4A 3EFFB 1JUFA 4TUOA 1YECH 4LGSB 1QO3A 4XBPA 3T04D 1YNLH 3MXWL 3R0MA 3VXUE 4F7CB 5CLWA 3BOVA 4X6CA 3FFCB 3VXME 2VZUA 3F58H 3QZWG 3V4UL 1CGSL 3P11H 4P2OD 1VEOA 4PJHE 1JHKH 4KFZC 4HPOH 5JHLH 3RVTD 3WDHA 1T2QL 1MJ8L 5CHNA 1QFWL 4NM8H 2JB6B 4GRLC 4H8WH 1JRHH 5IBLC 4PJGF 4ZUSA 3TN0A 4FQQA 3EIFA 1HILA 1OF2B 4XAWH 5LCVH 1KLGA 2JF1A 1QLFB 3T2NL 4K7PX 1ERNA 4JANA 5IFHL 1G0YR 1IEBA 1PJ9A 2IAMC 3U0TB 2CJUL 3BIKB 3NTCL 4OCYH 2NY4B 4CMHC 3L1OH 4IRJC 5F44A 2R0KL 2HFGH 4YWGL 4K8RH 3H9HA 2IANB 2BRRL 3I6KB 3DO7A 4X80L 3OV6A 4ERSL 4S2SB 4KVNL 5LGKA 3FHQA 4POYA 1WCQA 2FATH 5AWNH 4JPVH 1IM9B 2I07A 4QHLB 4FXGA 5CILH 5HHOA 1AKJD 4RNRB 4P2YA 2X5PA 3SQOL 3V5KB 5T3ZH 3BGMB 4EN3A 4P2OB 4X98B 3X3FH 4K7PH 1DBKL 2PYFB 1ORSA 8FABA 4NSKB 4W4OA 4IJ3C 5HI5C 1X3DA 5IB3A 4YHOL 1I3RB 4RMSA 3ZDZF 1JN6B 3AREA 1R0AH 5DFVD 5AD0B 4PJFF 4OD3L 3VWKD 4PRPE 4JFPA 1YYML 3CFDB 5F3HA 1HCVA 3UTSD 5B3NA 2YD3A 3L9RA 2YUZA 3OAZK 5MEQB 1EX0A 2MWCA 3H7BB 5GS2H 3U4BH 3MYJA 1MFCH 3KYMA 2I5YL 1LK3H 4PP2B 4G59A 1GHFL 1CGWA 5DA4A 3CSYB 1EZVY 3EDEA 4CJ0A 2CK2A 4PG2C 4XVUC 1YEKH 2OP4H 4CVXA 2DTSA 2AABH 4YFLI 3QDJE 5JMRA 1BAFL 3L5HA 3D25A 4KKAD 2QBWA 4HUVB 1BM3H 4G9FD 4HGWB 1FO0H 3FQUA 3KWWB 2RAMA 4K7FA 4PUBH 1WZMA 5DRXA 3MLWL 5T3XH 4JG1H 3VRLE 5FYKU 1T5XB 5J11C 3VFUB 1LO3H 1ES0A 4LVHC 2J6EL 4J3SA 1DEEB 4GW1A 2BY3A 1N3NB 3HZYA 5I76B 4XRCB 3WJJC 4HCRL 1XAUA 3K1KC 4MS8D 3SGDI 2J4WH 2V2WB 1G1CA 1N26A 1X4ZA 1LHZA 4U1IB 5DDHA 4JM2F 4QTIH 1OAKL 4WEBL 4X5WB 4QGTA 4Z78B 4EI5B 2FLRT 4FTVA 5B8CA 3KYKH 5CUSL 5ESVA 3BYYA 4LOUD 3SDAC 1WV7T 5MHSE 5GJSH 2XFXB 3BKML 3RGHA 2AJZA 2X4UB 4L8DB 1FZKA 4KV5E 1MF2H 3MV9D 2AQ2A 2IC2A 5EOQH 1U8OA 1KEMH 3HRZB 4G43B 4GRLB 5IVZA 1YY9D 4H25A 4R26H 4U6XB 1GL4B 2D7TL 3CSBA 5JOPD 1HIML 1KELL 2H41A 3WEXB 3C6LA 3D9AH 5D5MA 1FNLA 4MAYA 3FT2A 5D6DC 2NY1C 3FO9A 2BOBB 1F11A 5C0DA 2J1KA 3D85D 1QBAA 4MA7H 4X9BA 4MHHI 5FM4A 4UILL 1KFAH 5FO9B 4L4JA 1I7TA 4ZAKC 5L2KB 3MNWB 2NLJA 4IRJB 2VXVH 4YQXL 5C0EA 3B2UD 4AG4L 5F71A 5JIKA 5AZ2L 3HAEA 2YD5A 1MFBL 5EN2B 1MFNA 1OLLA 4HIXL 2WUCL 3FRUB 3D69B 2RFXA 4GRMA 3BZEB 5DEGB 1FN4B 4LSQH 2BERA 2I9TB 3NBNA 2QJDA 4DOHB 4D2NA 2PTTA 1TFHA 3HPJA 4HFWB 2GT9A 3PP4H 3QPXL 3DGCR 4TUKH 4POZD 4KMQA 3U7AA 4XMPH 1MLCB 2M2DA 1FV1A 2ZCKH 4OZFH 1ZANH 3MV9B 4OLZL 4IJ3B 2FGWH 4R9HA 3MV8A 3G08B 1I7ZB 4NDMA 4OZHB 1UWEL 1CF8H 4Z7NE 5IVXB 3GO1H 2HT3D 3V6OA 4KJPD 5K59E 3KYNB 3B6SB 5EC2A 3VJ6B 3T0BA 2KDGA 2P5WE 4DKFL 2VABA 2GCYA 4HK3N 4JFEA 3HFML 1I8LA 2ICWA 3VG9C 3FL7A 4Z7UA 1XGTA 3QO1B 3BO8A 1NBYA 3O2WH 2VKWA 4J8RA 1CK0H 2YSSB 4XNYL 3WSQL 3LEXA 4YUEL 3WNMA 3QIBD 3V4UH 3HCVB 3JWDC 4HF5L 4JGUA 5GHWL 3RVWC 3T8XA 1YNKL 2IPUG 1T2QH 1MJ8H 1D5IH 1AQDA 4Z7VE 3GSNB 2HG5A 1CDUA 2C1OB 3RWJA 2YD8A 2FR4B 1NEZG 1T5WA 3DX9B 1YMME 3LKSA 3ILQC 5FOBA 1WTLA 3T2NH 2Y5TA 2VXTL 5J11B 1P6FA 1G6RH 1HHJB 1RZFL 3QISA 5IFHH 5KN5B 5IMKA 1S7TB 3C87A 4F9PA 1AE6L 2CJUH 1I1YB 3LQAC 3BDXA 3TFKD 3O4LA 4PJEB 3RBGA 4ZOBA 2HN7B 2OJEB 3ZDYF 3KHOA 3OKOB 2R0KH 5HHVL 5BW7A 3IVKB 4M1CD 4EN3C 3QIUD 3N0PB 3QDGA 4BUHA 1H3VA 2NR6D 3IXTA 4K3HA 4O2CB 1K5NA 4JM2A 5FM5O 4LVNB 4Y5YA 3SDAB 3MUGB 5CSBA 3UJIL 4JRXB 4TRPH 4W68A 3G9AB 5D1ZA 1HXMA 3QIBB 2GAZB 3SQOH 1BVLB 2D9QB 4OQTA 4WU5B 4PJAE 5DI8B 1MEXL 5E2TL 1RMFH 3HUJE 4HC1H 1N2RB 5GGVY 4YHOH 1EEUA 4KI5E 4NKIL 5DJ8B 4AIZA 4J7RA 5EBMA 1RUKH 3FKUS 3RIFK 4D0DB 4OD3H 1Y6KR 4LNVA 4CDGC 4HGKC 3TCLA 1YYMH 4X4YA 2NY1B 3CVHL 1U8PA 4FQIL 4HMDA 3BW9A 3NFPA 3TN0D 1IZJA 2DQGH 1MCCA 3S3PA 1MCFA 4JN2B 1KIRB 1KIQB 4Z5RB 1NGYA 4ZAKB 5IR1A 4Q2ZB 1GHFH 4JE4B 1MREH