1KJMA

Tap-a-associated rat mhc class i molecule
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
277
structure length
277
Chain Sequence
GSHSLRYFYTAVSRPGLGEPRFIAVGYVDDTEFVRFDSDAENPRMEPRARWMEREGPEYWEQQTRIAKEWEQIYRVDLRTLRGYYNQSEGGSHTIQEMYGCDVGSDGSLLRGYRQDAYDGRDYIALNEDLKTWTAADFAAQITRNKWERARYAERLRAYLEGTCVEWLSRYLELGKETLLRSDPPEAHVTLHPRPEGDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVEHEGLPKPLSQRWEPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RT1 class I histocompatibility antigen, AA alpha chain, heav
publication title Crystal structures of two rat MHC class Ia (RT1-A) molecules that are associated differentially with peptide transporter alleles TAP-A and TAP-B.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Immune system
total genus 66
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2001-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kjmA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1kjmA01
1U8LA 3QIBD 4TRPL 2R69L 4XBGA 5D1QC 2RB8A 3TA3B 3HNSL 1AXSB 5FOBA 1I3GL 4JPWH 1NC4D 4HJ0D 3D87B 5D2LA 3RTQD 1N64H 1JUFA 4QHMA 2H1PH 4ZAKB 3GBNH 4M02A 5E8PB 5IKCB 2RCSH 4YDKH 4HFUH 1JNLL 3GIZH 4Q74A 5LJYH 2OK0L 3JWDH 1NAKL 1KTKE 1YZZA 5KS9B 1B6DA 3C09C 1I9EA 5KVMC 3Q5OA 5E8NA 2VITA 3HCVA 1ZHLB 5EO0B 4YAQB 3UCRA 2R0ZL 1YMMA 4XP5H 3H0TB 5BRZB 1K4CB 5HGDB 4IRJA 1M6OA 4WU5A 2AXGA 2P5WE 1RZJH 2O93L 3R8QA 1WT5C 1ROWA 3MLPA 3OKMB 4PP1C 3U9UA 1FSKB 1A7NH 5CJOH 4JY4A 3O41A 3RY6C 6FABH 2O26U 1UM4H 2D7QA 4ZXBA 3OKLA 3SGDI 4I9WE 3KS0J 3SDCC 1CGYA 2LAGB 4PGBB 3OHXB 5IFAH 2Y23A 2BY0A 4YR6B 2VQ1B 1JZ4A 4FQXA 5FB8B 4LPYA 1E0OB 1MFBH 3EW3B 3JV5A 5FA3B 2DBJA 3MLUH 2P46B 1CDYA 2BC4A 4ZUWA 1NGXA 2VDOH 5DRZB 1K6QH 3TNNB 1H5BA 4M1CC 2ADGB 4HWBA 3CSYB 1B0GA 2BNQD 3GRWL 5C0RL 3VG9C 2YUVA 1QPXA 5GHWL 5HYJB 1FFOB 5D7IE 5T3XL 2G9HB 2QLVB 5DA4A 3V4UH 2OR9H 1DQDL 4NYLA 4I0CC 4TVSa 1U8QA 1PBYA 4K7PX 4I5BA 5C0DA 4FTVA 4Y19D 2VDKL 1HHIB 3SJVE 4E41D 2HFGH 3QUYD 2E8ZA 3EBAA 4IJ3B 2BSRA 5HHMD 4IOIA 2NY1C 1AP2A 2VXTH 3IYLW 4WO4A 1F3DJ 4KRNA 4X98B 3U79A 3EDJA 1ZWIA 1XF3A 4PJGB 3WS6A 4KRPB 1BQLH 4Y16C 1EPFA 3LH2L 5CBEA 5IW6B 4HS3A 1ADQL 2W0PA 4QWWC 1MCQA 3MNZA 2ZG1A 4PV9A 5IHUH 5J12B 1WAAA 3QDJB 2XFXB 2QQNH 2ZOKA 1AGFB 4Y89A 1P84J 3RUGF 4P2RA 3O45A 1GGUA 4BYHA 3HPJA 3AM8A 2XI9A 5H8DA 1FJ1B 3REWA 1FN4B 5DD1H 4M48H 1JGVH 1RIUH 4G9DB 2APVA 5JHDE 1BIIA 3F6LA 3GMNB 1EZVY 4PJFE 3UTOA 1ZVHA 4MNGB 1UCBL 3LKPB 3GUTA 3O4LE 5E8OA 4RMQA 3BGMB 4P2CG 3S4SA 1WLHA 2N4IA 4Y4HA 5IFJB 4HLJA 5FK9A 1RZFH 4P5TC 4EDXA 4WHDA 1NBQA 2BERA 3QFDA 5INCB 3AS2A 1L7TH 4WU7B 4OLZL 4R3SB 3ECBA 3S96A 5CLWA 2I26N 3VGFA 4YX2H 4JFDE 4CN6A 3J8F7 1KYOJ 4ZS6C 4Y5VC 5HY9B 4IHOB 4NWUH 1HN1A 2NTFB 1GRWA 5SWZA 1ZHNA 1IL1A 1OWRM 4O5LH 4J6RL 3O2WL 2XV6B 1B2WH 4AJ0A 3EYUH 4P3DA 4OZGE 3D0LB 2OZ4A 3T4AB 2QQKH 2DQDL 4M4PA 2CKBH 2ZUWA 4JPIA 1D9KC 1NEZB 1K3ZA 5GIRB 4UV4H 2X05A 3QO1A 5IQ7H 1U2HA 4UQ2A 4DFIA 2IQAA 3CMGA 3ILQD 3RWGB 1HHGB 4ONGL 4GRMA 4YK4B 1W8NA 1G1YA 3GSVA 4WGWB 5JDSA 2J8HA 4OSUH 5EU5A 4LLMB 2APTA 1VKXA 2LAAA 3HC0B 3UYPA 3UDWC 3VRJA 1RULL 2Y4SA 2YXMA 4A6YB 5E8DL 4MXVF 4OD3H 2Q76B 4OKDA 5TF1H 2APXA 1XZ0B 4KTEH 4V1DD 3GBMH 4ZPTB 5E7FA 4XPFL 5DI8B 4QOKE 3INUH 1HSAA 1WJ3A 4KI1A 5CIPA 3MJ7B 2R56L 1GC1H 3ZDYE 3VFRB 2EIDA 3MOAH 5DC0A 2GJJA 4NQUA 4JVWA 2P8MB 5DFVC 2CKBB 5BVJB 3O11A 2Y25A 3JWOL 5HDBE 4MJ6A 2X1XR 4YGVB 1GXEA 3QT2A 1KB5A 3UXFA 3OR6A 2EIZA 5LVEA 3TA3C 2ZUTA 4LPCA 2VDLL 1DQQB 2R9HD 5TQ0L 5GRVL 1K8IB 2IAMA 1AQKL 3QEUA 4K9EL 5H37H 2AK1H 2BSSB 1P4BH 4ZAKC 1OB1A 3Q6GH 4Z7UB 4ZOCA 4YHNA 3D2UA 5EBWB 4PRHA 1NGYA 2H26A 3NIDE 4H20H 3Q3GB 4CW1B 1XGTB 3GMRA 5IR1B 4KK8C 5F9DC 2IPUK 3BO8A 4XWOD 5BXFB 3I9GH 4PJBF 4PJ9B 3JTTA 3NGBB 3E8UL 3BKYL 3QIWC 1JIBA 1NUNB 4P3WA 3DYMA 1SY6L 5SWSE 1C7SA 3MRIA 3O6LH 1C16A 2OMNA 3QQ4A 4U7KA 4NFBA 4WVRA 3QQ9C 4M1CD 5HYIA 1J5OL 2ICWB 3DMMB 5IBLC 1FSKC 4ODVH 1G7JB 3BE1H 3UPRA 1A7PH 1TETL 3RWDA 1RFDL 4X0KB 1INDL 4OCRL 4X6EB 4MD4A 1UB6B 3O4LA 2JJTA 1X4XA 4RGNE 4Y5XA 1I7UA 4N9OB 3LQAH 1WFOA 2GCYA 3BW9B 2GITB 3JWDC 1VEOA 3DV4A 3OAZH 3IDGB 5KOMC 4KMLB 1R24B 1FVCB 4OZIB 5BS0D 1E6OL 1HINL 1MRDH 4ZTPL 4GQ9H 5D6DA 5CFHA 4PD4J 4UIMA 2NX5B 1OL0A 4GG6E 1JZ2A 3GO1L 3N1FC 4O51B 4PPTA 1SEBA 5DK3A 2D7PA 4MVBD 1FZOB 3PP4L 3F6IA 1RZJC 3PGCB 5JW4R 3QA3A 4QWWD 4BFIB 3S36L 3MA9H 2GUOA 3BRDA 4D0BA 1NEUA 4JFFE 4F7EA 4FFWD 1KCUL 1N4XL 5C2UB 3X14A 3RRQA 2QHRH 1S7TA 2J12B 3EJJX 3GB7A 3OKNB 3FHQA 4LCCA 3GKWH 1XIWD 4HIXH 4XNYH 5EU6A 5DMYA 1BMGA 1MFCL 3EUUA 3MCLL 1JGLH 1NGZB 1VPOL 4MA8H 4AENB 3C6SA 4KRPC 5FO8B 4F7TB 1IT9L 1MREL 2DQCL 3P9LB 4KQ4H 3HZMA 5CUSH 3SGJC 1BF2A 1B4JL 1UM6H 2IADB 3HMXA 4YWGL 2R1XB 1NC2B 3MLVL 3PXJA 4XB8A 4P5TD 5DMIL 5E6IA 5HYSB 4QRRD 3LN5A 1S9YB 4ZUSB 1FE8H 3HRZA 2A9ML 4GKNA 5D71H 5E99L 4BZ1H 4ZFFA 5DZLA 3AU1A 3JV4A 3TBTB 4Y4KB 4NP4H 2O61A 2H9GA 1IAII 2SEBA 3RWHB 5EO1A 3FQUB 4E5XA 4P5MA 2F53E 1G0DA 4JFXA 3RVTD 2HKHH 2B5IB 3IKCB 3ZKMC 3B5HA 1S7XB 3ARGD 4G7VL 4MMXC 5FGCB 4ZO7A 2AABL 1IC5H 3BKML 1WIUA 4YHOL 4LPXA 4C59B 5FUOL 3BKJH 4C54A 4Z18A 5SV3A 5IHBA 2EXYC 4P3CL 4TVPH 2FGWH 5MEQB 4P5KA 1BD2A 2DS4A 3EO1A 5C3TA 4UNTA 4OZHB 3D69A 2FX7H 4YHMH 3RGVA 1NGPH 3DVNA 1JNNL 3JTSA 3DX9B 4X7CC 3D48R 4XCYA 3GMQB 1LP9E 3I6GA 1DR9A 4H26B 4F7PB 3BX7C 1NBVL 4LIQE 5DHYB 2FLRT 1ED3B 5DUPH 1MCIA 2DD8H 1Q38A 4NRZA 4UU9B 2X2YA 3RNKA 2AKRA 2MNUA 3QI9D 3BXNB 1U8JB 3N06B 1FBIL 2R29L 4LSQL 2PTTB 2J2ZA 3OXSB 1MHEB 1GZQA 2OI9B 3MREA 2D2OA 3UC0H 2A73A 4HPOH 5B3NA 4KWUA 2Y06H 5D9SA 3PL6B 5IVZA 2QTEA 4WW2B 3I50L 1T22B 5IHZB 4WHTA 2PO6B 4L4VA 3LHPL 4PRPA 5F7HA 1NCBL 4WUUB 1Z9MA 3ULSA 1ZAGA 5JQ6L 1C5BH 3EYFA 3CDYA 3V6OC 4IS6B 5A2KH 1RIHL 2XTJE 3AB0B 1T2JA 5CZKA 4D9QD 4LGPB 2EYRB 3CSGA 4QXWA 4ZAKD 3AREB 3G5YB 2FEEL 4P57B 2Q7YA 1IGIH 4G6KH 5I30H 5H35A 3JTCA 3DX8B 1RJZA 1TZGH 1TZIA 3OB8A 3L3GB 4CADB 4YE4H 4Q6IA 5D8JH 3K4AA 2PW2B 1YPZF 1N59A 2MJWA 3KDMB 4L1DA 4ZSOE 1A5FH 4X7FC 4UT7H 3VFWA 2J5LB 3E0GA 2ICEA 4OLUL 5BRZD 5B8CA 4LSVH 3QJHB 4F2MA 4JREC 3SE8H 4PY7B 1HILB 3VMOA 1WK0A 1FQ9C 5IUSA 1V7MH 5BV7L 1OGTB 2ZPKH 3QULA 4LOUC 4F37F 1J10A 2QSVA 2KKQA 1BP3B 2YD9A 5DJAA 1RU9L 4JDVB 3S6CA 1OGAA 1GC1C 1ZT7A 4HX1B 4PJ9C 5DLMH 2ITDB 3NGBC 3UTZA 1PEZA 5GSRA 2AK4A 5DJ0B 2WIIB 2BVPB 5ESVA 2Z92A 4ACPA 1H0DB 4F33A 4FHBD 2FO1A 4HIJB 4H1LG 1H15A 4HWEH 1Q72H 3OAYK 1CIDA 1AGEB 1KC5L 3DMMC 3S37H 4NFDA 3DUHA 3DHJA 4YJZL 1N6VA 3R06B 3VD3A 5A1AA 5FFLA 3DJ9A 2E7LC 1FYTA 2ZSVB 5J6GA 1N7ML 4XCFH 5D2NA 1GOHA 5KW9H 3RUGA 2IEPA 2DQFB 4Z76A 5F21B 4F7CB 1XGRA 3FOLB 1J9CT 1UACH 5HGBA 2X44D 3MLZL 3TGXA 4X9FA 1Y6KR 4KKAC 1UWEL 5FDWB 3P30L 4LVNB 3U6RA 1QLEL 2RFXB 4NQEE 4EI5A 3T3MF 3RWCA 2EIBA 1VEPA 1EA9C 3GHEH 2VXVH 5KSBB 3SOBL 1MNUL 4KI5D 3O3EA 3BGAA 2MKLC 1QG3A 1YEIL 1MUJA 5GRUH 1UZ8B 5GSVA 3M17B 2ARJQ 4QF1B 2ZCHH 2EE6A 4QTHA 1K8DA 5DT1L 4X7SH 3QDJD 2R23A 4QRTB 3TJHD 5BMFL 1P4IL 1KJVA 5E03A 3O2DH 4M9OA 4O2EA 4PJXF 4G80A 2XN9A 2DDQL 1QFWM 2DQIH 4MQ7B 3LQAC 3BJ91 4YLQT 4JR9L 3FKUS 1DEEA 5B39B 2FO4A 5DJCB 4NZTL 4F80A 1LDPL 3AVEA 1U3HB 2FBJL 4JB9H 2QSQA 4KJQC 3ZDZE 5AUMB 3MJ9H 2ENSA 4X4ZA 5JW4Q 4HULB 1YJDH 4FZEL 1UJ3A 2R8SH 2HP4A 3OF6A 4KQ3H 1EAJA 2FIKB 4G5ZH 3MBEB 1VSCA 2QQLH 3AMKA 1HH6B 1R3KB 4YDJA 1OP3H 2NMSA 1CFVL 3MUZ1 3GMPB 4LAQH 5C6TH 4GXUM 2B5IC 3CZJA 5JMRA 4ODUA 1YUHA 3BEVB 1J8HB 1QBBA 3MBXL 2EKSA 2X1WL 5I1DA 4JKWA 4MA7L 3AUVA 4JHBA 4HKJA 3S5LG 4EDWH 1K2DA 5HI4C 4X9IA 1XCTB 1WBYB 2CLVB 1ITBB 2DM7A 1MLCB 1PQZA 2M2DA 3L3DB 1QLFB 5FYLH 1PG7H 3VA2C 1S9WA 3LVEA 1FVEA 3NZHL 4TQEH 1CGUA 4QY8B 1XF5A 4OZ4A 5I17B 2FR4B 3V95A 4DW2L 4M6MH 3OJDB 3TVMB 2GJ6E 3BH8B 3EO9L 3QZWB 3QUMA 2IFFL 5C07B 3O8XD 2P7TB 1AY1L 3EOYG 1XGPB 2APBA 4NOBA 1CICB 2OMBA 4RRPG 5JMOC 3CDFA 1NH6A 2D0GA 4X5LA 5CP7B 1FNEA 3CFJA 3KYOB 4PJ5A 3P9WB 5IROA 1CDCA 3UJTL 1ZEAL 2X09A 3B9DA 3OXRB 3SDAB 2IGFH 4PRNB 5ERWA 1IC4H 1NANI 5E2UH 4XVTH 5AWNL 3U0PA 2OSLB 5GGSA 5IMLB 3MRDA 4PJBA 3FB7A 3UTSA 2MQ3A 3MFFB 2R1YB 1K85A 4QTIH 4M7JH 1KBGH 4Y4FB 3VRIB 4MGXA 5IV2A 1CFQB 4HUNB 1MWAH 1NCTA 3DIFA 4Z7OE 1LMKA 2WWMD 1U95B 4NWTL 3AB0C 3GSOB 2UY7A 2YC1B 2E3VA 5CKGA 4KMQA 1KIRA 5A2LH 2B20A 4KRLB 3PWVA 3AAZA 3VD9A 4LBEA 3TPKA 4R96B 4RMWA 2FATL 4K2UL 5F7EL 4H88L 3C8KA 2CXGA 2VABA 1WZ1L 3HC4L 3NA4A 5C08B 2FH6A 2CMRH 1BPVA 4UB0H 2FJHB 4RGOH 2I24N 2FEDC 1X5AA 4PJ9D 2WBWB 1U58B 3CUPB 3I6KB 1CGXA 1ZLVH 4ORGA 4YUEL 3M8OH 4X5WB 4E9LA 2D4DA 4LPVA 3BZFB 3PDOB 5E94A 3W9EA 3A67H 3ZDXE 1KJMB 4U0RB 5JPNA 1MWAB 1NFDE 1YYLH 1L6ZA 1P9MC 4ODWB 5FGBA 2EC8A 2UVFA 2CR3A 3C8DA 2BSED 3P0VL 5GISH 1F58L 1WZLA 5SX5K 4WI5A 1Q1JL 5D7LE 2KQMA 5INDA 4L3EB 1FCGA 1WIPA 4Z95H 3TYGH 3QB7C 5CHNB 1KENL 3SPVB 4R26L 3RI5F 4RIRA 1Q0YL 1IMHC 1OTUC 1CFNA 3IDNB 4PJDB 2W0FA 2HVKA 3T1FB 2CDGB 2NX5D 2X4QA 4TUOA 5TQ2L 1RZ8A 4MJID 1JWMB 4HJJL 2G2RA 5DO2C 1KPRB 2N1KA 1EVUA 3W81A 1LO2L 3IDIA 2I9TB 3UTTE 3I85A 3IU4L 3D3VB 2YN5A 1WEJL 2ZNWA 4PG9A 4IIQB 4LASH 4X6CA 1QVOA 2EC9T 3D39E 1FZMB 3WFZA 3VMPA 3NTCH 4G9FA 2VC2L 4LVNC 1YEHL 5I2IB 1CFTA 3E6HA 5FYJH 1HOCA 5J0BA 4L4TB 1F4HA 1Y0LB 1HYSC 1ITCA 5K33A 3FO9A 4WWKD 4K3EL 5I19L 2BDNH 1BBDL 4LLDA 3SHSA 4X6DE 5F1NA 3RIFK 1JV5A 1W0WB 3MRLB 4C83B 2WWKO 2XRAL 2FHCA 3MRJA 3W9DB 4Z78B 4DVBB 2EDWA 1J12A 1RJCA 1AFVH 2X4PB 3WIIL 3TFKD 5DEGB 35C8L 5TPWL 3T2NH 5DVNA 4YHLL 1U93A 2WLZA 3RA7H 1TJGL 4Y4KD 2NYYC 5CEXB 5D72L 3RAJH 4AEHL 2N7BA 1BZQK 2VIRA 4FFZH 3S35X 1HHHB 5I8OH 2BNRD 4YEEA 2LVCA 5GRVK 1SVZA 3LKQA 7FABL 1WFUA 4XHJD 1AGBB 4GW4A 1CBVL 4F9LA 1P2CB 3P0YL 3D9AH 2FNBA 4OB5H 4LL9A 3MBEC 4XBGB 4RMUA 1LEKB 3VH8G 4F8TA 2AJXH 2VLMD 4IRSD 3SE9L 3BOVA 2VXUL 3BEWA 4F3FA 4JN2A 5FOBB 1LE9A 2DKUA 5KSUB 3MLYL 1JUFB 4QHMB 4QGTA 3MV01 2NW2A 5MHSD 4MS8C 4BKLA 3JVGA 1V3LA 1JF6A 4P0DA 2ORBH 1IGMH 3TNMA 2Y5TA 4HWBH 5E8NB 3SCMD 2VITB 1TPXC 3HCVB 1A02N 5JXAH 1F00I 3V7AE 1YMMB 4R8WH 1YJDC 2UZIH 1OAXL 4Y2OA 3BQUA 4IRJB 1M6OB 1YPZA 4WU5B 3PQYA 2AXGB 4TVPD 3PL6D 3TVMC 3U9UB 2PO6D 4YDIH 4PJFF 5FO7A 1FORH 4JN1L 2OR8A 2YPVL 3BIAX 1ZGLP 1CICC 3FL7A 3O41B 4WUUD 1DBML 2HJFA 5B21A 5EIIA 4ZXBB 3Q1SH 1KT2A 3B9EA 5D5ME 5C09E 4X99A 5DJZA 2VDNL 2W38A 4JFQA 3TYFA 3L3HA 3SDAC 4U1NA 1PD6A 1I4FA 3LEVH 1BJ1H 3ARED 4LSUL 4LNRB 4GW1A 1IGFH 3MSPA 1QR1A 4D9RE 5FYKU 1H5BB 1WWCA 5IMOA 1FH5H 1B0GB 1ZHKA 4OIBA 1DSFH 1VFOA 1FL5A 2J8OA 4WCYH 2YKLL 4Y4FC 4OM0L 4HGMA 3MRBB 4Z7VF 4X9HA 4PJCF 4NYLB 4XWGL 4AT6A 1U8QB 4JFEA 2XNAA 1BZ7B 1ZTXH 1JPFA 2BFVL 4NQSA 3VXRA 1IRAY 1QQDB 4I5BB 4L1HA 5DEFA 5T5FH 5C0DB 4JQXC 2FX8H 1V5JA 5D7SL 3HTLX 4CAGA 3KXFE 1ZGLA 5CJ5A 4LLWA 2VAAA 3QO0A 2BSRB 5EA0H 4IOIB 1AP2B 5BZWA 4WO4B 2HFFA 4OD1H 5ITFB 1FC1A 2ZSWB 5I15L 5GS1C 4HKBB 5CGYC 4OIIH 5D7JA 1ZWIB 4OGXH 4BM7A 1INQA 5EFIA 2J4WH 1WZMA 5CBEB 2DQEH 1CL7H 1MQKL 2V5RA 4HS3B 4J3XA 3ZT5A 2D0HA 2J6EA 4BA8A 2ATPA 1T4KB 4XTRD 5KVEH 3MRPA 3WFDL 1OTUD 1J87A 1G7PA 3EYSH 1UC6A 2Y36L 1AGDA 3O45B 4XAWL 5HHVH 4EVNA 4U0RC 3IKKA 1C5DA 1L4IA 1CZ8H 5IFHH 4GKSB 1DBJH 2XYCA 2OZ4H 3ZE1F 1FL3B 2F8OA 3QQNA 3WLWC 3DETD 2R0KH 3ZYIA 3QUZD 4P59H 3FN3A 3GUTB 5I16A 4RGMB 2FX9L 5E8OB 3S4SB 1IAKA 4NO5B 1FNSH 3I2CL 4Y4HB 5FK9B 5J8OA 4J12A 3VDBA 4XXDB 4M8VA 1QEWA 4BFBD 2EXWC 1FGNL 3ECBB 5DQJA 4R7NA 4V3DB 4JGMA 4UINL 3KPRE 5CJQH 2X4RA 1QFWH 1UXWB 4ZUUA 5D7KD 3MGOA 4JRYE 4IIQC 4UT9H 1A9EA 1F4WL 1ZHNB 1IL1B 4M1GH 4R90H 5CIPH 4CVUA 1NLBL 3BPOC 4ODTH 4IDJH 5FHAH 3KYMB 3RI5K 4N0RA 4YDLB 1AIFA 3PUCA 1F13A 4JPIB 5KTEL 3W0WA 4JDZA 2P5WB 3QO1B 4P9ML 3UYOD 1RUQL 1U3HD 2EYTB 1KB5H 4UQ2B 2BY3A 5K9KA 1IILE 4K07A 5BV7B 1V05A 1YYMH 4CMMA 4GRMB 3GSVB 2DL2A 5JDSB 5T1MA 1SJEA 1AXTL 4FNLH 2CDFA 2GHWB 3BISA 1VKXB 5DA0B 3GIVA 3DV6A 3VRJB 4TUKH 2CGRH 2CLZA 2EDFA 4MNQA 4BZ2L 5T1DH 3IFNL 1BM3L 1XMWA 2R0WH 2PW1A 1HSAB 3HMWH 3EGSA 4MX7B 4AG4H 1PJ9A 3GFUA 2F58H 1WFNA 4NUGL 5IWLA 2IG2H 5F3BA 5D7IB 3BPNB 1BFVH 3RVXD 3FQNB 3O11B 5T3XD 2ZUQB 1I1YA 5IQ9A 5KN5A 1I8KA 1LO3L 5AYUL 1OAUL 3V79C 3V52L 4MJ6B 2C7UA 2ZWLT 4ZS7H 1KB5B 2LTQB 4OQTL 2XA3A 3OR6B 4XPGH 2B0SL 1JZ5A 3QEUB 4YBQD 3B2VH 2HAZA 3PWNA 1JNHA 3TVMD 1OB1B 1SYSA 2ADFH 4G3YH 4YHNB 3D2UB 1KXQE 4JFOB 5C07D 1NGYB 2H26B 2VXSL 4HT1H 4ZD3L 1CICD 1J88A 2R4RL 1E4XL 3VWJA 2DMKA 5LQBL 1Y18B 2DQGL 4GRWH 3JTTB 2MFNA 4KUCD 3ZYZA 1JPGA 3MRIB 1MCOH 5F44A 4IRJC 1AD9A 2L0DA 3QQ4B 1C16B 4G8GE 3T0AA 3ULVH 3QEQE 4N8CH 3TIEA 4MAYD 3G6JF 5JHDB 3RWDB 3VXUE 3T04D 5TE6H 3O4LB 5F7MC 3TO4D 4M43L 4ZXBC 1KEGH 2W60A 4MQTB 1HQ4A 4M5ZH 2WAHA 3IDXL 4N9GA 1P6AB 4WV1A 4M7KL 1KELL 3NA9L 2LU7A 4KK6D 3DV4B 2XQYG 4FQXC 1A9BB 1CU4L 5DGRA 4OLWL 4W81A 5HHNA 5IESH 1BEYL 1H5BC 3HMXH 1H3GA 4UIMB 4H1LA 3O3BA 1NDGA 3FQTA 5CGYD 4YXKH 3ROLA 3X3FL 3CDGA 4K7PL 3QDGE 1SEBB 2HRPH 5J7CC 3IJHB 2XZAH 3HE7B 3JUYA 5IB3A 3QA3B 3FQXA 3LKNA 4JKPH 5B38B 5KVGH 1MFNA 5AAWA 1MY5A 3NFNB 3BSZL 4D0BB 5L8JB 2GAZA 4HGWA 2ARWA 1XF4B 4OGZA 4F7EB 3X14B 1L7IH 1SBBA 1S7TB 4ZNCD 3GB7B 4WFFD 4LCCB 3DOSA 1CXEA 1EEYB 2A9NH 4WO4C 1P7HL 5EU6B 3UTQA 4LCWA 2WUBL 1Q8MA 4TPRH 3VGBA 3MNVA 3WS6C 3BPLB 1QRND 4OJFH 2WM0A 5I18H 3KWWA 5DRWA 2MSPA 3KPPA 5C9KA 5I8CA 2JB6A 4RA0C 2D9CA 3HLAA 1VB9A 3LN5B 2R2BA 3TZVA 3L5JA 4GKNB 4ZFFB 1ZANH 4G8EA 3AU1B 3JV4B 4RDQG 3L1OH 3ZHLA 2O61B 4EBQL 2D3VA 2H9GB 4GS7B 2SEBB 2VZSA 3AM8C 3VWKB 5C7XH 5EO1B 4E41E 2P24A 4P5MB 5IB1A 4E5XB 3C2AH 1K4DA 1RMFL 4JFXB 1KGCD 1HCFX 3D3VD 1H3WM 1W0VA 4L4JA 2I60L 4N0UA 4RGMC 1I9JL 3TJEL 3VXNA 4Y4HC 4NFCA 2KZWA 4R0LA 5E08L 3N9GL 3TT3H 1KTRL 1CLZL 1A4KA 2CXKA 4P5KB 5DS8A 3EO1B 2P42B 1JHKH 3KPSA 2MOVA 4L4TD 2HT2C 3D69B 1UKSA 4LHQB 3RGVB 1FO0A 2AJSL 3JTSB 1IAOB 2CLRA 1KTDA 4XCYB 1YMHA 1MJUH 1XR8A 4PRIE 4AK1A 2B4CL 2W0LA 5ILTL 1TCRA 2R2CA 4IMKA 1S5IH 1EMTH 1ND0B 3ZTJG 2JELL 4XX1E 2VR5A 1IFHL 3LRGA 4UZGA 1IQWL 1P69B 5IK3A 1MCPL 1BBJA 2IBBA 4NRZB 1J8KA 3JV6A 2AKRB 3S5LA 3ZHKA 1S7QA 3DX6A 3W5MA 3GI8L 4TSAH 4ELMF 4Z8FL 4YQXL 2AEQH 2IH3A 2IPTL 1GZQB 4H25A 1A6UH 1N5YL 2A73B 1A7OL 1T0NA 1S3KL 5EBGA 5D9SB 1H3VA 4RMSA 4WHTB 5D1XA 3IFPA 1YQVL 3FRPG 3GHBH 2X4TA 4ZOAA 4PRPB 5HVHB 4XP6L 2IH1B 1RZ7L 4X4YB 2HT4C 3QWQB 2V17L 4GFTB 3ULSB 4RRPA 1S7UB 3EYFB 1WICA 4H5SA 1X9QA 5ABDE 5I1KL 2R4SL 3ESVF 4Y1AA 4OV5A 4HUXA 3K80A 3MUY1 3Q5TA 4JKLA 2Q7YB 4GG6B 1MJ8H 5H35B 1ZGLM 3QDGA 1BF8A 3BPNC 4P2OA 5T33H 1TZIB 2ZUQC 2RHEA 3WXWH 4Q6IB 3KR3L 1LO4L 4K3JL 4S1RH 4GRLB 1N59B 3T0ED 3VFWB 5ICZA 5T5NG 1NCWH 1YMMD 2FD6H 2C4FT 2ICEB 5EU4A 2IAMC 4F2MB 3DXAE 3UTPE 1A2YA 3CJJA 4Z7VA 4NO2A 4PJ7A 2IANA 3ZDZF 5B4MD 4DZ8A 2CRIA 4I18A 2IJ0C 5IF0A 4BSJA 3QULB 3IFOA 1IM9B 4LEOB 2AJYH 4XCEA 4ZXBD 3ZO0A 4XCCH 1OGAB 3QBTB 5JORA 5GGRY 1E27A 1KJ2L 3VXTA 5EZOH 3FFDA 3UTZB 2AK4B 2EDNA 2O5YH 4QHLB 5ESVB 3STLA 3VI4E 4OBRA 4OF0A 4RZCB 1U2CA 4F33B 4LIQH 3MC0A 1IGYB 1T7YA 3K3QA 1H15B 2ESVA 2VLLB 1BZ9A 1EEZB 2E8YA 1IC7H 3HI5H 2Z4QA 1DLFL 3OAUH 2HH0H 3NVQA 5TDPB 1FYTB 2JE8A 2OR7A 4PB9H 5D2NB 4P4KA 1M7DB 1AO7A 2JJTC 4LARH 4XAKD 2M26A 4Y5XC 5ID1A 4Z76B 3QXTA 3AS0A 5D6CA 3OKKB 3MLXH 5HGBB 5FEBA 1JGDB 4UDUB 2X70B 4K94L 3BN9D 3U6RB 4EI5B 4BK4A 5D6DC 2HMID 4G42A 4WO4D 2VJXA 1C5CH 1GGBH 3WNNA 2Q6WA 3MROA 1T1ZB 3WNOA 4G6JL 2VH5H 1CG9A 2V2WA 3O3EB 3PDDA 1LP9B 4XP1H 1ZLUK 2ADIA 2WLYA 4OFYD 4XPBH 1FNHA 5J57B 3ULVC 2AXFA 1TVDA 3SKJH 1MUJB 5GGQH 4QTHB 4XVUD 1K8DB 2UV3A 4OCWH 1KN2L 1JWUB 1OSZA 3HAEG 4R4FL 1YNTB 4KJWD 4S1DC 2J8UF 2ZUSA 2DKSA 3FB8A 2CH8A 4LCCC 4G80B 1AR1C 3CX5K 5CJ8A 5IVXF 3BVNB 1DBKH 4POZC 5I1LA 3WFEL 4QYOA 5JOPE 4GBXB 4YPGA 4HIEA 4JRXE 4I3SL 3MRHB 5L2KA 3BPLC 4Q97A 1JRHI 2J1KA 3O6KL 5F96L 1FFRA 1UJ3B 3QDMA 4GMTH 5E6IC 4PYGA 4Z7OF 3LMJH 3HG1E 4HJGA 8CGTA 4AEIL 4DUVA 3F12A 2HTLD 2Q86A 1DQTA 3HI6H 3QUMH 4YDJB 5HYQA 2FYYA 3MV8E 4Z7WE 3GSRB 2VLRA 1TVHA 4ORZC 4ZO6A 4JE4B 1T7WA 4X8JB 5HYEA 3ZE0E 5HYFA 1YUHB 3VI3E 1IBGH 2EKSB 5I1DB 2GFBA 4I2XA 2P47B 3GM8A 5GRWA 4HKJB 4ZSOB 4XNXH 5GS2D 1ZLWH 2AJUL 4KKCD 4DK3A 1G9EA 2UWEF 2BCKB 3WSQH 2YSSB 1T04B 1S9WB 4JCLA 1FC2D 1FVEB 3G9AB 2HJLA 2P5WD 3ZDXF 1MCJA 3SDYL 4HK0A 3VH8A 3UJJH 3RGVC 2A6KA 1DDHB 1CDGA 1XF5B 3EOAA 4OZ4B 2VE6A 4MJ5A 2B2XL 4I4WA 1NCAL 5SWQA 1EO8L 4U1MA 2XXCB 4FQPA 5F6IB 3AXLB 3QUMB 3GK8L 4I9WD 4ZO8A 4MA3B 1Z3GL 4GAJL 4PUBH 4QRPE 2C3HA 4UIKL 1INEH 3RQ3A 2HT4D 1HDMA 3L9RA 3CFJB 2JJWA 4TSBL 2PXYB 3TBSA 3DECA 3S37X 2FJGA 3LZFH 1HNFA 4RISH 1ZVYA 1GGCH 3K2UH 1ODAA 4MB4A 4JM2F 1L9MA 3C9NB 5ERWB 4XCNA 3B2UD 3TBVA 1A6WL 5GGSB 5EC2A 4PJBB 5DSCA 1LO5A 4LU5L 3V4VH 1SBSH 3UTSB 1Z9OA 5DWUH 2X6MA 4KPHL 5HVHC 1W72L 3UPCA 3DVFA 2JB5L 4OLVH 5IV2B 4KKNA 2G60L 1QYGL 3DIFB 3G6JA 1FLTX 3SJVD 2XQBH 3G5VA 4PYHA 1PSKH 4NQEB 1RUAH 3U4BL 1DQMH 4U6YB 1MI5E 1JJUA 1NBYA 5ECJE 3AAZB 4LBEB 2G5BA 3D2UD 4L8BA 3OB0H 3C60A 2CO7B 3HR5A 2VABB 1YECH 1U36A 1BJMA 1TQCB 2WV3A 4NBXB 5T5NF 4Q6IC 3FN0L 2A6DA 5EUKB 4LKXB 3IS1X 1EJ6A 1G9ML 2W9EH 5F1IA 4AZ8A 3ES6A 4ORGB 5EU7C 4GLRH 4OF5A 5B8CC 5C0CA 5E94B 1IEAA 3W9EB 2H2PC 5I76A 3T1WA 5E2JA 3PV6B 2ATKB 4XPAH 3WD5H 3ZZ1A 4CKVX 2NY5H 4DEPB 4HC1L 2VSDA 3IJYB 5JHDD 4OCXL 1LNUA 1IEHA 3BZ4A 3O4LD 2OTUB 3UJIL 3VXQA 1Q9WA 1I7TA 5HPOA 5INDB 4JG0L 2NXYC 1R3LA 4JZOB 1OOAA 4NN7B 3L95A 4RFOL 4RIRB 3WS3B 1CFNB 1CE6A 4N5UA 5F88A 2W0FB 1RZKL 2X4QB 5CSZA 1OARL 1RZ8B 2G2RB 3L3OA 3V4PL 3KHQA 3OKEB 3V6BR 5D2NC 3VMNA 2E6JA 3IDIB 4MXQA 2VZTA 3HE7D 1T83A 2FSEB 3TV3H 4PG9B 1PG7X 4BH8A 5DVMA 4E0RA 4KROC 3OJMB 1UKQA 1YNKL 2AV1A 4X6CB 1QVOB 2UVEA 2QL1A 3MRFA 4GAFB 1IAIL 4YDVA 1CFTB 1OAQL 4EI5C 1LEIA 2CUIA 4N8VG 4ZFGL 3CVIH 3E6HB 5EU6D 4POZD 4NQXA 1BJ8A 3C8HA 1RK0A 4NKIL 3W11C 3FO9B 1IAMA 1Z2KA 3E1F1 3MODH 1G1CA 1H3PL 1QBMH 4LLDB 3KAAA 2H2SD 2P5EA 5L8KB 5DUBB 5F1NB 4QRPA 1JV5B 5HYJE 2H8PA 4S11A 3H9HA 3UO1H 4WI9A 3BIBX 3MRJB 5D5MF 1CD1B 3QXAA 4JM4H 4TULH 1BVLA 4G8FA 3NACL 3IGAA 3NFSL 1JPTL 1ZKAA 3O9WD 1KCGC 2FB4L 2ICCA 3QAZB 3WHE0 4EOWH 3CCHA 4HZLA 5TJWK 1DFBL 1U93B 4YPJA 4QOKD 1UEMA 2W07A 5DD6A 1IARB 2VDRL 2P49B 5MENA 1EAPB 4OGAD 2VIRB 1SJVA 1I8MA 4WIQA 4F9PA 5GZOC 3VWKD 1U8IA 1LEGB 1X5YA 3QXVA 1AHWA 4ZOBA 2EEAA 1ORSA 3W39A 1UWXK 5D1ZA 1KCSH 2C1PA 4ZUTB 3LRHA 1EFXA 2AI0L 2D7TH 4GW4B 4OF3A 3HPLA 1SVCP 3SQOL 4ELMA 1UJ3C 5LGKA 3IT8D 4LF3A 4X83A 3ZE2E 2BZDA 3QDJE 1NJ9B 5F6HI 2UZXB 2XZQH 3BEWB 4F3FB 4HCRA 4JN2B 3TPUE 1LE9B 5T1LD 4XBEL 4AYFA 3FCTB 4APQA 4JO2L 3H8NA 3T2OA 1DQLH 2NW2B 3GJEA 3GDBA 2RBLA 1XCQA 4X7EC 2NR6C 3VJ6A 4JDTL 2L7JA 4LEXL 1NCDL 4EEEA 1OLLA 1ZV5A 1EHLH 2ZNXA 2Y5TB 5HD8D 1KXVC 4NDMA 5SWSD 3TP4A 4BFGA 2HVJB 4KMTL 3C08H 4ODXA 1VFBA 3U7WH 1JN6B 2X1PA 5E2WH 3CU1A 3QHFH 5BO1H 4Y2DD 3ULUF 3BQUB 1ZLSL 4V3EB 1YEFL 2R0LH 3EJZC 3LAFA 3PQYB 1NFDB 1S7RB 3CFCL 5DMKA 4Z0BL 3MUJA 3U30B 1QSFE 3DUUA 3N85H 5F6IC 5FO7B 4PRPD 4RGND 4QXGH 2A77L 4WTZG 4H0HB 2HJFB 4Q6YA 4KKBC 5EIIB 1QTYT 1I9IH 2DQUL 5IROC 4X99B 5DJZB 4FQ1L 2B1HL 4JFQB 1XGUA 1DEDA 3TYFB 2CK0L 3L3HB 1CK0H 1S7SB 4U1NB 3QFJA 4UOW1 3TWCL 1I4FB 2V7NA 2AAVA 5IIEA 3QXDA 1MIEL 1QR1B 3R1GH 1CL7I 4OLYL 5TH2B 3LPWA 4NKDA 4PJHF 5IMOB 4JPVH 1ZHKB 2J6EH 5HDLA 4LCYB 1FL5B 4OQ1A 3UTTB 4Y8AA 4N5EA 4LHJB 1T0PB 3SEPA 4GRLD 5K9QG 4TNWF 5DHVA 4JFEB 4AT6B 5GGUA 1SHMA 1JPFB 1WCBA 2YUWA 4JFFD 4YXHL 4NQSB 3VXRB 4LPTA 4NZUL 5DEFB 4KHXH 1U3ZA 3MRMA 2Y9RT 1RVFH 2H2PD 3V6OE 5IT2H 4P49A 1D5BB 2MMXA 2HRLA 2VKWA 1ZGLB 3EDDA 4LLWB 3JSSA 1TJIL 5MP6L 5BZWB 4P2YA 4PGEA 4FQCL 2HFFB 4N8PA 1IM9D 2EZ0C 5ENWA 4X6DB 1TQCC 3RZCA 4YNYB 3VE0A 1INQB 1OGAD 3G04A 2ZCLL 3GI9H 3OKYA 4J1UA 2QADB 4LSRH 1NAML 1QSEA 3TO2B 2WK2A 4KXZH 4MDJA 4U1SA 3K4DA 4OD2A 3PNWA 4K7PY 2I25N 1NLDL 2NY3B 3MRPB 1QHOA 2BVOA 3EYQD 1H9VA 2J3SA 1LO0L 3SGDH 3VGGA 4EVNB 1AGDB 4J2XA 4NQDA 1JMZA 4NZRL 3RWFA 3CFBA 3P4NB 1GIGL 1UKTA 3JV0A 4O02L 5FGBC 4X80L 3BPCA 4MLIA 2J8UA 1N6QH 1KIQB 3M1BB 3F7YA 5EWIH 5DJ6A 3CVHA 5IVXA 3WXVL 5DR5L 3BHBA 5I16B 1IAKB 2OJZH 4FQIH 1A3LL 4ZG1A 4NN7C 3WFCL 3B6SA 2OTWA 1QEWB 4NBZB 4DKFH 5CINH 3T0DA 1QOKA 1G7IA 3IDJA 1X5KA 2ZG3A 3MOBH 4DGIL 4N0CD 1P7QA 3W11D 3PIQA 1IQDA 4ERSH 4W4NA 4UILH 2X4RB 2E7LE 1AKJD 3FFCE 4ZUUB 3SDXA 1JGUL 2VLJE 3ZSSA 2FCBA 2NY5C 1A9EB 4JG1H 5ISZE 1N5AA 4QHNA 5I1HL 3ROOA 1R3HA 4MQXD 4XPHL 3LOWA 2FZ3A 4PJAE 1A47A 2D7OA 5EULV 1Q0XH 3K8MA 5KJRL 2C3GA 1AIFB 4QRQA 5JR1L 3W0WB 4R4BA 4JDZB 3RNQA 1VA9A 4GBXD 1F8TL 5DQ9B 4FXGB 3RX8A 2UWEA 4IOFC 3MOQA 4WEBH 3U4AA 5IB2A 3FQRA 2XA8H 3I84A 4KGJA 4CMMB 3KPMA 3MGTA 2DQHH 2JIXA 3S35L 5T1MB 5DJ2A 4G7YH 5I8KH 5C09B 1SJEB 4L5FH 1BLNB 1BFOA 4KAQH 3QAZC 3L3KA 4PRBA 3FT2B 4MCZB 2I9LB 2DN7A 2XTJD 3DV6B 1AE6H 1Z9SA 3O2VL 2KL6A 2CLZB 4MNQB 2Y6SC 5C0IB 3DGGA 5ADOH 3EGSB 2GJZB 4P2QE 4RWHA 4KZEH 4JHAL 5JZ7C 4A2MA 4F9LC 4P23A 5I1GL 2F5AH 4GXUN 4UQ3A 1UXSA 4FG6C 5KN5B 4LFHG 2J88L 2HFEB 2C7UB 4ZNEE 3FRPA 1BGXL 3E2HA 3VA6A 4LSSL 3JWNC 4Q9QL 1AI1H 1UVQA 1CXFA 1CF8H 3KXFB 2WINA 1I9RL 2D03L 3QUXD 4Z7QE 4C4KT 1AGCA 5E9DE 3JVGC 5FHBH 2R39A 4ALAL 4GH7B 5HGHA 5JIKA 5FGCE 1LQSR 3T4YA 3VWJB 2PXYD 1GAFL 1OP5H 4NJAL 4H1LH 5CLTA 1MCBA 4ONHA 1SMAA 2GTZA 5IBUB 4MYWB 2OP4H 3FO0H 1JPGB 1UH3A 3BQUC 1AD9B 3SE4A 1IE5A 2YRZA 2ZG2A 2AQ2A 2DAVA 4DGVH 5C9JA 3UTSD 3TIEB 4O2FA 3U30C 3R0MA 3D85A 1L0QA 2C4XA 4RAVA 4X4ME 1FAIL 3DVGA 4FP8L 4JY5H 2W60B 3PWPA 1HQ4B 5C0NC 4PJEE 3CFKA 2ZUXA 4N9GB 5C0JA 4WV1B 4NQED 2QKIB 1LWRA 3GSNA 1A14H 4CMHB 3EFFA 4DOHB 5HHNB 2C9AA 3L6FA 1WBXA 2BRRH 4H1LB 5I74B 3O3BB 1NDGB 3FQTB 3RZWA 4TVPE 5GGTL 2EE2A 1HHJA 3CDGB 4JRYB 1TMCA 3UZQA 3K8KA 4YC2C 5EOCH 3HC3H 4M1DL 5CD5C 3VFVA 5C2BH 5IB3B 4IRZH 5KANI 3FQXB 4PJ8B 3LKNB 3D0VA 3MRQA 1GHFL 4GKZA 4UUJB 2GAZB 3O6FA 1QPPA 2HWZL 5GZNC 4R6UA 4YZFF 3A6CL 3UTQB 4MMZC 5HHOE 4UV7L 2WQRA 5D7JC 5T3ZH 2DIBA 3WFBH 2YD6A 3MNVB 4JO1L 5E5UB 4PB0H 4FFYL 1A6TA 1A1MA 2QADC 1PKOA 3KWWB 3KPPB 3O6ML 2CJUL 5I8CB 5KVDL 5KG9A 4ODHH 1FO0H 2NY3C 2R2BB 5KZCB 2O5ZH 2WP3T 1IM3B 4U0QB 1X5LA 3TM6A 2P8PA 4QRSA 3WN5B 3HAEA 3QXUA 3ARPA 5F93C 1G7MA 3T0BA 3WHXA 1XF1A 4P2QA 3LD8C 2XZZA 2M8XA 2PR4H 3E6FA 5IB1B 1EBPA 1K4DB 4FXLA 1D5ZA 5EPMA 4BQBA 3LQMA 1BOGA 4JPWL 3MA7B 2BOCA 1W0VB 1N64L 1WC7B 4NNXA 4EIZC 4N0UB 3ABZA 1NGQH 2H1PL 1R3JA 1F4YH 3GBNL 5FYKH 2RCSL 4YDKL 4HFUL 3GIZL 8FABA 2IF7A 1QLRB 3EDKA 1W72B 3JWDL 5D4QA 5A2FA 1ZVSA 4AQ1B 4K3DH 3EHBD 5LBSH 1A4KB 4OCSH 3GEWB 3MNWA 5J3HD 5DD0H 2GJ6D 5J1TC 4XP5L 4IOFD 2CLRB 1KTDB 5FIEA 5ALCH 3RVWD 1XR8B 3MYJA 1A7QH 1C08A 4WY7H 4B53A 4F7MA 3IXTA 4I0PA 4Q9BA 1RZJL 2P8LA 1A7NL 4J3WA 1R6VA 3STBA 5CJOL 3QDHA 4Y7MA 3EYOB 1BBJB 1OAYH 1CD8A 3OL2A 3JV6B 3QWOB 1MVUB 1Z5LA 4JFZH 6FABL 3NN8A 3S5LB 1UM4L 1F45A 3DX6B 4YBLB 5EUOE 5IFAL 1QBAA 1F6LL 1G7LA 3QEQB 3KPTA 4H25B 6CGTA 1MFBL 1T0NB 3MLUL 2NXZB 2PCPA 3HUJE 2VDOL 2JF1A 5D1XB 1K6QL 1P4LA 2X4TB 4D0DA 1NDMA 1QSZA 5FXCH 3FO1A 1ETZA 3NABH 5MEOA 3V4UL 2OR9L 3V0WH 5JPMA 4LQFH 1UZ6E 3HB3C 2VZ3A 3DBXA 1BAFH 4H5SB 2PYFB 4JPKH 4OV5B 4Y1AB 5DQDH 1CDUA 3RHWF 5GS0H 4HUXB 2FL5A 1BQHB 3CLEH 4F57H 4JZNA 4NKMA 2Q3ZA 5IWLC 1MY7A 1ZS8A 1QACA 2K9UA 4O2CA 4PTUB 3QDGB 3DO7A 4P2OB 2HFGL 5C0AA 1E4WH 3S34H 1GZPA 1YEKH 2BHYA 2IBGA 2VXTL 2BK8A 5J56B 3X11A 4NN5B 3G6AA 4FQHB 1IJ9A 5AYQA 1DQJA 4PJHA 5ICZB 3BGFB 1BQLL 1YNLH 2CKNA 2P45B 4HH9A 4D94A 1M7IA 3ZKSD 1J0IA 5EU4B 4CU7A 1GVIA 1A2YB 4OT1H 5DK2A 2X1OA 3KG5A 3GM0A 5IHUL 4FZ8H 2YUZA 3MLSH 2EH8H 4NO2B 1T21A 5F72S 2QQNL 4PJ7B 5H94B 5HHOA 3VXSE 1I1AB 1I7ZA 4OFPA 3WO3B 5DMGD 4I18B 5IF0B 1T5WA 5F71A 1J8HE 5D7LD 3B9KB 1S5HA 4XCEB 3RPKA 4OM1H 3VWJC 5KSAD 5L2JA 4L8CA 1MRCH 5F89A 5DD1L 4M48L 1D7FA 1JGVL 1RIUL 5C0ND 5JORB 5E4IA 4W70A 2E27H 1E27B 3VXTB 5I73B 1CD9B 4DAGH 1ZK9A 3TEUA 4DVRH 3KPQA 3STLB 4JM2D 1L6XA 1RZFL 2WBJB 3M07A 3V2AR 1BZ9B 2B1AH 4S1QH 3P4OA 1L7TL 4HKZB 3BDYH 4PP2A 1ES0A 3UTTD 5HDOA 4P4KB 5CD5D 1RAMA 4GSDH 3D39D 4YX2L 4WI4A 5ID1B 3PP3H 1R0AH 2R2HA 5ID0A 5D6CB 4WV1C 3FAXA 4NWUL 4KZDH 4HLZG 1FFQA 1J1OH 1MFEH 4CMHC 3H7BA 4O5LL 1G6RA 4J4PA 4NQCA 1A1OA 2EDYA 4YFLF 5GZND 2XKUA 1B2WL 2Y5EA 1PDKA 3EYUL 4G42B 3AROA 5FKPA 3BP4B 4XBPA 2QQKL 5I74C 3MROB 2CKBL 3RVVC 1EO7A 5BQ7A 1CG9B 2V2WB 5FYLE 4UV4L 5A16A 5IQ7L 3DGCR 4HH8A 2AXFB 4HUWA 1KIPB 5DDHA 2NTSP 5DJDA 4YO0A 4FQJH 1CTOA 3LB6D 3H3BC 4OSUL 3HFMH 3OX8A 1Z0NA 3IVKB 2H3NA 3KS0H 5DUMH 3WEXB 4FFVD 5I1LB 4OD3L 5JA8B 4Z77A 4N8VA 5TF1L 3QIBA 4YPGB 1KULA 2AGJH 4KTEL 4OLEA 3GBML 3HUJA 5L2KB 3INUL 4Q0XH 1TCMA 5E00A 3OR7A 5C08E 1GC1L 4GMSH 1N2RA 2XKNB 1NC4A 3MV7E 3NIFE 3QDMB 3MOAL 3RTQA 1WWWX 1PLGH 5K59F 3C5ZD 1P7KB 2VQUA 3O4OB 4KK9D 4HJGB 3VFUA 4FMKA 3TZVC 4B50A 3GZKA 3F12B 3LKSA 1XAUA 5EDXA 3HS0A 2W91A 2Q86B 2A6IB 5HYQB 2FYYB 1BWMA 5MERB 2VLRB 4W6YB 5JO5A 4QHKJ 3WIHA 4ENEC 3VD4A 1WQVT 2AK1L 2GFBB 2AS5M 3HE6D 1P4BL 3Q6GL 3EO0A 4R0LC 1RJYB 1F3DH 4H20L 4W4OA 2IPUG 4L3EE 2JCCA 3QXWA 3FOMB 1ZE3C 5D1QB 3W2DH 1GGIH 2HJLB 4AM0A 3I9GL 3NFPA 3VFOB 5L8LB 4Z7NE 4HK0B 3VH8B 2A6KB 4ZPVA 2IC2A 1TQBC 1X4YA 1GOFA 2VE6B 4I4WB 2YN3A 3UROR 5SWQB 1R5VB 2V5SA 4U1MB 5KS9F 4IMKC 1DTUA 3VRLE 1KGCE 3U2SA 1T66C 4J8RA 4ODVL 5C09D 2AV7A 3C09B 3BE1L 1A7PL 4Z6AT 5CZXC 1ZA6A 3L9RB 1AR2A 3QIUC 3TBSB 1NAMB 5JXED 2VXQH 5LG1A 2BNQA 1CLCA 2FJGB 4FQQA 2PUQT 3CAFA 5KBNC 2WUCH 4YBLC 4D9RD 3LQAL 2VN7A 4XCNB 3TBVB 5J11B 43C9A 5EC2B 4MZ3A 3VW3H 5DSCB 2NY4D 3MLRH 1LO5B 2NXZC 2M1KA 3PDGA 4Y19A 5D1XC 1U8KA 1MRDL 1W0YT 4GQ9L 5GGVH 3OZ9H 1MEXH 4IM8A 4U6TA 2VUYA 2X4UA 3QUYA 5HHMA 1A7RH 4WTZA 5HGAA 3CLFH 2OJEA 4DWHA 3GSQB 3ARRA 1S7WA 3KXFD 3G5VB 4JQIH 4XI5D 1I3VA 1KG0A 3BAEH 1F90H 5KSVB 3MA9L 3ZKXB 1DBBH 4XHQA 3IRZA 1UB5A 5DRXA 3GNMH 1OPGH 4L8BB 2QHRL 4I1NB 4P2OC 3C60B 3HR5B 4WDIB 3GKWL 2LFGA 3VG9B 1LVEA 4RBPH 4HIXL 4XNYL 3VWJD 2A6DB 4JN1H 4NN5C 5FYJE 1JGLL 4MA8L 1E4KA 1WIOA 4TUJA 2FBOJ 5F1IB 3ES6B 4KQ4L 5MI0C 5CUSL 4NJ9H 3HZKB 1P84K 3T8XA 3KJ6H 1UM6L 3X13B 1IEAB 2W0KA 4S2SA 5LGHH 1V3KA 3G9VA 2ADJA 1FE8L 5ACMA 1CD0A 5D71L 3RHWK 4BZ1L 5D2LE 4GG8A 2NY1B 4NO3A 1A21A 3U4EB 1LNUB 3Q6FB 4I18C 4NP4L 1NQBA 4PJGF 3ARDA 3X3GH 1DUZA 1VGKA 2BVUA 2VN4A 2YR3A 1F4AA 3BIKA 3BZ4B 5DGQA 1JPSH 2A0LC 3HZYA 5GS0C 3PHSA 3VXQB 3MV7A 4Y16B 1Q9WB 2HKHL 3MRNA 3EYVA 1I7TB 3WE6A 4KVNL 3MLWH 4UBDD 4TSCH 1IC5L 3L95B 5HYSG 1U8OB 3MV8B 3BKJL 4LVHB 3SKOA 1J7VR 1CE6B 1S7VA 4WEUD 3IF1B 3KPRD 1XGYH 4IOSD 4TVPL 2FGWL 5DD3H 5CSZB 5FA4A 2ZOLB 4GT7A 3L3OB 1CVRA 5FECA 4JRYD 5JW5A 3TCLA 1D5IH 3OKOA 3BH9A 1RIVH 4ZUVA 2FX7L 2YD3A 4P4KC 4YHML 2VZVA 1NGPL 3RKDC 1B0RB 4BH8B 5JHLH 4E0RB 4PJ8D 3QPXH 2P44B 2DM2A 1LK3H 1RUMH 3MRFB 4YDVB 2V7HA 5DUPL 2DD8L 5GXBB 2DWDB 2R15A 4NQXB 5C6PB 1VACA 2VUOA 3QPQD 4BUGA 1RK0B 4TTDC 4LLYA 5F8QC 4DKDC 1DL7H 4QRPB 2H8PB 1B90A 3UC0L 4HUUA 4HPOL 3H9HB 4V1DA 4X9BA 2GSGA 4HCRH 1A6AA 2Y06L 3QCUH 3QXAB 4WI6A 1BVLB 4G8FB 3IGAB 5KZCD 4NGHH 3CCHB 4HZLB 4FTVE 5L9DH 5MENB 4N0FA 1I8MB 1D9KB 1UCTA 1MFDH 1U8IB 2MPAH 1C5BL 3LPFA 3KPLB 1AHWB 1PZUB 3KYNA 4BSVB 1ZOXA 5D1ZB 4DN3H 3QCTH 1EFXB 3GSWB 3NBNA 3NIGF 3HPLB 2F74B 1LK2A 3BKCH 5K9JH 5I30L 1IGIL 4G6KL 2NLJA 3T0WA 4ELMB 3DWTA 2HA1A 1TZGL 4Q58C 2NY0D 4LF3B 3VFGH 1H3XA 3VGDA 4BQCA 2AJVH 4YE4L 2GY7B 4AY0A 1WAAE 5D8JL 4XMLH 5C71A 1A5FL 1MI5B 4UT7L 4P2RE 3U48A 1LE5B 2KBGA 4YHZH 2VDMH 4HFWA 4JJ5A 4APQB 4G6FD 4LSVL 3SDDD 4U6XB 3KLHD 3K7UA 5M7QA 3GJEB 3SE8L 1KCRH 4GJTB 2D7MA 1V7ML 4XNMA 5HHXH 1HWHB 3FQWA 2ZPKL 1JBJA 2VAJA 4LP4A 3VFNA 2JLLA 4NDMB 4WW1B 4G8GD 4ODXB 1VFBB 5DLML 3QEQD 5D70H 1RQ5A 4Y88A 4Z7UF 5GJSH 1X5HA 2NY6B 1KLUA 5DHVH 3VXUD 1J0HA 3T3PF 1I8IA 5J1AA 4HWEL 3CK0H 3QEHB 4PRDA 5DMKB 1Q72L 4Y8DC 3DUUB 3S37L 5EORH 1FDLH 1YEEH 4O4YH 5BS0A 3QRGH 4YHIA 5SWZE 4GUPA 4XCFL 3H7LA 1H3TA 3LS4H 5JIHA 3RX7A 5HPMB 1FG9C 2QQQA 5KW9L 12E8H 3QIWB 3IFLH 5ESAA 3QFJB 5ETUA 1UACL 2V7NB 3GJFA 4MVBA 5J11C 2XACC 2XPGB 5IIEB 3QXDB 5EZIH 4M8QA 3QDGD 4KXZI 5J9PB 3RL2A 4NKDB 4WENB 5ALBH 3MGAA 4U1IA 3GHEL 2VXVL 1OD7A 5FKAB 1OTTD 5GGUB 4MDIA 1XIWA 3MRMB 5GRUL 3IETA 4OZIF 2GT9A 3WL9A 2ZCHL 3JZ7A 4X7SL 4S0SD 3ZKXC 2ERJC 3CVHH 2X89D 1I1AD 2BVEA 2F5BH 3O2DL 3MXVH 3UAJC 4QRRA 4D8PB 4PGEB 3C60C 5FF6A 5ENWB 3MRKA 2DQIL 3RZCB 1WTGT 3B9KD 3TN0A 3VE0B 5GS0D 2VTFA 2Z31A 3G04B 4HMCA 3SY0B 2VL5A 3OGOE 4HSQA 3PWLA 1D5XA 4J1UB 2ZUUA 1QSEB 4JB9L 3TESA 4AIZA 4MDJB 4HKXA 4U1SB 5I1EL 4OD2B 3P40A 2EH7H 3MJ9L 3PNWB 3RU8H 4DGYH 3I02A 5DRNA 1YJDL 2R8SL 4HEME 3ARGA 2WBJD 3F7RA 1FL6A 4KQ3L 4G5ZL 1KJ3H 4M7LH 3RWFB 1TXKA 1P6FA 2EC9U 2QQLL 3K74B 2H6PB 4MXWH 4P4KD 4NHUA 3ZT6A 4PRHE 3V9FA 4LAQL 5C6TL 3F7YB 1RUKH 1VFUA 3CVHB 1FLRH 2CQVA 3ETBF 3P9MA 3THMH 5BZDA 4IMLA 2OYPA 1F11A 4FXKA 1SEQH 3B6SB 1KXTB 2BNUB 2OTWB 3NCYP 4LVHC 2AP2A 4RMTA 3TPUB 1NMAH 4LLAA 4EDWL 4HK3J 1IKNA 1G7IB 3V7MA 2HTKD 2C3VB 3WJLA 5FYLL 4PRID 1PG7L 1P7QB 5JNYA 2DTMH 3PIQB 3GMOA 1IQDB 4TQEL 4MXQC 3QI9A 3ZTJH 1T83C 3SDXB 2DJ4A 2Q8AH 5B3JF 5E2VH 1NMBH 4M6ML 3OJVC 3CX5J 1N5AB 4QHNB 4E42A 3OGCA 4UT6H 1JTOA 1MIMH 2FZ3B 3CSPA 3PHQA 4U6VH 1JK8A 4OZHF 4CNIA 4CDHA 4X7TA 4QRQB 3T77A 4R4BB 5C70A 1AC0A 4X6FA 4GRWE 1VFMA 4XT1C 2IGFL 1QSFB 4HGKC 1IC4L 3I75A 3EJYD 5E2UL 4XVTL 1IVLA 3NCMA 5E5RB 3L5IA 1F4XH 5IB2B 1OLZA 3KPMB 4ODSH 2JIXB 5DJ2B 5AG8A 3ULVE 5DK0A 1OAZH 3L3KB 4PRBB 4L9LA 1MPAH 4QTIL 4M7JL 1KBGL 4KJPD 3EOTH 5KS9A 4YIQA 3S3SA 4F9PC 1IEBA 2WW8A 2PTUA 3DGGB 1MWAL 1AHWC 1H8NA 5D1ZC 4HXAH 3NCFB 1ONQA 4N1EA 5EU6E 5EO0A 4WW2F 3RWJB 1ZMYA 5E4EB 1QUNA 1MAMH 15C8H 3KHOA 5BRZA 2HYMA 4UQ3B 3BP5A 3S9DB 1QKZH 4OLXH 1T20A 3E2HB 4N0YH 2CMRL 5D1QD 4FQ2H 5EZLA 4UB0L 2XY2A 4RGOL 1KFAH 3DXAD 2FEEI 3UTPD 4U33A 3UYRH 5CBAA 4KH2A 1UVQB 2AJ3B 2DWEA 2WINB 1MFAH 4DFHA 3MACH 1T1WB 3M8OL 4WHYH 4PGBA 5CILH 4PJIA 4APQC 2CSPA 1AGCB 3PGDA 4S1SH 3EFDH 4LSPH 3S88H 3A67L 4NZDA 3GSNH 3BZEB 1NL0H 5HGHB 2OM5A 5DRZA 3TNNA 1YYLL 3T4YB 3R0NA 3IXAA 4NNYA 5E0QA 2UUDH 1YEJH 2XZCH 5HJ3A 5GISL 1YQ2A 4ONHB 1DBAH 1MCKA 1R5WA 5IEKA 4WI7A 1BD2E 3TYGL 4Z95L 4D0CA 4JREB 5I1AA 2NY6C 1MOEA 3BWAA 4PP1D 5J1SC 5AEAA 4O2FB 3DI2B 1QBLH 3ESUF 4YGAB 4RAVB 1NKRA 1UEYA 4FQLH 3C5SA 4DTGH 3PWPB 3SDCD 3CFKB 3F7VA 3PWJA 4X98A 2UYLA 3WNMA 3FJTA 1FZKB 4OI8A 4PJGA 3Q0HA 3KPOA 3K81A 3GSNB 4LASL 5T1KB 1PW3A 4M6NH 3EFFB 3X17A 3NTCL 4DJMA 3L6FB 2HT3C 4UNVA 5DJYA 1WBXB 2XFXA 5C0FB 1MCDA 3TJHA 1AGFA 3FFCB 4N5EC 1HHJB 1U3YA 5FYJL 2VLJB 1EGJA 4L4VE 3HAEH 5ISZB 4PRPE 2CRZA 3BRGC 2BDNL 4N90E 5CKAA 5CEZH 4U1HA 2ED8A 4PJAB 4JHWH 4G9DA 4FA8A 1IGCH 3D0VB 3MRQB 4GKZB 4MCYA 4MNGA 1RPQA 1SYVA 3K8LA 3LKPA 1AFVL 3E3QA 3O6FB 5F7DA 1RV6X 5JOPD 3T2NL 2EE3A 2NY1D 4JRXD 5KSBF 5A3IC 5F9JB 3ALWA 4OBSA 2QR0A 1A6PA 3RA7L 3HZVA 3ARSA 3RAJL 4XMPH 5ICYA 5DTFB 4FFZL 5INCA 1UM5H 3RZCC 3WKMH 5I8OL 1FFPA 3C2SA 2OBGA 2DI9A 4Y16D 4PR5A 1A6TB 3HG1D 1A1MB 1JTPA 4I0KA 3V0VB 5KG9B 2OL3A 4ZMAT 1UZ6F 1MHPH 4IHOA 5ANMA 2NTFA 3MV8D 4NCDA 5EU7E 5DVLA 3B4NA 3D9AL 1P1ZA 4OB5L 4OUUB 3HAEB 2XWJA 1U6AH 1FG2A 4P2QB 3QWRA 2AJXL 2MCG1 1D5ZB 4PREA 1I1FA 1Z0MA 2VERN 3L7FA 1U3JA 2BOCB 5GIRA 5KOVC 2AVGA 3BP7B 1OGAE 8FABB 3DRQA 1ACYH 3RWGA 2AK4E 1HHGA 4KJYA 3L3IB 2JKXA 2HJKB 2ORBL 3O8XA 1IGML 4LLMA 3LEYH 2X9XA 4HWBL 4YHKH 5IVOA 3SN6N 3HC0A 3ULUH 5JXAL 4A6YA 5E9DB 5FO9B 1CFSA 3OAZK 4R8WL 2UZIL 4ZS6D 4NC0B 4QRPD 1FYTE 3MYJB 4FOMA 4I3GA 4WRLA 4ETQB 3IXTB 4F15C 5D2NE 3HKFA 3VGEA 2ZKHH 3X12A 2HLAB 2C5DC 3PXHA 1NGWB 1XGQA 3RUGE 4YDIL 2APFA 3VFRA 5CCKH 1FORL 1CLOH 2YPLA 2P8MA 1Z5LB 3NAAH 1IGTA 1WF5A 5DC4B 3NN8B 1D9KD 3A6BH 3ISWA 3Q1SL 3FRUB 4ZDHA 4TOYH 3UEZA 1A3RH 4YGVA 2E7HA 2YRLA 2XKSA 4LHUB 5HI5C 5D1ZD 1OTSC 2Z91A 5JUEH 4OFIA 3LEVL 1BVZA 1DQQA 3CH1A 4B41A 1C1EH 1PAMA 5C8JB 1IGFL 1P4LB 1NDMB 1FH5L 4PJEB 1QRKA 1DSFL 4O9HH 4Z7UA 3C6LA 2XWBA 1VGEH 4WCYL 3LKRB 3FO1B 1ETZB 2IALB 4CW1A 5MEOB 2E9WA 5JPMB 1MI5D 4KUCF 3DBXB 2LE9A 5FCUH 1ZTXL 4POUB 4LRIA 1VCAA 5ADPH 4M62H 5IBTH 3QNYA 1JZ3A 2XN9E 2X9WA 2FL5B 5T5FL 5FM4A 3DTXA 2FX8L 4JZNB 1X6NA 3G5XA 4HS6A 4NKMB 4M93C 3H9ZA 5DFVD 4O2CB 5E4EC 3DO7B 4P23C 5C0AB 1GZPB 2HKFH 5EA0L 4NKOA 2I07A 4OD1L 3X11B 3E2HC 4OIIL 1G7JA 3G6AB 1DQJB 4OGXL 3AS1A 2FLBT 3NZ8A 3TA3D 25C8H 3A6OA 4KVCH 1XFPA 2J4WL 4X6EA 4LVEA 4HH9B 1UB6A 2DQEL 1CL7L 3SKMB 1Y6NR 1KF9B 5DK2B 2X4NB 5KVEL 1F97A 1T21B 5HHOB 1I7ZB 1NFIB 3LEXB 1TZHA 3IDGA 3EYSL 1UH4A 1T6WA 1J0YA 3RJQB 4KK8D 2VLKE 5HHVL 1FVCA 4B5EA 1G6RH 3NIFF 1CZ8L 3ELAT 1S5HB 4N68A 5L2JB 5F89B 5IFHL 2CUMA 2NX5A 1DBJL 4MJIA 2OZ4L 2DOCA 4RAUA 4Y0GA 3QIWD 2R0KL 4OCNC 4P59L 1Q9LA 5DC9B 3HNTH 3KPQB 3VD7A 1MJ7H 1FZOA 1FNSL 4OKVA 5DYOB 4XPTH 3SE4C 3QQ9D 5I1JH 1A6VH 4BFIA 5IBLD 4HQQH 4LRNH 3IDYB 3MXWH 1ES0B 4N5ED 2EYSB 4LP5A 4QKXB 3OKNA 2DB8A 3G5ZA 4EN3A 5EOTA 2NY7H 1BECA 1RK1B 3OJ2C 1T03H 2F54E 5CJQL 4JFPB 3U0WH 2R2HB 4OCLC 5ID0B 1QFWL 1KNOA 4PJ5E 3QHTC 4AENA 1T80A 2YEZB 4WWKA 4UT9L 4LSDA 4ONFH 1JYVA 3H7BB 4Z7NF 4PJDF 4M1GL 4NQCB 4R90L 1A1OB 2YPKA 1JYWA 3MLTA 2BRQA 4ODTL 5HYSA 2VWEC 4XC3H 4IDJL 4LSTH 4PFEA 5FHAL 5FKPB 3TFKA 1S9YA 1IZKA 4PJBE 5HYJD 3RZCD 1OQXA 5BQ7B 3VRLF 3RIFF 3TBTA 3UTSE 3HA0A 4Y4KA 1G9NH 1AQDB 5A16B 5MEPB 5EBMA 1QSVA 1KB5L 4HUWB 1RY7B 2BNRA 1KEMH 3T65A 2WMPA 2ZJSH 1YYML 5DDHB 5DJDB 3IKCA 4YO0B 3WIHH 1VHPA 2RGSA 3O6FC 4OZFG 3OX8B 4FNLL 1KCKA 5ELIA 3WKNA 5EUOB 5CEYA 4WGVB 4NNPH 4TUKL 2QSCH 4P9HH 4N8VB 3QIBB 2F19H 1CVSC 5T1DL 4KRPD 3VFSA 3HUJB 2R0WL 5HBBA 1YDPB 2ILLA 3GMMA 5LAXA 3HMWL 4DCQB 4KUZH 2BSTB 3OR7B 1N6UA 4IRSA 4AG4L 1LQVA 1FP5A 1MF2H 3LS5H 2F58L 2IG2L 1JYXA 1NC4B 3RTQB 1HXMA 1P5UA 4KHTH 1BFVL 5HI3C 4J23A 5C0EA 3S97C 1E28A 1V7NH 3ARFC 2Q8BH 4F7PA 2XIDA 5DHYA 3HS0B 4ZS7L 1WISA 3JUZA 4U3XA 1VEMA 5CMAB 1ZT1A 5GRJH 4EQ2A 4PLKC 5JO5B 4XPGL 4RFNC 3ZKMD 1DE4B 3SCMA 2LVEA 1T2QH 3B2VL 4X9GA 2PTTA 3HHRB 3F62A 1GOGA 1S9XA 3KGRA 3OXSA 1MH5A 2OI9A 2ADFL 3EO0B 4G3YL 1FNAA 3G6DH 2EXYD 5M94B 2C1OA 4BZYA 4PLJC 1YEGH 3PL6A 4HT1L 2JCCB 4WW2A 2PO6A 4HPYH 4NT6B 2B39A 4LVOB 4AM0B 1OW0A 4WUUA 3VXSB 4NOFA 4ZPVB 4QXUH 4H0IA 1QSFD 4XNQA 4L8DA 4DN4H 3HNVH 2VLKA 1MCOL 5IB5A 4I0PC 5F7KC 3ULVL 1CLYH 3F5WA 1UH2A 2EYRA 4YHPA 3U2SB 4N8CL 2AV7B 3AREA 4P57A 2IBZX 4X6CE 2VZUA 4Q2ZB 1J0KA 3BT2H 5TE6L 1TPXB 5A2IH 1KEGL 4FQQB 4G9FE 4CADA 4QO1A 1JRHH 4M5ZL 2PW2A 4UTAH 3KDMA 43C9B 4D9LH 1KPUA 4RFEA 1G6VK 1MCCA 2C4FU 1Z9LA 4Y19B 3QEGH 3LY6A 1MAKA 3QJHA 5IESL 3HMXL 2F54A 2ARJA 4PY7A 4CBPA 3ULUC 3MRCA 4YXKL 2X4UB 3QUYB 4MD0A 5HHMB 3S3JA 4XRCA 4U1JA 2HRPL 4X4XA 4LPWA 1S7WB 2XZAL 4UDTA 1FIEA 3F58H 1KG0B 3HI1B 3F8UB 4JKPL 5L7XH 5F3HA 5KVGL 3ZKNC 4JQVA 4NQVB 1LD9A 4KV5E 1QR4A 1UB5B 3TCXA 1L7IL 5FM5O 1OP3K 4P46A 2A9NL 5ICXA 1AGEA 4TPRL 3R06A 3OTTA 4LLVA 1FIGH 4TUJB 1SMOA 2WBKA 1GPOH 4OJFL 5I18L 1CXKA 1UYWH 32C2A 5HVWA 5IM7B 3T8XB 1T6VN 3MPCA 5SX4H 5B38G 3NH7H 3QUZA 4JVUA 4PG2A 2ADJB 3IDMB 3O3DA 4GG8B 1ZANL 4NO3B 3L1OL 1T5XA 4LOUD 5FDWA 3ARDB 1DUZB 1VGKB 1PKQA 5GS1B 4LCIH 2DICA 1CIUA 1T2XA 3HZYB 5C7XL 1U42A 2IMMA 3C2AL 3CGTA 3PWPD 3MV7B 3ZMRA 3QH3B 5KSBA 5F9OH 3EYVB 2UY6A 3WE6B 5IW3A 3DROB 1JYNA 2ZP0T 4U1LB 3TBYA 5J6HA 4C56E 4FFEX 5T1KD 1TTUA 1YY9C 1ZXQA 1J1PH 1YC7A 3A0OA 3KLSA 3GMLA 1UZ8A 3DMMD 3M17A 3AMLA 3SKOB 1S7VB 3TT3L 2V5MA 3IDYC 1YPZE 2V2TB 4QRTA 3PQYE 5FA4B 4AL8H 5AZEH 2H45A 3FFCD 4CDGC 1FPTH 1JHKL 2VLJD 5FECB 2OXHA 5JW5B 3OKOB 3BH9B 1A7BA 4ZUVB 4RX4D 3IJSA 5ISZD 3BJLA 5DJ8A 5DJCA 1N0XH 1MJUL 3IS0X 3AS3A 1BWWA 1U3HA 3KYAA 4KKAD 1C8PA 1S5IL 4NN6B 5DEZA 1EMTL 4J4PC 1BX2A 2YD2A 5A2JH 2V7HB 1JGEA 3NCJH 2NCMA 1J1XH 5CGMA 1VACB 2FIKA 2MHAA 1EUTA 4TSAL 3UZEA 4L3CA 3VFTB 4JEGB 2AEQL 2NQCA 4ZFOL 2DBLH 2B7DT 1A6UL 4HUUB 2GSGB 3DLQR 1A6AB 5I66B 4JFEE 5JOFA 3BWUC 1CT8A 1JMXA 3GHBL 4MSWA 3BPOB 3VXRE 3WYRA 4DQOH 3GRWA 4ZQKB 3WMSA 2WNGA 3P73A 2PETA 4P2QD 1WBZA 4DKEH 1XCTA 1ZLVK 3CFDB 3KYNB 3QHZH 3QIBC 3TBWA 3VU2A 1U0QA 1QLFA 4KJQD 1X5FA 2VZOA 5KAQF 3SGKA 5JIPA 1B3JA 1NC2D 4N1CA 1DANU 3T3ME 2NLJB 3LDBB 4HJ0C 1MJ8L 2Y07H 3RTQC 5I17A 2FR4A 1MCHA 5E7BA 5T33L 2Z93B 3ET9F 3LIZH 4MZ2A 3WXWL 1G9NC 4LK4A 4Z5RA 1V3MA 4S1RL 3NOIA 1T0MB 4H8WH 4NRXB 2BY1A 2Q20A 4ZYKA 5E9DD 1NCWL 2FD6L 3O3AB 3H3KA 5F70A 1ADQA 5D7IF 4K7FB 1T89A 3MCKA 5FM5M 2CUHA 4MWFA 5IGXH 4UTBH 2OSLA 4XNMB 5IMLA 4XGZA 3GJFH 1F3JA 4P9HC 3TT1H 4PTTA 4W4OC 5HI4D 4ZFZA 3U7YH 4JGJA 5I9QC 3VFNB 1U8LB 1FGVH 3CX2A 1PVHA 3MFFA 2AJYL 4MAYA 4XCCL 3VFPA 4LVOC 1U8HA 1K5NA 4LHUD 5EZOL 1KN4H 2O5YL 5D2LB 5E2TH 3TO4A 4OGYH 5IJKA 3LN9A 3CXDH 1U95A 5I1CH 4LIQL 5EU3A 1I8IB 5JQHC 4PRDB 3TIDA 2FWOA 2DJSA 1IC7L 3HI5L 3UZVB 3OAUL 3OKDA 4YHIB 2HH0L 4GUPB 4AIOA 3BYTA 1MJJA 4PB9L 4F8QA 4C56A 4LARL 4WUKH 5F7LB 5TDNA 5ESAB 1ORQA 4HZAA 3MLXL 3QYCA 4XMKH 5ETUB 5CP3A 3GJFB 3W0WE 1QFUH 4BELD 3QUKA 4X5WA 1MRFH 3PDOA 4U1IB 4JY4B 4CL7A 1C5CL 1GGBL 4ISVA 3QUYC 1KJMA 2Q7NA 2VH5L 3OKLB 4XP1L 4MDIB 1XIWB 3OPZH 1EFQA 2YA1A 4XPBL 5BCAA 4KU1A 4WFEE 3SKJL 3KYKH 4FQXB 3IETB 5GGQL 1CTNA 1QRNA 2GT9B 3WL9B 4MNQE 4JFYA 1B0WA 4OCWL 3OQ3B 2BC4B 4OCYH 4ZUWB 3GJFK 5C1MB 5HHOD 1NGXB 1XF2A 3FZUC 5CHNA 4QRRB 3SPVA 4HBQA 2NZIA 3H3PH 2JJSA 5FF6B 3MRKB 3TN0B 1DBKL 1W8OA 2FEDD 3IDNA 4PJDA 3QG7H 4PY8J 1XH3A 4NM8H 1L0XA 2Z31B 3ULVF 2CDGA 3DSNA 2VL5B 2ENYA 1E4KC 1D5XB 5TF0A 4OZGF 4MJ4A 4AIZB 4FN0A 4FTVB 2ZUYA 3I02B 5DRNB 3H9SE 4GMTL 4PIRF 1OSPH 3ARGB 3HRPA 1R3IH 1FL6B 1EIBA 3LMJL 1M7XA 1HZHH 1QFHA 1CGSH 3WFHA 1FZMA 1RURH 1OM3H 3QUML 3ARDC 1XF3B 1O0VA 1UGNA 2V5TA 1JHLH 2Y1VA 3P9MB 5BZDB 1IBGL 4CRPA 3DURA 3FN9A 3MNZB 4PV9B 4FXKB 4XNUH 2ZOKB 1WTLA 4C83A 2AEIT 5H2BA 3DYOA 4XNXL 4Z78A 3ZDYF 4P2RB 2YZ1A 4GXVH 5LCVH 3WSQL 5F1SA 4YHYC 5DO2D 3HPJB 1CGTA 3K0WA 2EDTA 3REWB 3GMOB 5JNYB 4HBCH 3A6CH 3GSXA 5L88H 3AFLA 1A64A 3UJJL 1BIIB 5HDBF 3QI9B 1DVFA 4PJXA 3WUZA 3ZTNH 1SY6A 3FTGA 1AH1A 4WFHE 1F2XK 3GSUA 2DLFH 4E42B 3OGCB 4HUMB 3CFIC 4EDXB 4NN6C 4KY1H 4OI9A 3PHQB 1U91A 3ILQC 3QFDB 4PUBL 4RA3A 3OG6B 3HR6A 3L5XH 1INEL 2VR9A 3V5KA 1JK8B 4CNIB 1P2CA 3T77B 1OCWH 3S96B 4DOHE 4YXLH 1HYSD 3LZFL 4KTDH 5L6YH 4RISL 1GGCL 4X6FB 3K2UL 3NIDF 4XVJH 4XC1H 1LEKA 2BOBA 2GW5A 1J0ZA 2HN7A 1MHCA 3I75B 5TDOA 1DUYA 4LDLB 3MJGX 5KSUA 5SWZB 2DLHA 1EHNA 1SBSL 3V4VL 1TENA 5DK0B 5DWUL 4L9LB 4P3DB 4ELKA 2NYYD 1FV1A 1EEQA 4G6MH 4EUPG 4YIQB 4OLVL 1IEBB 2D0FA 3B5TA 3U1SH 2VDQH 2XQBL 5JW3H 1PSKL 1RUAL 3T0EA 1ONQB 2IQAB 1U41A 4LCWE 1DQML 5FUZH 2R9HC 3BMVA 4K8RH 3LDBC 4QXTA 2EDDA 3BP5B 5EU5B 2O5XH 5JW4M 1T20B 1YECL 3MBED 5EZLB 5CBAB 3WNKA 2DWEB 3VXSD 2W9EL 3Q48A 4L8SA 4XWOC 4PBWD 5CIPB 4ZFOA 4GG6F 3BD5A 2AERT 4U4BA 4PJIB 1J8HD 4NSKA 4MS8D 3PGDB 3SBWA 4XPAL 3WD5L 1KCVH 2NY5L 1S9KC 4LNRA 4N0UE 1OP9A 2GK0A 3IXAB 4NNYB 3H42H 2EIZB 3H9SA 5HJ3B 1QO3A 5CJXA 5T3ZE 4Q9RH 3MRBA 1R5WB 5IEKB 1X5GA 2IAMB 1EGJH 2Q1EA 5DD5H 4D0CB 3KPSE 1BZ7A 5I1AB 3BWAB 1OF2A 1QQDA 3LRSA 2MCPH 4MHHG 4PRHB 2PKDA 4H8WC 3GMRB 4RWYH 2RAMA 2KDGA 4HLZH 3T09A 3BO8B 1FCCA 3C5SB 2P1YA 4YBHA 5ITFA 2ZSWA 3F7VB 3PWJB 4HKBA 2UYLB 3SDAD 1RZIA 3TV3L 5BVPH 3KPOB 1G84A 5E1HB 4OFYA 3V8CA 2W9DH 2YMXH 1A4JA 4MVBC 4D3CH 3RDTA 3FZUD 5FYKE 4I77H 5FYLD 5DJYB 3LN4A 2DM4A 1T4KA 2OL3H 3UPRB 4S0UC 1A1NA 1HEZA 3CVIL 4FFWC 4Y4FD 3UX9B 4MD4B 1K3IA 4Y5XB 4HS8H 3MODL 1I7UB 1XIWC 1QBML 4HIIA 4U1HB 2GCYB 1DCLA 4GKSA 3FMGH 3UO1L 1FL3A 4MCYB 4JM4L 4TULL 2GI7A 1SYVB 5HSFA 2F15A 2BHUA 5F7DB 3V6ZA 4NO5A 4Y1AE 4EOWL 4GRWB 2V5YA 1UFUA 5F7YC 2QR0B 2DQTH 4R7DA 3ARDD 1LP9F 3HZVB 5ICYB 5C08D 4GQPH 1UA6H 4XXDA 3TN0C 1FFPB 2YA0A 3MV7D 1Q9OA 2Z31C 4P4RA 4PR5B 1NCCH 4HHAA 4O58H 1KCSL 2GQHA 4LLQA 3DUSA 2D7TL 2OL3B 3RVTC 2OX5A 4A6YH 1UXWA 2GUOB 5ANMB 3ARGC 4C55A 1P1ZB 2XWJB 4Z7VE 4PJCE 4QRUA 4OZFA 1FG2B 3VXME 2VR4A 4PJ7E 1D3CA 2IANE 1TNNA 1AJ7H 2XZQL 5GRXG 3I6LE 3KYMA 3C6SB 4PREB 1I1FB 3C87A 3WLWD 3L7FB 4NIKB 3IAQA 3HZMB 4HWNA 3DX7A 2P5WA 3CXHK 4WEMB 3P0GB 4L3ED 1DQLL 2EYTA 5E6IB 4Z0XA 3CMOH 1CQKA 3DRQB 2E9BA 3HRZB 4M6OH 3H9YA 4KJYB 4PGCA 5EOQH 4M03A 2EXWD 1U8PA 4GAGH 1IKNC 1EHLL 3O8XB 2QHLA 3WJLC 2DQJH 2ESVE 4X5XA 5EN2A 3C08L 4NM4H 4ONOA 5FUCE 1CFSB 3U7WL 5E2WL 3FB5A 2QJDA 3QI9C 3QHFL 5BO1L 1A0QH 5KVFH 3IRPX 4F58H 2R0LL 3X12B 1AO7E 4MB3A 4MX7A 1WV7T 1CE1H 1XGQB 5AZ2H 3U9PH 3N85L 4QXGL 5D7IA 2YPLB 3FQNA 1IGTB 1BD2B 2QEJA 1I9IL 4U2YA 4XVSH 4ZDHB 3T08A 3WDHA 3ZE1E 4QGYA 1KCLA 1NUGA 5A43C 5CZVH 3DVNB 1EV2E 1CK0L 2AEPH 2K3TA 2Z91B 3MV9E 3SJVA 1VERA 3CH1B 1CI5A 4LGRB 3I6GB 1ZHBA 2ZUVA 1OY3B 1CR9H 3R1GL 4JPVL 1PYWA 2J6EL 3C6LB 4K23H 2XWBB 1T7VA 4L9LC 2XG5A 4Q7DA 3SO3B 3QIUA 4JFOA 3RNKB 1D6VH 5HDQH 2DI8A 3D25A 2I5YH 1FRGH 5E70A 5GJTH 3FT4A 3QNYB 1Y18A 3MREB 4KHXL 3DTXB 1NCNA 2GK2A 3EDEA 1VENA 3G5XB 4HS6B 1RVFL 4EQ3A 5IVZB 5IT2L 5L2KE 5FYJD 1BHGA 4L4VB 1NSNH 5ESQA 4NKOB 2I07B 1NFKA 2AXHA 1WFTA 3L3JA 3QDME 4LFHD 5ACLA 5JHDA 4HF5H 5ITBH 4ZTOH 3ARWA 3NZ8B 4B0MM 4M5YH 4PJFA 1PEWA 1X7QA 4JO4H 3GI9L 3ARXA 4LSRL 3QNZA 2JTDA 1N8ZA 1M71A 2VLRE 4K3HA 1A9BA 2BHZA 1TZHB 1RJZB 3OBAA 1JP5A 2A1WH 2GEEA 1JNJA 4I2XE 4NHCH 4JFDA 1N6QL 4MJIB 4RAUB 1P5VA 3ORJA 5EWIL 2DF3A 5IMKA 1Q9LB 2DLGA 4K8RC 5B8CB 4IRJD 4OKVB 2OJZL 3IJHA 3HE7A 4FQIL 4PJCA 5IOPA 2BVQA 3IDUA 1Z6JT 3ZL4H 4XXCA 3VXMA 5I1IH 5LXGH 5B38A 4OZGA 3NFNA 4DKFL 3BD3A 5CINL 2Q87A 1XF4A 3DVIA 2VO5A 3QCVH 3MOBL 5DJAB 3G5ZB 4EN3B 4IJ3C 3FO2A 5EOTB 1EEYA 1ZT7B 2IMNA 4ERSL 4UILL 1JE6A 4KI5C 1KNOB 5GSRB 2OXGA 2XT1B 4FQXD 2NXYB 4WWKB 4L29A 3UMTA 2Z92B 2C26A 2ZCKH 4OTXH 1PX3A 3OMZA 4JG1L 5CAYB 5DURB 2YPKB 3MLTB 3DSFH 1JFQH 4UNUA 3MZTA 4LAJH 3TLRA 5L0QB 5J12C 1Q0XL 3O9WA 3TJHC 4WJ5A 4FABH 1EJOH 3V5HA 3TN0D 5J6GB 3O0RH 2Z31D 4PY8I 4QOKA 3U46A 1CN4A 4JFHE 5EBMB 2X7LA 2BJMH 3RUGB 3CDCA 4JGUA 4X6CF 5I8EA 3VWKA 2BP3A 1X4ZA 1XGRB 2BNRB 2OTPA 4XP4H 3Q5YA 4KROB 3T65B 4ETYA 4WEBL 5BJTA 4FTVD 1OT1A 2VDPH 3VG0H 2XA8L 5CSGA 5TE7H 5F1OB 3MYZA 4KVNH 2DQHL 3G6JE 5DXWA 1ACZA 3E3QC 4G7YL 5I8KL 1URLA 4L5FL 3RWCB 4KAQL 3V7AG 1VADA 4NRYA 1PY9A 1IKFH 4AMKH 5CEYB 4JO3H 1AE6L 3MV9A 2YK1H 3I3BA 4MAUH 4LQ1A 3VFSB 5F7UA 3GMMB 5LAXB 5ADOL 4FRWA 3WHE1 4IRSB 5SV4A 5GSVB 5T1LA 4KZEL 1HXMB 1IAOA 5DHXB 2R23B 4DUXA 4M61A