1KJMA

Tap-a-associated rat mhc class i molecule
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
277
structure length
277
Chain Sequence
GSHSLRYFYTAVSRPGLGEPRFIAVGYVDDTEFVRFDSDAENPRMEPRARWMEREGPEYWEQQTRIAKEWEQIYRVDLRTLRGYYNQSEGGSHTIQEMYGCDVGSDGSLLRGYRQDAYDGRDYIALNEDLKTWTAADFAAQITRNKWERARYAERLRAYLEGTCVEWLSRYLELGKETLLRSDPPEAHVTLHPRPEGDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVEHEGLPKPLSQRWEPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RT1 class I histocompatibility antigen, AA alpha chain, heav
publication title Crystal structures of two rat MHC class Ia (RT1-A) molecules that are associated differentially with peptide transporter alleles TAP-A and TAP-B.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Immune system
total genus 66
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2001-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kjmA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1kjmA01
5EIIA 1PZUB 5DHXB 1MQ8A 1IGMH 3FQUA 4G9FA 5GGTL 1FZJA 3OR7B 2Z31C 3O9WA 3QCVL 4FG6C 4NZDA 5D7IA 5DD0H 3VFOB 3HZMB 4D0BA 2W0PA 1S5IH 1KLGB 4M8QB 2PXYB 1CICB 4XVUD 4Z78B 4IRJD 1CN4A 4DEPB 4CADB 1HYSD 3BP6B 1T04A 1HHHB 3T2NL 3TBTA 1EBPA 1QFUL 5DHVH 3GHEL 2M2DA 4U1SA 3CCHB 3VXOA 1QLRB 5C0DB 4TRPL 5KSBE 1M7DA 3L3HA 5LKNA 2BY1A 1IFHL 3AS1A 4Z0BH 3QNXA 2Q76B 3AREC 3R1GL 2QEJA 4NZTL 4UTBL 5HYSB 5T33L 4UAOC 5FB8B 4QRSA 1NCWH 3KJ6H 2EYSB 1CDUA 1VFAB 5ALCL 3IAGC 5DC0A 1DQJA 2FYYB 3RVUD 5IMMA 3U46A 5CIPB 1XGRB 2D03L 3HG1E 1N5AB 3V6OA 4YDVA 5F71A 5E6ID 4WU5A 4S0UC 5JDSA 1T5WB 4PJHB 1UACL 2E7CA 4EVNB 3RUGF 1C1EH 3MACH 4LVHB 4KVCH 2CLVB 4PY8I 2FATH 3MRMA 5DMIL 4KZEL 2XICA 1YQVH 4UOW0 3JSSA 3DO7B 5DJ6A 4PRPD 1CGXA 4MS8C 2F9BT 2IEPA 5D7JA 3QUXA 5EU7C 5H2BB 3RVWD 4NJ9H 3W0WB 5T1DL 1KCRH 2NY5L 1AKJD 1BEYH 1J8HE 2A9ML 2BX5A 4KKBC 5DYOA 3RUGA 1MAML 3QI9D 2G60H 5K9QG 4X0KA 2JJTA 1MCQA 3UYOD 1TVHB 5IM7B 4U49A 2AK4B 5I76B 4LARL 4KK9C 5IEHA 4X4XB 2VH5L 2DIBA 2CDFA 5FM5O 2XZZA 5L2JB 2OXHA 3R0MA 1L0YA 2X1OA 5CEZL 1A4KA 4H5SA 4FQ2L 2QKIB 4MQ7A 4O2CA 3SJVD 1KPUB 3PQYD 3QP3A 5IWLA 3FAWA 5DJ8B 2R0ZL 4PB0L 1U8MB 4ZNEE 4ZAKA 2XA8H 2QHLA 5DZLA 2BY3A 4PLJC 4YQXH 3QIWC 1AXIB 1AO7B 4LKCB 4U05A 1P9MC 5GISL 1RJCA 5E8OB 1RIHL 3WIIL 2IG2H 3RP1A 4NCC2 3D0LB 1VFOA 5HYJA 2HJKB 1U8HB 3IU4H 4YHOL 3LDBB 2NY7H 3FB8A 3FKUS 1NGXB 2AQ1A 2FB4H 1NLBL 2QADB 3SKOA 3FRUA 3OKLA 1WAAE 4F7PA 3BYTA 2DL2A 1OOAA 1TMCB 4CBPA 5KOMC 2LVCA 4OCWL 1I8LA 4YJZL 4GMSH 4JZNA 3WHXB 1MREH 4KUZL 3GSQB 3P9MB 2D0FA 3HZYB 3VXSE 4HH8A 3T2PA 1FC2D 3H8NA 5F89B 3QXVA 2EYRB 1F4YL 5LGHH 3G6JB 1LO4L 4LCIL 2GY7B 3LIZH 3S36X 3VFPB 5L2KE 4HIIA 5J8OA 2AS5M 4OF6A 2R2HA 3UO1H 3BP4B 3AB0B 1KELH 4Z9KB 1FGNH 5IW6B 2P47B 5DR5L 1Z0MA 4PDCE 1KB5A 5J11C 2X4SB 4F9LA 4U1MB 4RZCB 1XGYH 2QSCH 1M6OB 2NY6D 1PZ5B 4NKQB 4YBLB 1V3JA 4N90D 1AR1C 1QNZL 5D1XD 4PJEE 5JOFA 3PHOB 1L4IA 4PJ5B 4UU9A 4JANA 1MFCL 5HHQB 5KVEH 3A6CL 1R5WA 4KJPC 3FOLB 4MA7L 3V6BR 5F70A 4J3OC 4PGCA 2XZCL 5CZXD 1A6WL 4BUGA 3GO1H 1FCGA 4NQUA 4R0LA 2LVEA 2ICWI 3S7GA 1B2WH 4L4VE 4MD5B 3BGFB 5J06A 4BZ2L 3UTSA 4XPBH 4RGND 5I75C 3RWGA 4NCDA 4YH6A 4LLQA 3E8UL 1GXEA 1NUNB 1JNNL 4X6EA 1XH3A 3BHBA 3WSQH 5MI0C 3TNMA 3VXQA 4MXQA 5MEPB 3S36L 3JXAA 4JFYA 1UJ3C 3LY6A 4OKVB 3UTTB 2XTJC 5EZLB 4O4YL 4I9WD 1MVUA 5GGVL 4HUVB 1HCVA 2R0KL 1MSPA 4K3DH 2R1YB 2H8PA 4NM8H 3ARTA 1NCNA 4MDJB 4F80A 4YX2H 3S9DB 1FZOB 1JMXA 5IFHL 4NRZA 5DQJB 2R2EB 1UWXK 2EC8A 1QD0A 4JKLA 4LRIC 4M93C 3MOAL 5IG7B 2ZCHL 1EHLL 5I8KH 1S7XB 3FN3A 1FZKA 1ND0B 4AEHL 3KPRE 3EFFB 4OQTL 2YPLD 4PY7A 3E6FB 1NGQH 1FFRA 3VGGA 4RA0C 1LILA 2DB8A 5C0ND 5EIIB 1AGEA 5BRZD 4DCQA 3FQUB 4G9FB 1LEGA 5A3ID 1FZJB 3O9WB 5D7IB 4EBQL 4D0BB 4V3DB 2CIIA 4B53A 3RX8A 4NNPH 4WGWB 1FL5A 4N0YL 3NCFB 5TPWH 2R29L 1DLFL 1KFAL 4Y4HD 4YEFA 5JTWA 2ZJSL 3R06A 3KWWA 1LDPL 2EDKA 1T04B 3OKYA 5F1OB 3TBTB 1C7TA 3ILQD 3UZQA 4JN1L 3AXLA 4U1SB 3G6DH 3VXOB 4Z7NF 3CFDA 2KBGA 1M7DB 3L3HB 5E9DE 1ZTXH 4KK8C 5EOTA 4HJGA 3QNXB 3C09C 3LD8B 2GSGA 2NW2A 2QTEA 1IGML 4N5EC 2VLRE 4QRSB 1HHIA 1Z9MA 3EOYG 3U79A 3ULUL 2NY2C 1IEBA 3BE1H 4WHTA 1ACZA 5BV7H 2LE9A 1DQJB 4Y5YC 1Q0YH 1S5IL 5IMMB 4QRRA 3L1OH 3KXFE 3LH2H 3U46B 2GW5A 3HE6C 4PRID 4HIHA 3MV8A 4YDVB 1TTGA 3VA6A 1T66D 3O81A 5EIQA 4L1DA 4WU5B 5JDSB 4PTUA 1J10A 2CQVA 4FQJL 4FS0A 3GBMH 3MRMB 1JTTA 3QDMA 4HS3A 5DJ6B 4UQ3A 4UMGA 4Y2OA 3Q1SH 1CD9B 4Z0BL 5D7JB 3QUXB 4OF7A 3ZT6A 4WTZA 3LPWA 5ABDE 2Z0BA 3KJ6L 3WMSA 3RUGB 5DYOB 1MRCL 4HWBH 4JR9L 4X0KB 1KPVA 3QRGH 5DJDA 2OJEA 4GXVH 5KSBF 1K5NA 2X89D 5GRVL 5IEHB 1CLCA 4WTZG 2CDFB 1D5IH 5D2NC 3GRWH 4U6TA 3IS0X 4URTB 5F7FA 1T2XA 1A4KB 4XCYA 4H5SB 4MQ7B 4O2CB 4KVCL 2FATL 3ULVE 2HFEA 4XWGL 5DGQA 3UYRL 1YQVL 1RQ5A 1QFOA 1WZLA 4ZAKB 2E7LE 3BH8A 3GI9H 3U48A 2IH1A 2P5ED 1JWSA 2EZ0D 4K7PH 4JZJA 4NWTL 1KCRL 1BEYL 3T0EC 1T2QL 5HYJB 3UX9B 2V7HA 4KAQL 4IMKC 4ZTOH 4JY5H 2VKXA 3FB8B 3BAEH 3T65A 3HUJE 3IFLH 3U9UA 2KDGA 3SO3B 2F54A 3SKOB 2GAZA 5INDA 3K8LA 3FRUB 3SDCA 5EZOH 1F90H 1C7SA 4M7KH 4PJ7E 4F7PB 1A6VH 1GJIA 2VZUA 4JZNB 4R97C 2YZ8A 2XA8L 3TH2T 4UV7H 4X5WB 3K81A 4NQSA 2C4XA 1ZT7A 1ZA3A 4YQXL 2C3XA 4MD0A 5HI3D 5BQ7A 2VR9A 5IB1A 2X4OA 2PTVA 5C0AD 5CGTA 4MJIE 1J8HA 3NZ8A 3B9KC 5IVZA 4HIIB 2IG2L 4EI6A 5DZOA 2R2HB 3O3BA 1I3GL 4AK1A 2NY7L 3MNVA 4ENED 2YXFA 1KB5B 1XF5A 2DQJL 2D7QA 1WTGT 3FO0H 3NFPA 4DUWA 5CLTA 2YMXL 4NC1E 4LHUD 2Q3AA 5JOFB 2ZUQC 4UU9B 4JANB 2EXYD 2HMID 1R5WB 2P5WA 4GMSL 3MUGA 1S8DA 1MREL 4JCLA 5IROA 1P2CA 4FTVE 2XOTA 1HOCA 4KRNA 4PGCB 4KH2A 1EEYA 3RGHA 3FFCE 1PSKL 1U2HA 1KENH 4HUNB 1WAAF 4LL9A 3I6KA 1FIEA 5LGHL 1YYLH 1VFUA 5L88H 4R0LB 2AXFA 3EHBD 3ROLA 3NVQA 3FAXA 3UO1L 3QWRA 1KELL 3KAAA 1FGNL 3MX0A 2AXJA 2FEEI 2A77H 1KCUL 1S3KH 3UTSB 1KLFA 1XGYL 3VG9B 1QSZA 4ZFFA 3B9AA 3RWGB 3W9EA 4LLQB 1WAAA 1F3JA 2E6PA 4X6EB 4F57L 2IAMD 5KVEL 5BXFA 3BHBB 4WI9A 3TNMB 1JUFB 3VXQB 4XBEH 5DI8A 4P2YA 2CSPA 3QQ9D 2HT4D 4JFYB 3E2HA 4WO4C 1J1XL 1OQOA 2LTQB 3AM8C 1EO8H 2PW1A 1FJ1A 3MCLH 3PDOA 5E95B 4RQQA 1MVUB 5F7YC 3GO1L 2P44B 1LK3L 5KVFH 1ZLSL 4PJEF 2J7LA 3K2UL 2H8PB 3MLRH 3WHE1 3BT2L 3RDTD 4YDIH 1A2YA 2FCBA 4NRZB 3MRCA 5CBEA 4WW1A 1V3LA 4H88H 1G1YA 2R56H 4HWEL 3TYFA 2ZCLH 4JHBA 5CD5D 4XNZC 5ADPH 5SX5K 4ZSOE 1FZKB 2I07A 4PJEA 1FFPA 3VWKD 4PY7B 4CL7A 4U2YA 3WSQL 1GGTA 2DQDH 4YDJA 4DCQB 2EECA 5D70L 3MGOA 3FZUC 1LEGB 1EVUA 1IRAY 3D0VA 5CEXA 5E2TH 4JRXA 4K3DL 2ICWA 4NM8L 2CIIB 4YX2L 4CUCA 1FV1A 1FL5B 3N0PB 1GOFA 1IEAA 2F53E 4L4VA 3R06B 3KWWB 1A1OA 3KPSE 3EBAA 5F8RC 3BKJH 4LLVA 3EOBA 1I9EA 4LSRH 2WMPA 1JTPA 5I8KL 3T0XA 4HEME 2X9XA 1JF5A 3AXLB 4KHXL 4Y7MA 3CFDB 1MCWW 5EOTB 3M45A 1NGQL 4I2XA 4HJGB 4X98A 4RMVA 2ADJA 5JQ6L 1OL0A 4PGZA 5JXAH 2NW2B 5T1KD 5CJ5A 1HHIB 3VI3E 1K3IA 2NZIA 5GGRY 2XWJA 4Y19E 1IEBB 4WHTB 1TJIH 2PXYC 3FQXA 3I3DA 4HSQA 1X4ZA 5D1ZD 2A1WH 1WZMA 4NNPL 4QRRB 3WKMH 2IADA 4DEPC 1E27A 5TPWL 4HIHB 3MV8B 3O3DA 4JG0H 4M61A 2EDDA 3K3QA 2V5YA 4PTUB 3GGWA 3WNLA 4U7SA 3DARA 3MUZ1 1A21A 1V5JA 3HMXH 3QDMB 4HS3B 4K23H 2CGRH 3KPRA 4UQ3B 3H3PH 5DDHA 4UDUA 3PHSA 4K8RC 4OTXL 1ZTXL 1N59A 2V7NA 2BZDA 2BFVH 3V4VH 4WHYG 2Z31D 1GPOH 3DVFA 4UB0H 4K94C 3AVEA 1FNFA 3BE1L 1KPVB 5DJDB 4KI1A 1U9KA 2OJEB 5IJKC 3LSOA 5BV7L 4X80H 4XMLH 2YD1A 4K7PX 1Q0YL 2ZUSA 3O4LA 4WUUE 1K5NB 2APBA 5I9QC 3LH2L 4G6AC 5FO9A 3D48R 4MAYA 4KKLD 5FAAA 3VD3A 1G6RA 3SE3C 5D71H 4B7LA 4R4FH 1F6FB 3GFUA 4XCYB 4HD9A 4MNHA 3JWOC 1DDHA 2HFEB 5DJYA 3WN5C 1ROWA 1MHPH 4O2EA 2PF6A 5EOCJ 4BYHA 3BH8B 5E9DA 2IPUK 2IH1B 2P49B 5C0IA 1IILE 4XTRC 1JWSB 4I18A 4XCEA 4XP6L 4JZJB 4RNRA 1RZFL 1T6VN 1DBKH 1T7ZA 5AWNH 4Y1AA 3QRGL 4GXVL 2V7HB 4ZODA 2H1PL 4E41D 1JZ2A 3KXFA 1D5BA 3EDKA 1K8IA 3AGVA 1EIBA 3T65B 1I75A 2ESVD 3I6GA 3CSBA 3PE9A 4KHTH 3U9UB 3VFRA 1D5IL 2F54B 3GRWL 2GAZB 2FH6A 5INDB 3DLQR 2Y25A 3CVHA 3V9FA 5LQBH 3SDCB 1B9ZA 4MMZC 2DQHH 4Q58C 4Y4FC 1PAMA 3TC9A 3Q3GA 4TOYH 4A2MA 3CK0L 1WIOA 1DEEA 3ARDA 4DVBB 1ZLVH 4NQSB 1OAQH 1ZT7B 3PL6C 3RPKA 3GBLA 1ZA3B 5F9DC 1KB9J 2XWBA 1YNLL 3NCBB 4FOMA 4KKBD 5ITBL 4MD0B 5BQ7B 3BMWA 4K7PL 2JCCE 4LPCA 5FCUL 2X4OB 4MHHG 5CJBA 5IB1B 3C5ZA 4S1DC 1J8HB 3NZ8B 1ZGLM 2AEPH 3ULVF 5IVZB 1BIIA 5TE6H 4EI6B 5IVXA 3O3BB 4IEFB 1ZHBA 1NJ9B 2VDRL 4GSDL 4UT9H 3MNVB 4ZTOL 4JY5L 3V7AE 3IYLW 1XF5B 3BAEL 3IFLL 1FO0H 1RJZA 5ADOH 2J88H 4W6WB 3NFPB 1N2RA 1UADC 4LMQI 4Y0GA 1F90L 2AQ2A 4NFDA 1D6VH 1A6VL 1MHEA 3QULA 3TN0A 1F4XL 5DTFA 4M3KB 2P5WB 4PLJD 3PG2A 3MUGB 1S8DB 3QIWD 1P2CB 3DVIA 2E7LA 1KEML 1HOCB 1R24A 3HUJF 1JPST 1WK0A 1EEYB 5LWYH 3MZTA 2V2WA 4GW4A 1IQWL 3TZVA 2YEZA 4OBRA 3ZTJH 1X7QA 3I6KB 1FYTE 3BPOC 2AXFB 4N68A 4K2UH 4PJ7F 2APVA 2ZG2A 3IKCA 4LCCA 3ROLB 4UOJA 2R2BB 3VGFA 4LFHG 5HHOE 4MVBC 3SGEI 4FQCH 4UILH 2N7BA 3UTQA 2GHWB 1CQKA 4K7FA 4ZTPL 4ZFFB 1JGLH 3DYMA 3W9EB 2VLME 4K9EC 5CSGA 1F3JB 3PF2A 4JFPA 5D7LA 1PKQA 4CGTA 4M1DH 4PJ7A 3LN9A 5BXFB 1JBJA 1IGCL 1NCDH 5I17A 5DI8B 1ZEAL 3QUZA 4WTWA 3VFSA 2EXWC 4PLKC 3E2HB 1HQRA 2PW1B 1FJ1B 1DQTA 3PDOB 4RQQB 1OT2A 1T89A 4OD3L 1KENL 2R69L 5HVHB 4MJIA 4Z76A 1IVLA 3MRBB 5BJTA 1TNNA 3X13A 1A2YB 3MRCB 4RGMB 3ARQA 3BGFC 5CBEB 3WFEH 4Y8DC 5IGXH 4WW1B 5DRWA 2J3SA 1AR1D 4WFHE 2W92A 4NQCA 3QHFH 2M26A 3KG5A 3TYFB 43C9A 4NNXA 2H2SD 4PJEB 2I07B 1FFPB 2HTKD 3R8BB 5EUKA 1DUZA 3GNMH 4XBEL 4QXGL 1PBYA 4LPTA 4FTVA 4YDJB 1EO8L 5DJAA 1EGJA 4R7DA 3MGOB 1JFQH 3GKZA 2VNCA 1Q1JL 4H25A 3MCLL 5T3ZE 3D0VB 2WV3A 5B22A 5CEXB 4G8EA 4JRXB 2ICWB 2ZPKL 1KJ2H 4HAGA 3MLRL 3G5XA 4WNQA 1FV1B 4YDIL 4TUJA 1HQ4A 1IEAB 4L4VB 1RI8A 1A1OB 4LLVB 2G5RA 2X05A 2R56L 2X5PA 3EOBB 4RMSA 5TE7L 5ADPL 2AV1A 5C08A 3CSPA 5K9KA 1YEEH 3IVKA 2PYEE 4HC1H 2XXCB 4KJYA 3ZSSA 2XZQH 4OGAC 2VWEE 2ITDA 1XGPA 2XTJD 4I2XB 2DQDL 1G7IA 5DJ0A 4X98B 1J9CT 1YYML 2ADJB 1EX0A 5KVGH 2OS7A 3TPKA 3D18A 2XWJB 4GKOA 4ZO6A 5E2TL 1AD0A 3FQXB 4XVTH 4DN3H 5KAQF 2IADB 1E27B 5E7FA 4TQEH 1PX3A 3O3DB 5DXWA 4M61B 5FUCE 5GSRA 5A2IH 3GGWB 3HG1D 5I1HL 2V5TA 3BKJL 2FWOA 3B6SA 1X5AA 4XAKD 5ESVA 1S7SA 4C58B 2CD0A 4GAGL 3KPRB 5DDHB 2FO4A 4UDUB 1EHXA 5IK3A 4M43H 1N59B 4JQVA 2FGWH 5IB2A 2V7NB 4HXBL 1DANT 5JIKA 3BUYB 2M8XA 5DVLA 1KULA 4OGZA 1F3DH 3HC4H 1RZKH 1TJIL 1JK8A 1B88A 5KAQG 3LSOB 5CJXA 3V6OC 5CIPH 1L9MA 3O4LB 5FGCE 5CBAA 5FO9B 4WWKA 5DURB 1GIGH 1JNHA 4MAYB 4ODUA 3S35X 4Q97A 2F53A 1G6RB 5L7XH 3MGTA 4QRQA 4PRAA 3VI3F 2B7DT 3W2DL 5D1QD 4MNHB 4RBPK 1DDHB 3QXDA 5DJYB 4KK8D 4O2EB 5IV2A 5D7JC 1CL7H 4LBEA 3H3PL 3EFDH 3DX7A 5E9DB 4Y2DC 2OXGA 4CNIA 1RZ8A 1FE8H 2W9LA 3N1QC 5C0IB 4I18B 4XCEB 3DETC 2EDLA 2BFVL 4RNRB 4UB0L 3PV6A 3OKMA 4YLQT 4Y1AB 3G6AA 4HG4K 4KTYA 3HE6D 4X80L 4P2QE 4XMLL 3KXFB 5TDNA 1D5BB 1TENA 3MNZA 1K8IB 5JXEA 3I6GB 3VFRB 1U8IA 4JB9H 2WAHA 1IGTA 2N1KA 3CVHB 2MCG1 4R4FL 1K9TA 2Y06H 4ZAKC 1CGVA 3BIAX 3Q3GB 5E99H 1RU9L 1MHPL 4N0CA 4DAGH 4WCYH 1DEEB 1WSST 3ARDB 5I1LA 5I18H 3HE7D 4PTTA 4UIKH 1UCTA 2XWBB 4YHIA 4WEBH 4WV1A 1DE4A 3TA3A 3K7UA 4YAQA 4OGYH 3C5ZB 3VXSD 5F9WB 3TFKD 4RIRA 1DBKL 4HIXH 1BIIB 3MLYH 2BNRE 1RURL 5IVXB 4EI5C 1ZHBB 5L2KD 4OLUH 4WUUA 1Q9LA 3E3QA 3VG0H 4RWHA 4BFBD 1IC5H 1FLRH 1MJUH 1RJZB 1KN4H 4KHTL 5DUBA 5ACZA 1N2RB 1E4WH 5I30H 4OB5H 1FLTX 1LHZA 1WISA 1MHEB 3M8OH 3QULB 3TN0B 1WWWX 3KPMA 2EE3A 5DTFB 1I3UA 3MC0A 5C0BE 2CKBH 2CLZA 1WFUA 1R24B 4QHLA 1UCBH 2V2WB 4GW4B 3TZVB 2YEZB 4WGVB 1X7QB 2WBKA 4HF5H 2OR8A 2C1PA 5KSVA 1MCNA 3Q0HA 4M7JH 2AEPL 3IKCB 4LCCB 4WHDA 1CXKA 1A22B 4WY7H 3SGKA 5J3HC 4F9LC 1VERA 2CUIA 1BJ8A 3K46A 4U0RC 2LAAA 1D5MA 5FIEA 4PJ9D 3UTQB 5C0CE 4K7FB 2J88L 2JCCF 2CH8A 4HK3N 4JFPB 5D7LB 1PKQB 3DGCR 4TTGA 4PJ7B 1D6VL 1ZLUK 3MA9L 1FSKB 3GEWB 1B3JA 5I17B 1GC1C 1JRHH 3DX9A 3QUZB 3RWIA 3VFSB 5ICYA 1HQRB 2ZOKA 2YOCA 4N5UA 4R0LC 4RGOH 4D9LL 2JCCA 2W9DH 4X7DC 4MJIB 4Z76B 5BJTB 4K2UL 4HK3J 2Z35A 1FNLA 3X13B 3F65A 3O6KL 3WS6A 1NMCC 3G08A 3AS2A 2VYRE 3BEWA 4J3TA 1G7JA 3RHWK 1ULVA 4UILL 5DRWB 4G6KH 5IKCA 3LQAC 2Y07H 1CE6A 4UT6H 1I7RA 2MNUA 4NQCB 3ZKSD 4I5BA 3THMH 43C9B 2IMNA 2EC9T 4NNXB 2DMBA 5F9OL 2Y6SC 4GKSA 4QGTA 3KLHD 4MXQC 4M1DL 2AXGA 1CDBA 5FUCC 5J57B 1E4JA 1LD9A 3JVGA 4MJ6A 5EUKB 1MF2H 1DUZB 1MI5A 3V7AG 3IAPA 3CDCA 3RIAK 3KJ4B 3RY5A 4FTVB 5DJAB 1TIUA 4R7DB 4H25B 2Q1EA 1PX4A 2YA1A 4LAQH 1I3VA 2AI0H 4G8EB 1FYTA 3EAKA 1QHPA 3Q5YA 3AU1A 2WBJD 4WNQB 4ZYKB 5HHOA 5EC2A 3EJJX 5IGXL 3LZFH 4TUJB 4MCYA 1HQ4B 3PIQA 5B3NA 5KVDL 1LGVA 5EWIL 1KIQA 5C0JA 2AV1B 5C08B 4V2BA 5K9KB 3IVKB 4KJYB 4OSUH 4NBYB 2A9NH 3OKNA 4WO4D 3U4AA 2ITDB 1XGPB 3GNML 2NY3C 1G7IB 5DJ0B 3O2WL 3HKFA 3WV0A 3MR9A 4PJBE 1N6UA 3QIUA 3D18B 3C60C 3QNYA 4F3FA 1F02I 4ISVA 2ZOLA 1MIMH 2J5LB 2VLRD 1AD0B 4LQ1A 1KJ2L 5E56A 4ELKB 5I6XB 3EDDA 5ELIA 1OPGH 4G43A 1B0GA 1LP9A 3FT2A 4YHKL 4G6FB 4NN5B 5GSRB 3KLAA 2DAVA 4K07A 3ESVF 3I02A 2FWOB 2BVQA 3B6SB 3IDMA 1YEEL 5ESVB 1S7SB 2BHUA 4U1HA 1W72A 4NO2A 5I73B 5J56B 4HC1L 1Z9OA 3OAUH 3TCLA 4BUHA 4DUVA 3SQBA 2FO4B 2XZQL 4L4JA 4WJ5A 5IK3B 2BK8A 5DLMH 5GRVK 4EQ2A 5IB2B 3ARDD 3MOQA 3CDYA 5KVGL 4I8DA 1IT9H 2RBLA 1ORSA 1LEKA 2YSSA 3KLDA 2AJSH 4AEFA 1JK8B 1BFTA 4OD2A 4NQVA 4W4OA 4P2RE 4JKWA 4DN3L 3ARGA 1N0XH 5CBAB 4WWKB 4NQED 3MLWL 1KGCE 1JNHB 4ODUB 5GJSH 1PLGL 2F53B 3CXDH 1HXYA 3RTQA 3MGTB 4QRQB 4PRAB 4DK3A 3VXUD 2E7MA 4O58H 1VCAA 5KSAD 3QXDB 4BSWA 4KQ4H 2PYEA 5CJOL 1JWUA 3IGAA 5IV2B 4LBEB 3DX7B 2Z8WC 4M43L 3UAJC 1VESA 4AQOA 1RZ8B 4CNIB 4K8RL 4FNLH 1X5XA 3PV6B 1MWAA 3OKMB 4NZJA 4IS6A 2BC4A 3HC4L 4U0QB 2JLLA 1RZKL 3G6AB 1N3NA 1TETH 1DQDH 3EO9L 1KT2A 2JIXD 2VN7A 4D8PA 3MJ9A 3Q6GH 5GS2D 5TDNB 3MNZB 5I15H 2DYPA 1IGYA 4Y16D 4DN4L 1NAMA 5L7XL 1U8IB 5F88A 1IGTB 1H3TA 4HFWA 4L29A 2CPCA 4UINH 3VW3H 2CLRA 1OARL 5E8PA 2CDGA 3HHRB 3EFDL 3GHBL 1RY7B 2B39A 4WDIA 3K80A 4V1DD 4PTTB 3HNTH 4YHIB 3QUZD 4WV1B 1DE4B 5BW7A 3TA3B 3TP4A 4AEIH 4YAQB 1BM3H 3PWJA 2ED9A 4GS7C 4LVOB 1RIVH 4RIRB 1BF8A 3G04A 1U91A 3X11A 4I0CC 4WUUB 1Q9LB 4XCNA 5K9JH 4BZ1L 4UBDC 1J12A 1JGDA 5GS1A 5DUBB 4PLOB 4APQD 2BERA 5ACZB 1HZHH 3T1WA 4H8WC 2XA3A 1MH5A 2Y06L 3J7HA 1DVFC 5ICZA 3KPMB 3O0RH 5IHZA 3OAZH 4DAGL 2VZOA 3V7MA 4F33A 2CLZB 4UIKL 3MODL 4DWHA 4QHLB 3DYOA 4OGYL 1QYGL 2C1PB 5KSVB 1PY4A 3FFCD 4HIXL 3B2UC 5GRUH 4U3XA 1R3JA 4LIQH 4BQCA 3INUH 4JVUA 4OLUL 3P77A 1D5MB 1L7TH 1BBDH 3OZ9H 5E94A 3LEXA 1U58A 1IC5L 1FLRL 1KN4L 3RPIA 3U0WH 1E4WL 1FP5A 5FYKE 4Y4FD 3MOBH 1N6QH 3AY4C 3KYKL 1HKLH 3M8OL 3LRGA 2ZUYA 1AE6H 5JMOC 3PL6D 5TE4H 4L3EA 2W59A 3DX9B 3RWIB 4DZ8A 1E4XI 5ICYB 1MFAL 2ZOKB 5FO8A 4P99A 4IRSA 3ARWA 4OCMC 1IEHA 3O8XA 4S1DD 5J12B 4N1HB 1UCBL 2JCCB 4XPFH 5I8EA 1MCJA 4EN3A 2KPNA 2APTA 4NFCA 4HF5L 2KQNA 5HGHA 3WIHA 2Z35B 1BJ1J 4HUXA 4ORZC 4FFYH 3G08B 3C5SA 3SE8H 3KNBA 3LKNA 1NC2A 3BEWB 3FB7A 1G7JB 2BNUA 2W07A 4QT5A 3RI5F 5IKCB 1CE6B 4P4KC 1I7RB 4FXKA 1MVFA 1MCPH 4I5BB 1SJVA 4NQDE 1AC6A 4MXWH 4GKSB 4NKOA 3O3AA 2AXGB 4OFPA 3E2HC 3IDIA 1LD9B 4MJ6B 4HJJH 2XY2A 1MI5B 1GZQA 1JRHL 4WHCA 3ZYJA 3ARBC 3FTGA 1XFPA 4NBZB 1F97A 4PFEA 2XZAH 2W9DL 1FYTB 4JY6A 5GJTH 1FG2A 1AGCA 3AU1B 4XI5C 2EIEA 5HHOB 4Z95H 5EC2B 4YHYC 4CU6A 2PN5A 3VFVA 3TO4A 4MCYB 3OXSA 1MLCA 1LE5A 3PIQB 2CRMA 2VC2L 4G6KL 2Y07L 3L7FA 4HH9A 4XC1H 1KIQB 3QUMA 3SE9H 3THML 2EH8H 5C0JB 3KPSD 4GBXC 4PUBL 1I4FA 4GT7A 2EXWD 4DVRL 3OKNB 3ZLQC 1UVQA 5CINH 1MF2L 1SJHA 2VZ1A 1JZ6A 1AFVH 5EFIA 3CFCH 3ETBF 3D6GA 4JVWA 3O2VH 2B20A 2BNQA 3MR9B 3QIUB 5DO2D 5FYLE 1X5JA 3QNYB 4F3FB 4ISVB 2ZOLB 4LAQL 1IC7H 3Q48A 5J7CC 3H9SE 3N85H 3B9VA 4YHLH 2MQ0A 4LPWA 4Y19D 3BYYA 4G43B 3UTOA 1B0GB 1LP9B 3FT2B 4KY1H 4PRDA 5BS0A 3NCYS 4WRLA 2E6JA 3ZKNC 4JQXA 3KLAB 2I25N 1N7MH 3SOBL 2L4OA 3I02B 3MJ7A 4NQTA 1UH4A 2BVQB 3IDMB 3GM0A 4JFFE 4U1HB 1W72B 4NO2B 5D96B 2L7UA 3TCLB 4OSUL 3RGVD 1PG7W 2A9NL 3GI8L 1ED3A 4WJ5B 5DVNA 4MA3A 4TPRH 4IBLT 1D3CA 3UPRA 1JNLH 4YDKH 4BH8A 1F8TH 4YK4B 1YJDC 3U2SA 4L9DA 3TNNA 2H45A 5GRYA 4U4BA 3U9PH 1ORSB 5SWSE 1LEKB 1MIML 2JB5L 2YSSB 12E8H 2H41A 4GUPA 4O02H 4YE4H 5JW4R 4OD2B 3DUUA 4OZGE 1MAKA 3BIKA 4KRLB 4NQVB 4S10A 1OPGL 4MQXC 3ARGB 5HGGS 4L4TE 4WUUD 5JW3H 4PJBF 2R15A 1HXYB 1J0YA 3RTQB 2Y72A 2OR9L 4GRWE 3VFTA 4BSWB 1EA9C 4OGAD 3HZVA 3V0AC 4YR6A 2PYEB 5E2VL 1JWUB 2Z4QA 3IGAB 3MZGB 1VENA 5J13B 1KTKE 3LMJH 3WEXA 4KXZI 5D9SA 1C8PA 4PPTA 5L6YL 5C2UB 4KJWC 4PJBA 4X7SH 1VACA 1MWAB 5B38A 1JF1A 1NANH 1VKXA 4IS6B 5F3BA 4LLUA 2BC4B 1G84A 1IAIM 3NN8A 2DM2A 1N3NB 3P4LA 1UWEL 1KT2B 4WW2A 3KYMA 4D8PB 4MAYC 5HXMA 1QQDA 1FORH 4GLRI 2IBGA 1S5HA 3UPCA 5J1SC 4KI5C 2FX9H 3H9HA 1QHOA 2DYPB 1IGYB 5T5NF 4JFXA 4PP2A 2ZWLT 5B38G 5GJSL 2NXYB 3CXDL 4G3YL 1NAMB 5GHWH 5F88B 1CLYH 5GGSY 4O58L 2C9AA 4HFWB 1I9RH 3QIBA 4L29B 1J87A 2CLRB 2CRZA 4LRNH 5E8PB 2CDGB 4I18C 3ARUA 4WDIB 4WFGE 3MCG1 2OP4H 1I1RA 3T4AA 4PJFE 4FNLL 1S7RA 5BO1L 4LCWA 2NY1C 3PWJB 2GTZA 4JY4A 4TSBL 2WWKO 5CAYB 4QOKE 2GK0A 3ZE1E 3G04B 4NNYA 1U91B 1DQDL 3X11B 3RNKA 4TN9A 4F7EA 3Q6GL 4P2RA 1NCCH 4XCNB 3O41A 2X41A 4JFDE 5GS1B 1JGDB 1TJGH 2VZSA 1CFTA 3S4SA 3TBYA 2P8LA 1DBJL 2DI8A 4RA3A 3IFOA 1MH5B 2FEDC 3F7PC 5ICZB 3O6LH 4UINL 4Y2DD 3VW3L 1HI6A 3TYGL 4HWNA 5IHZB 2FZ3A 5CJ8A 4F33B 2WQRA 3C5ZC 2ZCKL 4YIQA 4U1KA 4N0UA 3HNTL 5E2JA 4AEIL 1BM3L 3QCTH 4JN2A 1RIVL 3RZCD 3HPJA 4Q7DA 1FNAA 2BHZA 4P59H 1I7TA 4N8VA 3V5HA 1R3JB 4L9LC 1KJ3H 4UOW1 1NAKH 35C8H 4PG9A 3LQZA 4W4NA 3P77B 2HH0H 2NNAA 5E94B 3LEXB 4PGDA 1U58B 1HZHL 3RPIB 3C2AH 4N8VG 4K71C 1RK0A 3QZWA 1QSFB 3UDWA 2WLYA 3HR6A 3IJHA 3TM6A 2VLMD 4JG1H 4I3SH 4XH2A 5JHDE 3O0RL 2FGZA 4L3EB 4UQ2A 4DZ8B 1NGYA 3O3EB 3TZVC 4GG6E 1MCKA 1EHAA 5FO8B 4IRSB 4LLYA 3O8XB 1QFWM 3WFBL 2XFXA 5CGYC 4EN3B 4HZLA 5I8EB 1CDHA 5EORH 5EPMA 1J5OH 1WFNA 1FL6B 4KGLA 5FYJE 7FABH 4XXDA 3PWLA 4EI5D 3BJLA 1SQ2N 5HGHB 4HUXB 4LVNC 2A74A 3RIFK 3FFDA 4LIQL 3P4MA 3INUL 3C5SB 4HHAA 3KNBB 1NC2B 3LKNB 3FB7B 4WIQA 2BNUB 1KB5L 1UJTA 4QT5B 3OZ9L 1E6OL 4FXKB 4DGYL 4JKKA 4N1EA 1NMBH 3PXHA 2Q86A 4HUKB 3MOBL 1N6QL 1ZKAA 4M9PA 4NKOB 3O3AB 1QUNA 1HKLL 3IDIB 1BWMA 1AE6L 4Q9QH 5DD3H 3WFZA 1GZQB 5FFLA 3SQOH 1MQKL 4POYA 1T89C 1YY8A 3MJ8A 3FTGB 1RUAH 3SDYH 4DKFH 2NZ9C 4XPFL 3C6LC 4P5TA 4JY6B 5DRNA 5FGBC 1FG2B 1AGCB 5GGQH 3OF6A 4FP8H 4PJIE 4E5XA 4IIQA 1OAZL 3BSZH 1J1OL 3VFVB 4QLRA 3TO4B 4Y8AA 1Z3GH 3OXSB 1MLCB 4QXUH 1LE5B 2EEDA 1IAIH 3HRZA 3L7FB 3PGDA 4P23A 4HH9B 4XP9L 3QUYA 3UJTH 2J2ZA 2QV2A 2VAAA 3QUMB 2NX5E 1QP1A 4JFZH 3ZT5A 5DVOA 3VFWA 1I4FB 1T7XA 4R4BA 3ISWA 1UVQB 4HJJL 1SJHB 3QJFA 2D2OA 3S6CA 5EFIB 4XVJH 1OGTA 2BNQB 4KWUA 1QO3A 1OGAE 4O00A 4AL8L 2XZAL 2WZPD 2ZSVA 4UZGA 1GGYA 4NOFA 2VDNH 5GJTL 3QQ3A 5M94B 2ED8A 2A73A 2Y9RT 3FN0H 5DMKA 4Z7WE 1ZANH 2P4AB 2AEIT 4PRDB 2IALA 2DQGH 5BS0B 5CCKH 3JV0A 3MJ7B 2Y6SD 4XC1L 4ZQKA 4DKEH 2D31A 5FECA 3SE9L 2EH8L 5D7SH 3QDGE 1WT5C 4NQDA 3D39A 3VD7A 4Y5XA 1ED3B 1ADQH 1WTLA 4LLDA 4MA3B 4XPGL 5C09D 3UPRB 2VXTH 4W6YB 1MCSA 1AFVL 4BH8B 3O2VL 4LPYA 2OMNA 3U2SB 3DXAA 3O6FA 3TNNB 5FO7A 3S88L 4S2SA 2ZNXA 2N56A 1UM4L 2BRRH 1VDGA 4GUPB 2WWMC 4HBCH 3DUUB 5D5ME 4Z8FL 3BIKB 1AC0A 4ZFZA 3WKNA 2X4QA 3EJYD 3KHQA 4NN5C 1RZJH 4HMDA 4KY1L 1V7NH 1CU4L 1CFVL 1L9NA 3DV6A 4RAHA 5IMKA 1M05A 3MRQA 4WHYH 2HKHH 4IJ3C 3VFTB 4U1NA 2ERJB 2CKNA 2X4NA 1Q9WB 3LN5A 3HZVB 4YR6B 2NY3D 2Z4QB 5F7MC 3TBSA 3IJYA 4KU1A 3WEXB 5D9SB 4TPRL 4YDKL 2ZUUA 3C60D 3S96A 3WIFA 1F8TL 4PR5A 5DSCA 4PJBB 3ESUF 1VACB 5GIRA 5B38B 1JF1B 4BK4A 5C86A 5F3BB 4P9MH 4LLUB 5I1DA 4X4ME 3CNKA 3NN8B 1U8JA 2IWGA 3H9SA 12E8L 3EYQC 5MEQA 4O02L 4WW2B 3KYMB 1QQDB 4PRHA 3U7WL 4XBGA 4TULH 1QFWH 4HWBA 1S5HB 4FFZL 3H9HB 4OCRL 4JFXB 2FD6H 2X4TA 4KRMB 4PP2B 4P2QD 4XCFH 3SO5A 5I1IL 5JO5A 3CXHK 4ESKA 3RY4A 2EDQA 2Y5TA 2VXUH 4FQ1H 1HHGA 1U3HC 3QIBB 4JFFA 4PRPE 5GS3A 3REVA 1T5XA 1XGUA 2EO9A 2CXKA 3SGDI 4OZGF 5L0QC 1OD7A 4X6FA 4ONGH 4NRYA 4PYGA 2G2RA 2MHAA 3V5KA 4XPTL 3T4AB 3U4EA 1IKFH 1S7RB 2VL5A 1U36A 4LCWB 1H5BC 4A2LA 4X7SL 4GRWF 4PJAE 5DK0A 2GTZB 3O8XD 4JY4B 5E4EC 4CVWA 1YEKL 3LCYA 2GK0B 5SWSA 2J8UE 4NNYB 4HIEA 1J0IA 5JXEC 2WLZA 3RNKB 4MLIA 4F7EB 1WIPA 1X5FA 3NCCB 1ZLVK 4P2RB 2BNRD 2AABL 2D7PA 3O41B 1K3ZA 1DSFL 1NC4D 3KYNA 1NC2D 3U7YH 1WVZA 2OSLA 3HR5A 3DMMC 3CVHH 1CFTB 5GHWL 4I13B 2P8LB 3S4SB 3SJVE 3TBYB 1CLYL 1HH9A 2P8PA 3FRPA 3IFOB 2OTUA 1AHWA 3ARFC 1HI6B 3UAJD 1WWCA 3W9DA 2FZ3B 3O4OC 3TIEA 2LV4A 3OPZH 3TA3C 4HAFA 2VDML 3LKQA 3HI5H 4YIQB 4U1KB 4N0UB 5C0BD 3ILPA 3FRPG 4MNGE 4LSVH 4JN2B 5F8QC 3HPJB 1BFOA 3HS0A 2OJZH 1I7TB 3E3QC 4N8VB 4OAWA 3V5HB 1DZBA 1I7UA 3NIGE 5CEZE 4PG9B 3LQZB 4ZS6C 1NCCL 2NNAB 4AQ1B 3D2UA 4PGDB 4PJFF 4CKVX 5C0CD 3ULVH 1RK0B 3QZWB 2AGJH 5IQ7H 3ZE1F 1DBMH 3IJHB 4JPWH 1AJ7L 1XZ0A 4HGWA 3O6LL 4XH2B 1Z9SA 2EDTA 1A7RL 4UQ2B 4JPKH 1NGYB 2DQTL 1U8KA 4LLYB 3E0GA 3WNKA 2XFXB 4PJFA 5F7LB 5D72L 4HZLB 3EYFA 3O6MH 5EPMB 1LEIA 1JHLH 4XXDB 3PWLB 3EOTH 2B4CC 5TF1L 2APFA 3FFDB 4GQ9H 1KJ3L 2OLDA 3FB6A 3P4MB 4HHAB 1NAKL 35C8L 4QY8A 4MJ2A 2AEWA 2KZ1B 3C5JA 4L5FL 2C3GA 4U33A 4PY8J 1DVFD 2Q86B 3C2AL 1A7PH 4XP1H 1MOEA 4LPXA 1HHKA 3RWEA 1WLHA 5IBTL 1QBBA 5BOZG 3CZFA 1YY8B 5ANME 4NKDA 3PXJA 3MJ8B 3B2UD 4P5TB 3ARVA 1J5OL 4E5XB 3ARRA 4IIQB 1I1AC 2BVPA 4FQXC 3QPXL 1JPTH 2DL9A 5JW5A 4GG6F 3HRZB 4P23B 3PGDB 5J6GA 3QUYB 2VAAB 4ETYA 2HT3C 3FJTA 4R9HA 4AIZA 1AXTH 3I9GH 2Z9TA 3VFWB 4R4BB 3TT1L 2D7TL 5GZND 4Q9QL 1GHFL 3QJFB 3V4UH 2Y23A 3P11H 2F8XC 1OGTB 5F72S 4S1SH 4OUUA 4OV5A 1HN1A 1QO3B 3MV7E 5I8CA 1RUAL 3SDYL 4DKFL 3PUCA 3V8OA 2ZSVB 3OL2A 3QQ3B 3AMKA 2A73B 3V5DA 1S78C 3VDBA 5DMKB 4H1LA 4P4KD 1L7IH 3BSZL 1KXQE 2IALB 5HHMA 1Z3GL 4QXUL 2ORBH 5J4MA 3STLA 3RVTD 1IAIL 1KG0A 5TQ2H 2DICA 4ZQKB 2VLJE 2D31B 5FECB 1SVZA 5DMGC 1DCLA 3R0NA 5BVJA 4NQDB 3D39B 4H1LG 2YPLE 4JFZL 3IDYB 4PJIF 4M48H 4Y5XB 5IMOA 4LLDB 4U6YA 5F7DA 3ARBD 3QIUC 5SWZD 1NDGA 5CUSH 3DXAB 3O6FB 1P69B 5FO7B 2FO1A 4S2SB 3P3YA 2HN7A 5IQ9A 4XI5D 2VL4A 1GH7A 4D3CH 3TPUE 2VDNL 4WWID 4ZFZB 4J3UA 1RJLA 4PJIA 2D9QB 2X4QB 3FN0L 1F5WA 1D9KD 4C56D 2COQA 1OW0A 1I1YA 5FV1L 2DQGL 3DV6B 5IMKB 1M05B 3WFCL 3MRQB 1XCQA 5CCKL 4NKIH 1KGCD 5D96C 4U1NB 2NX5A 2X4NB 3LN5B 5D7SL 1K6QL 4N0FA 4B0MM 3CXHJ 3TBSB 3IJYB 4XNYH 4YK4C 4XNXH 3HMXA 1F58H 2YA0A 4XRCA 4Z7WF 2VSDA 5CKAA 5IR1A 4X8XA 3DURA 3BRFA 3S96B 3WIFB 1MCDA 4ACPA 4PR5B 5DSCB 1TLKA 3SDDD 3KYOA 1B90A 3EZ8A 5GIRB 1YJDL 4MQSB 1OGAA 3TVMC 5I1DB 4OF8A 5IHUH 2FJHA 1U8JB 3H9SB 3JUYA 5MEQB 2BRRL 4HBCL 4RFNB 4NGHH 4PRHB 4XBGB 4XP5L 5D93C 4Z7WA 4GFTB 5EU6A 3UBXA 5I0DA 3RTQC 3ZMRA 1KIUA 1V7NL 1K4DA 2X4TB 1BQLH 2FR4A 1H3PH 4UV4L 3QG7H 5JO5B 3WXVH 3U36A 2HKHL 4LDLB 3OJVC 2OMBA 2Y5TB 4C83A 3OXRA 3ZE2E 1HHGB 5J13C 4JFFB 3REVB 1T5XB 1XGUB 3RWDA 3BKML 5D5MF 4AH2A 4PGEA 4X6FB 3TJHA 4NUJA 4NRYB 4ODVL 4LASH 4JHWH 3ULUE 3GSRA 4DFIA 2G2RB 1KN2H 2MHAB 3V5KB 4POZC 5B4MC 4IOFC 1UYWL 4QTHA 3U4EB 4P3CH 2VL5B 1CVRA 3A6BH 5DK0B 5SWSB 4FABH 4MQXD 4HIEB 2HFTA 4LNVA 1CXEA 5FCSH 2PO6C 2EO1A 4JM2C 5EN2A 2NXYC 1QFWL 1T0MA 1CFSA 4TULL 2UWEA 5E5RB 1NUDA 1XF4A 2FD6L 3KYNB 1G6RL 4IRJA 4XCFL 4X6DA 5IW3A 1M71A 2OSLB 3HR5B 4FN0A 3SGJA 4ELME 4OZFG 5EZJA 4GRWB 1X5KA 4P49A 1HH9B 2P8PB 2AP2A 2OTUB 2VXUL 4OIIH 3UJIH 1AHWB 4P5KA 5EUOA 3W9DB 5GGTA 1A14H 4ONGL 3TIEB 5BVPH 1SEQL 4R90H 4NUGH 2C4FU 3LQMA 4NO3A 3LKQB 4JHZA 2CRYA 1RJYA 5IESH 3ILPB 4Y4KD 2RFXA 5DEFA 4O2FA 2FIRT 3K2MC 3ZTNL 2QHRH 5IF0A 4Q74A 1P5VA 1BFOB 3HS0B 5HYEA 4OAWB 5B21A 4C55A 4KI5D 1I7UB 2UUDH 3LPGA 1P4BH 2B2XH 3D2UB 2GY5A 5E6IA 2QQNL 2QQKL 5E70A 3CVHL 1SYSA 3ALXA 1NQBA 1IGFH 4PJAF 5D2LE 1FO0A 2IF7A 2J8UF 1U6AH 1F00I 1XZ0B 4HGWB 4PRPA 4R8WH 5KZCD 1QVOA 3OPZL 4AG4H 2NY1D 3HI5L 5ALBH 4HLZG 5C6PB 1JGUH 1U8KB 3BN3B 3SKJL 2XKSA 5C0AE 1AKJA 1U0QA 4LSVL 3TV3H 1CTNA 4PJAA 1LEIB 1G7LA 1PY9A 3QI9A 2VQ1A 2OJZL 2FJFA 1ZA6A 4IM8A 4NRXA 3FB6B 5LXGL 1XIWD 4LU5H 4N9GA 4QY8B 3SY0A 2AJYH 4U3CA 3FOMA 3C5JB 4P5MA 2YK1H 4IDJH 5HBBA 4X9GA 4KMTL 3MUY1 3AROA 2FEDD 5HDBE 4N8CH 2XG4A 1NFKA 2FSEA 4RSVA 3SJVA 3PQYA 1T7YA 3ULVL 1FNGA 2AGJL 5FEBA 5IQ7L 3UJJL 1DBML 1I9IH 1HHKB 4JPWL 1A3RL 3RWEB 4F9PA 3NIGF 4IRSC 4JHAL 2Y4SA 3CZFB 4JPKL 2YS4A 3KS0J 2DKMA 2YXMA 4NKDB 4FA8A 2GJ6D 1BPVA 4YPJA 4W70A 4MNGA 3B8YA 4R2GC 1JHLL 1JPFA 3QSKB 5M7QA 4GQ9L 1OTSD 3VFMA 2DMCA 2BVPB 4NZRH 1U8PA 2ZP0T 3IFNH 3ZKMC 2I5YL 5JW5B 1KOAA 1JI2A 4JFQA 2R0LL 3A0OA 5J6GB 1N64H 4JJ5A 2ADIA 2HJFA 4PJDA 4AIZB 1A7PL 4XP1L 1P84J 3CH8A 3B2VH 4PBVC 4QHKI 5I19H 2X7LA 1UEYA 2FBJH 1LVEA 3TGXA 5AG9A 1FAIH 3CLEH 3QEGL 4OUUB 5HVFB 1WICA 4OV5B 2ZKHH 5I8CB 2HFFA 1EAPA 1OT1A 5FYLD 3BZEA 2ICES 5ERWA 3V5DB 1LDSA 3VH8G 4H1LB 1QBLL 5HHMB 2HTLC 2AEQH 3STLB 1KG0B 1MRDH 1GCFA 4LSTH 4O51A 2GK2A 2YUVA 3B8SA 1UKSA 1MCHA 2BVUA 3L5HA 5D1XA 3EYOA 2ZG1A 2E27H 5BVJB 1AXTL 2JELH 3I9GL 5KW9H 3TF7C 1TJHH 5IMOB 2YRPA 4JFFD 4Z7UA 1FRGL 5F7DB 3V4UL 1NDGB 1EGJL 3LAFA 3C6LD 1NEZA 5J0BA 1IC4L 3I3EA 2HN7B 5IQ9B 4XBPA 4RFEA 5F1IA 4ODWA 5FOBA 1BHGA 4OF5A 5IOPA 1N4XH 1RJLB 4PJIB 5F3HA 5EG6C 4JQXC 1I1YB 4KMLB 1NEZG 4GMTL 1OWRM 4ZUVA 4GJTB 2ORBL 4L4TD 5TQ2L 3LEVH 3FONA 2NX5B 5T1LD 5IB5A 1ZGLA 4AIXA 2MSPA 2WNGA 3I84A 3FB5B 4N0FB 3WO3B 4GOSA 5HY9A 4XRCB 5IR1B 3LKSA 4XXCA 3DURB 4L8DA 1GGBL 5IHBA 5CUSL 1FNHA 5T3ZH 4KDTC 2VITA 2XQYG 3KYOB 4S11A 5EB9A 1OGAB 1IKNA 1S7UA 2CK0H 5E6YA 5I1JL 1CGTA 1NBYA 2FJHB 1NGWA 3PABA 4D3CL 2JJSC 4EDWH 2WUBL 3HC3L 5EU6B 4Z7WB 3UBXB 1AIFA 4FZ8H 3RU8H 4J3XA 2FR4B 3DHMA 3IU3A 4RCAA 4NKIL 3U36B 2VXSH 5CP7A 4MSWA 1KTLA 1AGBA 1BX2A 1JYWA 4C83B 3OXRB 2XNAA 5I74B 2NPLX 3RWDB 2YPLA 3OGOE 4PGEB 5DD5H 5GGRA 1ZLWH 4AH2B 4NUJB 4BZYA 2V2XA 3GSRB 4XNYL 2CUMA 4HKXA 4XNXL 1F58L 3JTCA 3RA7H 1CXHA 2MOVA 4HULB 1TNMA 1WFOA 2NXZD 4QTHB 1KYOK 5BRZA 2DTSA 1MWAH 5C1MB 3P30H 2DKSA 3QFDA 2WWMD 1JGVL 1UA6H 3J8F7 5JQHC 4QOKD 4OM1L 1QRND 4DGIH 5GS0H 5EN2B 1FGVL 1CFSB 1T0MB 2UWEB 1CQYA 5F7WC 5A2JH 3IXAA 2I9TA 4Y4HA 4BSVA 1XF4B 1BJMA 3QHZH 4HFUL 4IRJB 4X6DB 1H3PL 1M71B 3QG7L 4JFDD 5EZJB 1F6LL 1FIGH 2XQBH 1D5ZA 4OFIA 2GYSA 4P5KB 5EUOB 4LASL 4JHWL 4NO3B 3KLSA 1KN2L 5JNYA 1RJYB 1MRFH 2RFXB 5DEFB 4O2FB 4P3CL 3EYQD 3A6BL 5IF0B 5HD8C 3ZE2F 1EFXD 1AGFA 4PD4J 1T2JA 5SV3A 3VRJA 4P46C 4AYFA 5C8JA 3OAZK 3ULUF 3RAJL 4PRIA 4Q9BA 3OJ2C 2AERT 3QWQB 5E6IB 1T0NA 2B5IB 2XXMB 1SYSB 1U3HD 1WBXA 3MV9D 1FO0B 2VDLL 3UTPD 4OIIL 1OSPH 4PRPB 4C54A 5EU7E 2I9LA 1A14L 1QVOB 5BVPL 4R90L 3ME0A 3SCMC 3ZKQD 4KTEH 4NUGL 4U1JA 5JHDD 1J0ZA 2XY1A 1GGCH 5IESL 4ELMF 1MJ7H 2CKBA 5ECJE 2ICCA 1AKJB 3WD5H 4PJAB 1G7LB 2QHRL 3QI9B 4XPHH 4LGRB 2VQ1B 2H9GA 1KCVH 2FJFB 1T1ZA 1ZA6B 3C8KA 2HLFC 3QDHA 4NRXB 5FYJD 4NHCH 4N9GB 2X89A 3SY0B 3CFEA 3ULSA 3FOMB 1P4BL 4P5MB 2B2XL 2WP3O 3BZ4A 4KC3B 1QPXA 4ELMA 2NYYC 2FSEB 4OJFL 3WE6B 3SJVB 5JLZA 1OAKH 2AQ3A 3ARFD 1T21A 3PQYB 2X9YA 1FNGB 1A7NH 2IANE 4GXUN 3PNWA 3F7YA 3CJJA 4AG4L 3QR2A 2P5EA 2MTPA 1JV5A 5C6WH 4NC2B 1CXLA 3EYUH 4QRPD 1IBGL 4MNGB 5LCVL 2XPGA 3WIHH 5D2LF 4OLVH 4Z7VE 3W11D 1JPFB 2EDWA 1YEJH 4ZS6D 3VFMB 2B4CL 3BUTA 3RX5A 4LU5L 1QSED 1U8PB 3H42L 2AJYL 4WFFE 2YK1L 4IDJL 3GUTA 4JFQB 4JJ5B 1BMGA 3T0WA 1CXIA 2ADIB 4JRYE 1MPAL 4N8CL 1H3GA 2HJFB 4PJDB 3U6RA 2NR6D 4B50A 2YA2A 1PFCA 5L8KB 1A7BA 2RJMA 3DV4A 2X7LB 1I9IL 3V0WL 4NWUH 2MPAL 1FH5H 1MIEH 3EW3B 4XVSH 2HT2D 4DOHB 1QKZH 5CSZA 1BZ9A 5HDBF 4E42A 5C0AA 2HFFB 1EAPB 4LLMA 2LAGB 5ESAA 3NGBC 4IIQC 1TCRA 5A40E 3BZEB 2ENSA 5ERWB 2P48B 2VAJA 3EGSA 4P23C 2VLKE 3JTSA 3QUYC 2DTMH 2IGFL 4HUMB 1A6PA 1NLDH 4J4PC 4U6HA 1JZ4A 1N64L 2NY6B 4O51B 2D7OA 4LHUA 3ET9F 3LKRA 1YMHA 5D1XB 3EYOB 1EEUA 4J6RH 2DIJA 4PIRF 5MP6L 1EJOH 5I19L 2ZUVA 2VR5A 2FBJL 2WUCH 4L3CA 4L8SA 3QDGD 4NN6C 4Z7UB 4V3EB 2NY0D 3CLEL 4KZDL 1GRWA 5GSVA 3ZDXE 1NEZB 1TQCB 1TVBA 4KUCF 4G8FA 2ZKHL 1L8JA 3EIFA 3D69A 3U1SH 2EEAA 4XBPB 4RFEB 5F1IB 4YDLB 5HYFA 2DQIL 4ODWB 5FOBB 1I1AD 5IOPB 2X42A 4TVPE 4FQXD 4JPIA 5F3HB 3HRPA 4PP1D 4HQQL 1IM9D 3V52L 1QACA 4ZUVB 3MLZH 2HT3D 4MJ5A 4RGNB 4M7LT 4X8JA 3CLFH 1BGXL 2GUOA 1F45A 4LSTL 5IEKA 3JWDH 3CX5K 5IVNA 1FCCA 3NTCH 4X7EC 4Y5XC 5IB5B 1ZGLB 2JE8A 2E27L 5E7BA 2JELL 2IAMA 4WENB 1TJHL 1HINH 2C3VA 2DLEA 3NAAH 3PWNA 4TYUA 2XTJE 3CVIH 5HY9B 3LKSB 5FUOH 5I1AA 5MEND 4WUKH 2LQRA 4L8DB 2D9CA 1UZ6E 2VITB 3NCJH 3NFNA 4OCXH 1S7UB 1NBYB 1S78D 2CR3A 1NGWB 3QAZC 1EMTH 1FVEA 3PABB 1MFBL 4L8BA 1S9XA 3RDTA 2PR4H 5BV7C 1N4XL 1CGYA 3EDFA 4S1RH 1AIFB 1FNEA 3NOIA 4R26L 5DQDH 1A5FH 2XN9E 1O0VA 3IU3B 4JO2L 3PGFH 4OM0H 4H0IA 5CP7B 4DUXA 2CIKA 2X40A 4MSWB 1KTLB 1AGBB 1BX2B 3LEVL 4XAKE 4EEEA 1W72L 2XNAB 3IDXH 3VWKA 2YPLB 5GGRB 4G59A 2V2XB 3FHAA 4M5YL 1Y6KR 3QXTA 4HKXB 4HS8H 5FXCH 4YFDB 1R3IL 3I2CH 1N5YL 5BRZB 1HILA 4YBHA 5T3ZL 2A0LD 2HAZA 3MRNA 1HEZA 3QFDB 5ID1A 3TCXA 3WXWL 4RFNC 4M5ZL 2CR6A 3MV01 4CVZA 3ZKXB 1UB5A 2ICEA 4WI7A 1A3QA 3IXAB 2I9TB 4Y4HB 4BSVB 3RU8L 4OD1L 3C6SA 1MEXL 5TFSH 2DLFH 1DQLL 5C0FA 1Z9LA 1RUPL 1EUTA 3KPQA 1U92A 3B5TA 1VADA 3G9VA 3NABH 3MUJA 1D5ZB 4ZXBC 1TZGL 5DJZA 1XCTA 5SWQA 5CEYA 1MNUH 5DUMH 1OAXL 5DD5L 5E8DH 3DROA 2AW2A 1VGEH 4FRWA 1U8LA 2J4WH 3RA7L 4LK4A 1L6ZA 5JNYB 5T1KA 3TVMD 3KR3H 1MWAL 4A6YH 4X5LA 2P24A 3P30L 1SYVB 1UA6L 1AGFB 3L3IA 3VRJB 5D1ZA 5C8JB 3MJ9L 3F6IA 5F96L 4FFVC 5GS0L 4PRIB 2Q7YA 5AAWA 2QQLL 5CEZD 3QHZL 1T0NB 1REIA 5D8JL 1NAML 3GSWA 5FM4A 3QJHA 5IB4A 1FDLL 3F62A 5KOVC 1MY7A 1LO0L 1WBXB 3IETA 1UG9A 3D3VD 3LHPL 1INEH 4F58H 2DKUA 3LN4A 4QWWC 4XMPH 5C9JA 4U6VH 3IJSA 2I9LB 2CJUL 3AFLA 1G9EA 4U1JB 1UM6L 1KCSH 2JJVA 4Q0XL 2DJUA 5CP3H 2Z31A 2PW2A 3GJEA 4ZUWA 2CKBB 4DZBA 2EDYA 3WDIA 2D0HA 3OG4B 2VDKH 1EFQA 2PO6D 3MXWH 5AUMA 3TBVA 2H9GB 4JM2D 5CZVH 1EO5A 1T1ZB 3C8KB 5D2NE 1H9VA 3CMOH 4TTDD 1RHHA 3CFEB 4OLXL 3S97C 3BQUD 3ULSB 2RAMA 1HSAA 4X9HA 2D0GA 3DRTA 1TVDA 3BZ4B 4P2OD 3KPPA 4ELMB 2V5RA 1KXTB 5FYKU 2XWTA 5JLZB 1T21B 2Q7NA 5C07E 2NTFA 1KBGL 4G80A 1IGIH 1MUJB 2AVGA 1CYGA 3PNWB 3F7YB 1T3FA 3QISA 2P5EB 3T0EE 1JV5B 1GGCL 1MJ7L 2XPGB 3WD5L 4P9HH 3EDJA 4BH7A 4U1LA 1KCVL 4E41A 1EUUA 3L3DA 3T0AA 4NHCL 4JM4L 5DS8A 2ESVA 4HWUA 4BQBA 2JJWA 4R6UA 3GUTB 2F58H 3LKPA 3ZDYE 2E6QA 1XF2A 3DI3B 4YHPA 4JFHE 3U6RB 5EOQH 4XHJC 1OAKL 4R4ND 3VXRD 1A7NL 2X70A 2GCYA 3DV4B 2UZIH 3QEQD 1QTYT 1JE6A 3SE4C 2X4PA 4OZHF 4ZMAT 4QHUA 4PJ8D 5T3XL 4M03A 5CSZB 2OZ4A 4JAMA 1BZ9B 2V9RA 4E42B 3KPLA 3EYUL 2DD8L 5C0AB 3KHOA 4LLMB 5ESAB 3A6OA 3WIHL 1J1PH 1TCRB 3MV7D 2YC1A 4OLVL 2ADGA 4LEOA 1NFDE 1OTUC 4WFEE 3MLXH 4PV8A 2ZSWA 3EGSB 4KJQD 3JTSB 4NO0D 5I1CH 4Q2ZA 5DFWH 1RZIA 4U6HB 4G8IA 5FYKH 3CMGA 4LHUB 1KC5H 3CPLA 3LKRB 1YMHB 4LSDA 3S37X 1FPTH 1JZ3A 4ZOCA 4Z7VF 5JPMA 2VLJD 2CO6B 1KLUA 3T1FA 2H26A 4NWUL 4L3CB 4L8SB 3QIWA 4LNRA 2XACC 1FH5L 5I16A 1P9MA 3GMLA 4XVSL 4R2GD 1TVBB 3Q5OA 1QKZL 1T6WA 4G8FB 5FM5M 4POUB 3QQ4A 3D69B 1FN4A 4WI8A 2DQCH 25C8H 4M1CC 3LRHA 4JPIB 2LU3A 3MRIA 3ZKMD 4YBQC 5HPOA 1A7QH 1HE7A 2BDNL 4HWZA 4J7RA 2YN3A 4MJ5B 3BW9A 4JO4H 4X8JB 3QUML 2GUOB 5IEKB 4OZIE 1R5IA 2DLGA 4J6RL 4NDMA 2IAMB 4KGJA 1EJOL 1NCAH 2C3VB 3G9AB 3PWNB 5EOCH 5EA0H 4CRPA 2WUCL 5I1AB 3MREA 1F4WH 1MCLA 2FNBA 4C4KO 2Q20A 4HT1H 4E0RA 1ORQA 3WDJA 2D7MA 3NFNB 3MGAA 3ZL4H 3FO9A 4ZPVA 1IZKA 2X4RA 2HLAA 1OTTD 3MBEC 3ZZ1A 4L8BB 1FVEB 2DQUH 1S9XB 4KVNH 3RDTB 1PEZA 3REWA 2I60H 5DD0L 1FNEB 3N06B 5I1GH 2J6EH 1JCKA 4DTGH 3ZDXF 3MLZL 1OAYH 1CG9A 3HNSH 2BY0A 3CLFL 5GGUA 2CIKB 1ZS8A 3NTCL 3VWKB 5A43C 1GOGA 3NAAL 3UXFA 1K85A 1G7HA 2YBRA 2Q87A 5FUOL 3I6LD 2DI9A 1V05A 2BOBA 2B1AH 4WUKL 4ODTH 3VD9A 1HILB 3ULUD 5FYLH 4ALAH 4QYOA 4OCYH 1HEZB 5ID1B 4FFWC 4OCXL 4KK5C 1ZV5A 4H0HB 1NCWL 2PTUA 4CVZB 1EMTL 3QFJD 4F8QA 2WM0A 3HTLX 2D3VA 1UB5B 2ICEB 3JTTA 4NQEE 3NPSC 3DSNA 2C1OA 3C6SB 4KKCC 5CSBA 1UZ6F 5C0FB 3PV7A 3VXUE 3PGFL 4OM0L 2EIDA 3KPQB 1U92B 5F6IC 2P1YA 1VADB 4JFED 5DJZB 2ED7A 1XCTB 1C1EL 3MACL 5SWQB 5CEYB 2N4IA 3DROB 3EKCA 1EEZA 1U8LB 2BHYA 1TQBB 5AZEH 4LGSB 2W0FA 5KSBA 5JIHA 4D0DA 5T1KB 5AYUH 1RV6X 2R0WH 2P24B 1EVTC 4NJ9L 4KROC 1MLBA 3VGAC 4CAGA 3L3IB 3P2TA 5D1ZB 5F7EH 2G60L 1T7WA 4XVUC 4IRJC 4CMMA 4LRIA 4X7FC 5I66A 2YR3A 2Q7YB 5CILH 4R7NA 1H8NA 5TFSL 4GAYA 2DLFL 3GSWB 3HG1A 3QJHB 4GRWH 4ZUUA 5IB4B 3B83A 3IETB 3OKLB 1UXWA 1FG9C 3DX8A 3LN4B 5C9JB 4YHZH 2D4FA 4M00A 4R3SA 1MNUL 3MJGX 5DUML 3IJSB 1VGEL 4V1DE 1JHKH 3O3UN 2Z31B 2PW2B 3GJEB 3KR3L 4ZUWB 4TSCH 4DZBB 2W91A 4JRWA 3RVUC 3H0TA 3BXNA 2R4RH 3TBVB 5AUMB 3BFOA 4KPHH 3ZYOA 1RIUH 4PJHE 4GH7B 4F2MA 3L95A 2B5IC 1AI1H 1RHHB 1NPUA 2YPVH 1HSAB 1FAKT 3IU4L 3DRTB 3ZYIA 4QKXB 3SBWC 3KPPB 3HAEG 3K1DA 3OB8A 3STZA 1U42A 4MAUH 5D1QA 2XWTB 4I0PD 2FB4L 1KF9B 2NTFB 2YRLA 3WUWA 4G80B 6CGTA 5E0QA 4F58L 2NY4C 4XMPL 3W0WE 1A47A 4N5EA 4UAOB 3RY6C 1T3FB 4M9OA 2UV3A 4AENA 4ZNEA 3CU7A 5HD8D 4XMKH 3WUWG 4LSQH 3MXWL 4BH7B 4U1LB 4JJHA 4J23A 3HE6A 1TPXC 3LIZL 4IRZH 4E41B 4YXKH 5JHLH 5H94A 3CMOL 5DVKA 1AGDA 5DS8B 1IAOA 2VDPH 3PP3H 2ESVB 3LKPB 1XF2B 5HTSA 4YHPB 3EJZC 4F9PC 2QSCL 4LHUG 4KUCD 4PJGE 3SPVA 2X70B 2GCYB 4J8RA 4OUOA 1IGIL 3SCMD 4EIZC 2B0SH 1XH3B 5LGKA 3ES6A 4YXLH 1HXMA 4QHUB 3HE7A 3MRFA 4M7ZC 4JAMB 5F7KC 2GJJA 3KPLB 3VXSA 3TFKA 2HLFD 2F15A 2WWKT 2YC1B 3P4NA 2ADGB 5JA9A 4LEOB 3UMTA 5L2KA 4PV8B 2ZSWB 5D2NA 3MRKA 2V9QA 4OT1H 2NYYD 4GRLC 4Q2ZB 4WI4A 1B2WL 1RZIB 4RMRA 5GRWA 4G8IB 4U2ZA 3CPLB 3V2AR 4XPBL 5EOQL 3VXTA 2Q8BH 1CTOA 2P8MA 5C07A 5JPMB 1KLUB 1WQVT 2UZIL 3T1FB 2H26B 2F8VA 3G6JE 5FDWA 3MBXH 3QIWB 3ZE0E 2ID5A 1M1SA 4LNRB 5I16B 3GMLB 4JKPH 3M07A 3T0EA 3ZDYF 3L7EA 3QQ4B 1AGEB 1CS6A 4YC2B 3HCVA 4Z0XA 1FN4B 5FYJH 4DW2H 1J1PL 3LS4H 4H1LH 5KS9E 2X44D 3MRIB 3VWJC 4PJ5E 1C16A 4HWZB 4PJ9A 2NY6C 3EYSH 3BW9B 4DGVH 4LPUA 5FYKL 1R5IB 3MNWA 4UDTA 1BZQK 1FPTL 4NDMB 5IB3A 3NFSH 5I8OH 2JB6A 1JRHI 1NFDF 4KRPD 2VDOH 1TQCC 3MREB 3GSXA 1ADQA 4E0RB 1ORQB 1WCQA 5DVMA 2GSGB 4U31A 3B9KA 3FO9B 4ZPVB 2X4RB 2HLAB 3ARSA 4NM4H 3X14A 3MFGB 4ODSH 3SDAD 2BRQA 1I1FA 5GGVY 2FHFA 2DQCL 25C8L 3REWB 1NFDA 4XWOD 4U1IA 1CICC 2AJXH 4J4PD 5GQBA 3MLTA 3VXMD 4U1GB 3OHXA 1HWHB 3QEUA 1CG9B 4JO4L 1I85C 1P7QD 5A16A 1ZS8B 4KKAC 5HPMA 5E8NA 5I1KH 3RVVC 1NCAL 1A1NA 2X6MA 1G7HB 2MCPH 1P6FA 2YBRB 3ERYA 2W9EH 4HKJA 3G6DL 2BOBB 1BP3B 4JE4B 5EH1A 4HT1L 5MHSE 4QYOB 3MRJA 2G75A 3ZL4L 1MFNA 3TIDA 4OZIF 1SVCP 1JMZA 4FG6D 1MCWM 1CD0A 1NEUA 1RZKC 2DQUL 2WBJA 4KVNL 3B4NA 2I60L 2PKDA 2IPTH 3JTTB 3DUSA 5I75B 3CDGA 2C1OB 4FQHA 3L1OL 1HIMH 4DTGL 5FHAH 2ITCA 1OAYL 5IHLB 4LVHC 3HNSL 3FCTA 1OP9A 3QRFM 1YDPA 3MRRA 3GBML 1FL3A 4WO4A 1EEZB 2MMXA 3AM8A 1YN7A 2XTJB 1R5VA 5D7IE 3V6FA 3ARED 2W0FB 5KSBB 1U3ZA 4D0DB 4WI6A 2J8HA 5EIVA 4ODTL 3VFGH 4OIAA 1YNKH 3FQNA 3Q1SL 4ERSH 4OZFH 1ZSDA 4GRMA 2VLRA 1MLBB 3QEHA 4K3EH 4ODHH 1RAMA 4CVUA 3S35H 1I9JH 4HWBL 1NKOA 4CMMB 1MCIA 5I66B 5CLWA 1DL7H 1CF8H 4R7NB 3HG1B 4ZUUB 4AY0A 1UXWB 2IBBA 3DX8B 3WO4B 5GGTH 5FGSA 1G0XA 4QO1A 2FDBP 4R3SB 4MS8D 4D94A 3WLBA 3QCVH 2UUDK 1G7PA 5AZEL 1LO5A 1X4XA 1G0DA 3GI9L 5AYUL 3P73A 4BQ9A 1H8OA 3V6OE 3H0TB 2GTWA 3BXNB 1AP2A 3ARYA 4W68A 4F2MB 3LDBC 4KK9D 1T66C 5GGSA 3L95B 3MRHA 4NQEA 5J89A 3FQWA 3K8KA 2QADC 4HLZH 5CILL 4LMQE 3STZB 5SX4I 4ZXBD 3SGDH 3VXUA 1IFHH 5D1QB 5K9QI 1CLZH 5LJYH 1RUQH 5KSAA 3HFMH 3R1GH 4UTBH 3WUWB 4WI3A 4F7CA 3GSOA 5EZOL 4YHZL 3L3OA 4M7KL 2L7JA 2CUHA 3PWPD 3OB0H 2P46B 2HRLA 2FX7H 1EH9A 4AENB 2IAND 1JHKL 3W81A 4UV7L 1B4RA 4TSCL 4OV6F 2JK5A 2FECL 1A9BA 4KDVA 2Z8VC 2JIXA 3AB0C 2GITA 1RIUL 2A6JA 3HE6B 5DD1H 5H94B 2JKXA 4KZEH 1AI1L 1AGDB 1IAOB 4Y16A 2YPVL 3U7AA 4M3JA 1QLRA 4YBLC 4WFFD 3HUJA 3ORJA 4KDWA 1JNJA 4MAUL 5EBMA 5HDQH 3SPVB 3FO0L 1M4KA 4LPVA 4JRYD 4J8RB 5B3JE 5F6HI 4PJHF 4MYWB 2NY5H 3S98A 3ES6B 3T08A 4TNWK 1HXMB 4V1DA 3HE7B 3MRFB 5HYJE 1K2DA 1WFTA 2UZXB 3VXSB 3OJDA 2VKWA 1IE5A 1Q38A 5IJKA 3L6FA 4LSQL 1TZHA 1N5AA 4X9IA 3P4NB 3PDGA 2YD3A 1YYLL 1A6UH 4UI2A 5L88L 2DIAA 5L2KB 4IRZL 5D2NB 4FQ2H 1KV3A 4YXKL 3MRKB 1C12A 3OKOA 1A0QH 4HPYH 3FQRA 2R0ZH 4H20H 4H26A 4W81A 4APQA 2VLKD 2A77L 1S3KL 3WBDA 3WN5A 1G9NH 3VXTB 2P8MB 5C07B 1UC6A 5GISH 2DDQH 4KJPD 3VDCA 5FDWB 3MQIA 1YEDA 1RIHH 4YXLL 2EYTA 3WIIH 1C5BH 3CFJA 3GK8H 3T0EB 4YHOH 4EDXA 3L7EB 1FC1A 4Z7QE 3HCVB 4Z0XB 4MA8H 4PJGF 2XIDA 3FFCA 2DM3A 1NLBH 5KVFL 1S9WA 4CW1A 3DTXA 4UIMA 1CDGA 4KKNA 1C16B 1IL1A 4PJ9B 4OT1L 4TVPD 4YZFE 4XHJD 4X9BA 4KUZH 1QBMH 2DJ4A 2EXYC 4H88L 3LKOA 4QEGA 4Y4FA 3MNWB 3HI6H 4UDTB 3V95A 5IB3B 2ZCLL 4PJGA 2C5DC 4R97B 1MCBA 2JB6B 5CWSA 4LKCA 3PL6A 1F4YH 1OP5H 3MBXL 1P4LA 1RSFA 5H37G 2PYFA 3GSXB 4JKPL 4U7KA 4RWYH 3IF1A 1KUMA 3B9KB 3EHBC 2C26A 5DR5H 3O9WC 4JDTH 3X14B 1NGXA 1OTUD 5CFHA 1I1FB 1S7WA 3LS4L 2IJ0C 3TH3T 3G6JF 1NFDB 4N0RA 3ZDZE 4U1IB 3ZE0F 1U95A 3MLTB 1NCUA 1X3DA 3EYSL 1OHQA 5KTEH 3OHXB 3QEUB 3A6CH 4DGVL 2ZUQB 2UZYB 1SEBA 3B5HA 5CMAA 4MA7H 1NCBH 2XN9D 5A16B 5HPMB 1BFSA 4FMFA 5E8NB 3ZO0A 3NFSL 3QQ9C 4LSRL 5KS9F 4OLEA 4ZSOA 2IQ9H 3GKWH 5C09E 4RDQF 1A1NB 4LDOB 2VDOL 4HKJB 3LD8C 1Q0XH 2O5YH 1PGRB 3RL2A 3MRJB 4OLYH 1JJUA 2G75B 3TIDB 5JXAL 2EDXA 4M1CD 4NM4L 3T0DA 2WBJB 3KYAA 1M6OA 1ZLWK 5KS9A 1DEDA 2H32H 3E8UH 3Q5TA 2VJXA 3DUSB 1JNNH 3CDGB 2A1WL 2AJXL 4FQHB 3WKML 3IDUA 1ZT1A 2ITCB 4JG0L 2MKLC 2WK2A 3FCTB 3KPSA 1YDPB 3MRRB 5J1AA 2XKUA 5LGJA 4RDQG 1FL3B 4WO4B 3HMXL 1YN7B 1YA5A 4K23L 1R5VB 5E5UB 5LBSH 2CGRL 3V6FB 3CSYA 3C8DA 5JW4N 3QUXC 1UEMA 1XR9A 1UWGH 4N5ED 3FQNB 3MBED 5IVOA 1ZSDB 1YQ2A 2NY2D 3V4VL 2JJTC 4GRMB 2VLRB 3C08H 4F7MA 1GPOL 3QEHB 3UP1A 3MOAH 4Y19A 2OL3A 2ZCHH 1WV7T 4NP4H 3FHQA 4OQTH 3CAFA 3RVXC 3DVGA 4NOBA 4XNZB 3WDHA 1HIML 5FHAL 1HYRC 3V6ZA 4EOWH 2DF3A 5IWLC 3KDMA 5D71L 5EZLA 4D2NA 1CGSH 5EC1A 3RGVA 3C2SA 1EZVY 3ZHLA 3WLBB 3FN9A 1MAJA 1G7PB 4EBQH 1LO5B 5HYQA 4FFWD 3VFGL 3P73B 1NSNH 1DLFH 4JGUA 3MV8E 2GTWB 1AP2B 2EEBA 4ZUSA 2ATKA 1BJ1H 2F5AH 4JO3H 1J05A 3S35L 1I9JL 2NTSP 5AWNL 5GGSB 1YECH 4KKCD 3CFIC 3MRHB 4NQEB 3QDME 5D7IF 3FQWB 3IRPX 3SO3C 1QOKA 5A2KH 2AK1H 3WJJA 3VXUB 5KSAB 3JV6A 5LQBL 4F7CB 3GSOB 1I8LC 3L3OB 2YPKA 5IW1A 5C07D 3ULUH 2DQHL 4TOYL 1NANI 1OAQL 4KROD 2R1XA 3T0ED 2JK5B 5IIEA 4M6AA 4AZ8A 4TVSa 1A9BB 3JBG7 5HHPA 2JIXB 2GITB 2A6JB 4KKLC 4FQJH 5TE6L 1OQXA 1KCGC 2NLJA 4Y16B 4F37K 1BD2D 4UT9L 1P1ZA 5CS7A 3HUJB 1FO0L 5ADOL 4HJ0C 5EBMB 3O2DA 1CLZL 1RUQL 3HFML 4JFHD 3OWEA 4D9QE 3K4ZA 4ZO9A 1MRCH 3FL7A 4JR9H 4V1DB 2FX7L 4LSSH 2IMMA 1K2DB 3OJDB 1EAJA 3N1GC 4YWGH 3V4PH 5DFTA 3L6FB 4U6XA 1TZHB 3T77A 5LWYL 3B9KD 4CDGC 1UB6A 2F54E 2A6IA 2YUXA 4K7PY 5I9QB 2Z8RA 1CIUA 4M02A 5DD1L 1C12B 3RI5K 3NCMA 3OKOB 4XWGH 3UYRH 3FQRB 4WFED 1XF1A 1FVCA 4H26B 4FQCL 3VG9C 2BSRA 4APQB 1YZZA 3DVNA 3U0TA 5AEAA 3WN5B 3OG6B 2NY4D 1JI1A 1JGLL 5HDQL 4PBXA 1CK0H 4JO1H 2YD5A 4Y2DA 1BECA 4NWTH 3VXPA 4AIOA 1IAKA 1YEDB 1UFUA 2EYTB 3CFJB 4F15B 1T2QH 2LTQC 1NCDL 1TFHA 4QTIH 1KIPA 4KAQH 4EDXB 1S9VA 3QO0A 1KTDA 4HKBA 2FIKA 3RZCA 3WNOA 3FFCB 1U8OA 2EICA 1IC1A 1S9WB 5B3JF 4CW1B 5HSFA 1OD9A 4X7CC 1A6UL 2RHEA 3G5XB 3DTXB 1Y6NR 4UIMB 3QT2A 1IL1B 3I50H 1F42A 2R8SH 1A0QL 3SKUD 3EJZD 4HPYL 4TUOA 3WFEL 4H20L 1CGWA 2P5WE 3TO2A 3VXNA 2EDEA 4YXHH 1G6VK 1OSZA 3LKOB 4Y4FB 3F5WA 1FYHB 1G9NL 3QHFL 4PJGB 5CWSB 1DFBH 3EO1A 3PL6B 1E28A 2DDQL 1YMME 1DQQA 3FMGH 1P4LB 1C5BL 2PYFB 4YC2C 3GSNA 3GK8L 3IF1B 1I3GH 3D85D 5HI5C 2DI7A 3DGGA 3EYVA 1CFBA 1JFQL 2DQJH 2ZUXA 4MA8L 2J1KA 4EI5A 1S7WB 2ZG3A 4LAJH 2HVKA 2BOCA 2YMXH 3MLUH 2IPKA 1HWGB 4GRLD 4PREA 3RWJA 3PWUA 5GRXG 1U95B 4RMUA 3VD4A 2VUYA 3S3SA 1NUGA 3QWOA 1QBML 1SEBB 4Z7QF 5CMAB 1MFDH 5FK9A 4X5WA 1UH3A 3HMWH 3HI6L 3I3BA 3VFUA 1PSKH 4ZSOB 5SWZE 1CLOH 4EZMA 5JPNA 4YZFF 5CD3A 1YNTA 3RL2B 3T3PE 2EKJA 3FZUD 3WCYA 3BPOB 2WY3A 4RWYL 5DA4A 2DBLH 4JDTL 1KCUH 3NACH 3VWJD 5KS9B 4C56E 4U1GC 2F5BH 2WQ8A 4XVTL 1CD8A 1IAII 4F57H 3QUKA 1I7ZA 1ZT1B 5KTEL 4TQEL 2H2SC 3RWFA 2KH2B 2HTKC 4HG4J 5HDLA 3QDAA 1J1XH 1NCBL 3KPSB 4C57C 4RISH 2R39A 2YD2A 5J1AB 3GMOA 5LGJB 3WS3A 1LK3H 2IQ9L 3GKWL 1FFNA 1ZLSH 3V79C 3ZDZF 3CSYB 4JRXE 4I3RH 8FABA 3K2UH 1Q0XL 2O5YL 4JDVA 1AH1A 3BT2H 2DQEH 1XR9B 2NMSA 3SN6N 2FGWL 4OLYL 3L9RA 1WCBA 1II4E 1FFQA 1TCMA 4RFOH 3TLRA 4F7MB 5IJVA 2PXYD 3WJLA 3JUZA 4Y19B 4HLJA 1E0OB 1CICD 2ZUTA 2OL3B 4HWEH 2VXVH 4QNPE 4M62H 2DLTA 5JOEA 1J18A 3DVGB 3V6ZB 1GIGL 1JUFA 4KKAD 4YO0A 4I2XE 1K8DA 3RVVD 3KDMB 2DBJA 1UQSA 5D70H 3BIBX 2PUQT 5EC1B 1C5DA 3RGVB 5TQ0H 5HHNA 4K8RD 5C09A 5LBSL 4PGBA 5HYQB 1CL7L 5JOPE 5I1LB 3GSVA 3GIZH 4HUUA 1A4JA 1UWGL 4JZJC 4LVEA 1FE8L 5FHBH 5F9JA 3C08L 5GRJH 4ZUSB 1JVKA 2ATKB 4FQQA 5FV2A 1J05B 2MQCA 2IBZY 2EDFA 4NP4L 4G6AD 5AZ2H 3OGCA 5D7KE 4RX4D 2AV7A 4KHXH 1G9MH 1R0AH 3WO4C 2VERN 3SDCC 4EOWL 3VA2C 5A1AA 1MHCA 5JQ6H 3JV6B 3G5YA 5TDPA 4JB9L 1CGSL 2YPKB 5IW1B 2CDEA 4HW6A 5FA3A 5E99L 4ZDHA 3W0WD 5INCA 3H6JA 3TESA 4WCYL 4XTRD 3C60A 3MROA 2YD8A 3O4LE 3RQ3A 5I18L 4PB9H 3T2QA 2R1XB 1NSNL 1BQUA 2AK4D 4WEBL 5IIEB 4YNYA 4GW1A 3H3BC 5F97E 4KI5E 5HHPB 1QFWI 2F5AL 4JO3L 5DZNA 1JZ7A 3MLYL 1J88A 1YECL 2F74A 3BP5A 4G6MH 3UYPA 2NLJB 1EO7A 4P2QA 3EO0A 5D1QC 2PTTA 1P1ZB 4LCUA 3VG0L 2AK1L 4OTXH 1MJUL 4ZUTA 2W0LA 1LO3H 4OIBA 1D7FA 5I30L 3NBNA 4OB5L 2IFGA 5IROC 2X1QA 3WFDH 1AO7D 3NMEA 4Y1AE 3VMOA 4MB3A 1NUFA 2QQQA 2CKBL 1LE9A 1T80A 4U6XB 3T77B 1UB6B 2A6IB 3K4DA 5DFVC 4M7JL 2QADD 2BNRA 2VIRA 4WY7L 4V2CB 1JGEA 1NC4A 1FVCB 1G1CA 2BSRB 3DVNB 1HSBA 4MHHI 2E5EA 2ATPA 3U0TB 3P4OA 1EHNA 2BVTA 4XP6H 5C0RH 4Y2DB 2QBWA 1RZFH 3HE7C 3VXPB 4YUEH 1I8KA 1IAKB 2QSVA 5MERA 2X10A 2OK0H 2OZ4H 2GJ6E 4LSSL 5IVXE 1KIPB 5C0BA 3TFKC 5HYIA 2H1PH 1S9VB 3QO0B 4OFYD 1KTDB 4HKBB 2FIKB 1B0RA 4IDLA 4YWGL 4XB8A 3V4PL 4X5XA 3RZCB 4RGOL 3V8CA 5HVHC 1U8OB 5KG9A 4UUJA 4RGMC 4QRUA 4MVBD 4WU7A 2E9BA 5DD6A 4OQ1A 4HGMA 4M7LH 2K3TA 4TSAH 4TUOB 3CK0H 1QBAA 4PJ5D 3GBNH 3TO2B 2RCSH 4PG2A 3VXNB 1OSZB 2DQFA 3E6HA 4UT6L 3F5WB 5C0CA 1YNLH 1CK0L 5ITBH 4JO1L 1HNFA 5ITFA 3EO1B 5FCUH 1C5CH 1E28B 2DMKA 1DQQB 4PLKD 2D7NA 2IFFH 3WUZA 3GSNB 4QTIL 2MJWA 2VDRH 4Q9RH 4GSDH 3DGGB 3EYVB 4FMKA 2ARJQ 2W1NA 4EI5B 1T1XA 2HVKB 5DC9B 2AI0L 2BOCB 4S0SD 4PJ9C 2IPKB 4PREB 5D7LE 1W0VA 3RWJB 3PWUB 1PKQE 1AXSA 3I50L 2R8SL 5C0GA 1NGPH 1F4XH 2HG5A 3LZFL 3QWOB 2WP3T 4DVBA 5FK9B 1DVFA 4YXHL 1KEMH 2Q8AH 2MQ3A 3O45A 3VFUB 1DFBL 1IQWH 3LEYH