1KJMA

Tap-a-associated rat mhc class i molecule
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
277
structure length
277
Chain Sequence
GSHSLRYFYTAVSRPGLGEPRFIAVGYVDDTEFVRFDSDAENPRMEPRARWMEREGPEYWEQQTRIAKEWEQIYRVDLRTLRGYYNQSEGGSHTIQEMYGCDVGSDGSLLRGYRQDAYDGRDYIALNEDLKTWTAADFAAQITRNKWERARYAERLRAYLEGTCVEWLSRYLELGKETLLRSDPPEAHVTLHPRPEGDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVEHEGLPKPLSQRWEPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of two rat MHC class Ia (RT1-A) molecules that are associated differentially with peptide transporter alleles TAP-A and TAP-B.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Immune system
molecule keywords RT1 class I histocompatibility antigen, AA alpha chain, heav
total genus 66
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2001-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kjmA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1kjmA01
3IDNA 1NDGB 2A74A 2F5BH 1DQDL 2DIAA 4O58L 5GRWA 2I9TB 3KLHC 1KJVA 3OR7B 1BZ9A 4N8PA 2R69H 4JDZA 3HI6L 1OGAE 4RFEA 1A0QL 5DS8A 3R4DA 4RISH 5E56A 3QUYA 2BVQA 3MOBH 5E4IA 5F9OL 1P7HL 4ONGL 4MHHI 5GS0H 3C2SA 2VZ3A 4G6AD 3SJVD 1NSNH 3WN5B 1JTTA 5DJXA 4GG6E 4M8QA 2W0KA 3BKYH 1IC7H 5C0AE 2FX8L 4S0TD 4RQQA 3K74B 4N0RA 4PJEF 2VERN 4J3VA 4LAJH 3P4NA 5E9DE 3PL6C 5FYKH 1UEMA 5HHMB 3ECBA 3F6LA 3L9RB 3NH7L 3DYPA 2FGWH 1AGDB 4PIRF 2IAND 1ZA3B 1KF9B 4JM2B 4CVWA 4N0CA 2HFFA 1KIRB 1S7SA 4PRHA 3SGDI 1BIIA 5D7LD 2ICWB 5GGRB 4AT6B 3DROA 3MLUL 3QQ4A 4QTIH 1XF1A 4AL8L 1RZ8B 4PJ7B 2X4NB 5T1KD 2H1PL 3UCRA 1LDPL 3RI5K 1FFPA 3H9SB 3D39D 3HNTL 2ZP0T 4UDUA 2PO6B 1I7UA 1MCRA 4N0UB 4EUPA 5AYUH 3R0MA 2AK4B 3REWA 3IKCB 3TT1H 5EO9B 4OFYA 2IALB 3Q6FA 4PLJC 3RTQA 2Z8RA 3LKPA 1P4LA 3HZKA 1CXKA 1J0HA 1OW0A 1I7ZB 4NQCD 5DC9B 2YSSB 4NCC1 4ZPVB 4PJEA 4QHKI 4TYUA 3PGCB 1AIFA 2Y4SA 3H8NA 1BVLB 5INCB 1QEWA 4E0RB 2V2TA 1JIBA 3SJVA 1BREA 2Y36H 4YHOH 3QEHA 4K7PL 3QIUD 4XBEH 5JHDA 1NH6A 3X3FL 4JVUA 4OZFB 1M4KA 4K9EC 4WUUE 1NLBH 2YXMA 5FOBA 4KZDL 4GW1B 3ZSSA 1SYSB 3OXRA 1AFVH 5TJWK 4F7CB 5DSCB 2A9ML 1SJHA 2XACC 4YR6B 5FYKD 3MLWH 4ZOAA 1WTGT 3L3OB 3DHMA 1JE6A 4Q0XL 2ZOLB 3RHWK 4LLMB 2F54E 1GGBH 2MWCA 4JJ5B 3KPLB 2VXQH 4ODHH 5T33H 4MD0A 2AK4D 4GAGH 2X9WA 2NX5E 1H3PH 1HH9A 4U1MA 1MCPL 3QI9A 4X7SH 1AXIB 1YMHB 5JORB 1W72B 4ODXA 3BKJL 3THMH 1I9JH 4WI8A 4E5XA 1KEGL 1QFHA 5DMIL 1QSFE 4UTAL 3FB7B 5GHWH 2OI9C 2VDKL 1DDHB 4GBXA 4NN7C 5KOMC 1LEKA 1FL6A 2W9EH 4HS3A 5D1XD 3O3BB 2J12B 3I3DA 1Z3GL 3QG7H 1T7VA 3W5MA 3QFJB 2EC9U 4MHHG 3EDFA 4U1NB 3LD8C 4U1LB 2IH3A 3P9MA 3QRGL 5KN5A 3GSXA 5L2KD 1MRCL 4PTTA 4BH7A 5D7KD 4N1EA 1XZ0B 4LCUA 4QHLB 4F7EB 1MAKA 2FWOA 4UAOC 5DK2B 1BBDL 1T3FA 3V5HA 1JGEA 4JVPA 3C5SB 2ED7A 3CU1A 4NRYA 1HHHA 3VFPA 4M1GL 1UQSA 3VCLB 1FYTE 5JQHC 4AJ0A 4NFDA 4KJWD 3FT2B 4AEIL 3UBXI 5E2TL 4AQOA 4YAQB 1QSEB 4JKPH 3W5NA 3DBXB 1C5DA 3VWKC 4DCQA 2B4CH 2VLRB 2XOTA 2BVTA 1J0IA 1ZLVH 4DKDC 1UM4H 2X10A 4M61A 3O6FB 2PN5A 3GM0A 5CUSL 3EFFB 3K1KC 4HGKC 1IILE 1NGYB 1EMTH 3RVWD 3FT3A 2VDQL 3RAJL 3G5ZA 4LCWE 4F8TA 1ZMYA 3MRQB 1QRNB 1QLFA 4PJHB 2DWDB 4ZFFA 5IB4B 3VRJA 3ARZA 1XGUB 1SEQL 3MRCA 4NRZB 4JFDA 1YQVL 5KSBA 5KVEH 5KAQG 1CE6B 3EYVB 4RIRB 4AM0A 3LKSA 4UILH 1KELH 4GS7B 3HZYA 5IHBA 5J6GA 2DLHA 3CDGA 4OZHF 1MCJA 4WW2B 4XPFH 4QRSB 3U36B 2ZSWB 4WDIA 2EEAA 5DGQA 4HC1A 4D9RE 2EH8L 2HP4A 2Q8BL 3BT2L 4DFHA 3A6BH 2R4SL 3U0TB 5TDNB 2I9TA 4IHOA 3L3IA 4MJIE 3MRBA 3V7MA 4GXVL 4LLYA 2O61B 1SJXA 2ZUTA 1UKTA 3OXSB 4L4VD 1PG7L 4WI5A 4FTVE 1FZMA 4MS8C 2FX9H 1E4KA 3VXOB 3Q6FB 2GSGB 2C3WA 3IU4H 3LEVH 3D5OF 1A6TA 2GTZA 5DJXB 2PUQT 2HTLD 3GKWH 5D7KE 1OARL 3VFMB 1EHXA 5CAYB 4P5TB 3MX0A 1S7UB 5E6IC 3ULVE 1FPTL 4M93B 1RUKH 2O26U 2I9LA 1FG2A 2D0FA 1H3PL 1WT5A 4S0SD 5AAMA 4WTXA 4MJIA 4LASL 9CGTA 1KXTB 1IGMH 4JRYD 2UY6A 4MXWH 4NIKB 2W1NA 3ES6A 2COQA 3N0PB 1F90L 3L7FA 1H8NA 5EU5A 4EUPH 2ENSA 4U1SB 1HCVA 2P5EA 4JGMA 4KTDH 5B21A 1QFUL 2P8LB 3RY5A 3S4SG 3HC0A 3JWOL 5LQBH 1WBYB 3L5JA 2J2ZA 3FAXA 4F7MB 3D3VA 3VG0L 3ULVD 3EO1B 1FYHB 2YKLH 3KWWB 1NGPH 1OW0C 4Z7UF 5I2IB 3BH9A 4G8IA 1K8DA 5C07A 4OM0L 5FYLD 3SKMA 1R5IB 2AK4E 4G6KH 4L4VE 5GRJL 1G6RH 4KMTH 1FNFA 3SDAD 3VG9B 4XTRD 5E6YA 3HZMB 4P2OB 1MWAB 5FA3B 3SE4A 1SY6A 2D0HA 3G6DL 4H0HB 1BOYA 2YN5A 1T21B 2BNRB 4FNLH 2AKRB 4ONHA 1A7OL 3PV7A 3QIWC 2XZCH 2NYYC 3QEGH 4HKJA 4LQFH 5E95B 1ZS8B 5BV7H 4X99B 4O5LH 4X7CC 2C1PB 2GITA 3SKJL 4NWTH 3HNTH 1TZGH 1MELA 2GFBA 3CCHA 4RGNE 2X1WL 5IF0B 2WZPD 3ZE0E 2BNQB 4GAGL 5DLML 5I8OL 1IAII 1KLUB 2R1WB 2R2EA 3BKMH 5FCUH 6FABL 1TDQA 2ARJB 4M1CD 5CBEB 4JFFD 3HMXH 1AQKH 4MA3A 4UDUB 2APWA 3SCMB 4LL9A 3G9AB 5IB3A 3PGFH 2NXZB 1KPVA 3SDAB 4QXUL 1I7TA 1KLFA 2HVJA 1CU4L 4FQLH 2M8XA 4M7LL 2NY0D 1EUTA 3LPWA 4P5TC 2JJUA 3TH3T 4EIGB 2A77H 5JW4M 1MJJB 2NYYD 5GGSY 1EVUA 2WNGA 5CJXC 3AY4A 1RU9L 3T1FB 3WJLA 1T0NA 2HTLC 1ES0B 1T7XA 1UVQA 2R23B 1RZ7H 3RL1B 5TFSH 4S1DD 1A3LL 4U7KA 4ZQKA 1VSCA 3U0WL 2PKDA 1NFDE 4ELKA 3ARWA 2X5PA 4C59B 4X98A 3P9LA 1JHKL 4EJ1C 5I19L 4O2CB 1F3JB 1F97A 4JRYB 4HXAH 4KRLB 3BE1H 4ELME 2EIZB 4WW1B 5D71L 2J5LC 4J8RB 1WITA 4H1LH 4NPYB 1D5XA 4P2OC 4DUVA 4KVNH 3RWFA 3GSQA 4X6EA 2EDWA 2C4XA 2DI7A 2BC4A 2GK0B 4EI5B 2N56A 4NUGL 4ZFGH 5CEZD 1A6WL 3GGWB 4LGRB 2KH2B 4RFEB 1F90H 1I3RB 4WO4B 1CFQB 4LP4A 2GKIA 4XZUB 3TIEA 4X80L 1NLDL 2ZPKH 3BP7A 3FN0H 1IC5H 2YPKA 1GC1H 5IVXF 2NXYD 4HIIB 3HZKB 3HN3A 3U1SL 3WFHA 2BNUB 2V7HB 3ARYA 2E8YA 3QDGE 5E7FA 1T1YA 4IRJA 5K9KB 3MRLA 1IAMA 3RFZC 2BHYA 1ZHBA 1YEFH 2VN4A 5KG9B 4MAUH 5HTSA 3TN0D 4F7EA 4YDVB 3P9WB 3QULA 2R69L 2F53E 5ESQB 2EIDA 3SCMC 4AIZA 4GW1A 5HVFB 1MCKA 3LN4A 2F58H 2FZ3A 2NY2B 4AT6A 3O41B 1TMCA 5EPMB 1CDBA 1CFNB 3AC0A 3DJ9A 3IXAA 3PXJA 2GCYB 2FBJH 3DUUB 5DUBB 5ID0A 3V7AG 2GUOB 3JV6B 1YEEH 4IRJD 4WI2A 1NCUA 1TITA 3TFKC 4A6YH 5ESAB 2V9RA 3AMKA 4YC2C 3Q2CA 3KPSE 2XZQH 4NRXA 3PQYB 3EJJX 5K33A 2PO6D 3QCUL 3VH8A 1EFQA 3MRKA 4K3JL 3VFOB 4PJIB 1KJ2B 3G5YB 3FQTA 4MAYA 2ZCHH 4L4VB 5F96L 1YUHA 1T7ZA 5JZ7C 1MI5E 5KW9H 1FFQA 4M7JL 1VGKA 2XPGA 2NCMA 4YBLB 3MV9D 4P4KC 3E6HA 3WO4C 4AEEA 2IANE 2PTUA 1D5ZA 2QKIB 3IDNB 4U1NA 3MRHB 5EFIB 1NPUA 5HGBA 4R7NB 2VLLA 3HC0B 1IARB 3RWCB 3HUJB 5IW1B 1PX4A 4Y5VB 2HVKA 3SGEI 5KZCD 4U1JB 1RK1B 4K07A 4NUGH 5C0AD 3EDKA 2G5BB 1ZVSA 3NPSB 1NUFA 4APQB 2AK1H 3FRPA 3MC0A 1UQSB 5I74B 3RWDA 4MJ5B 5DQJA 5AWNL 3VA6A 4ZUUB 4GRWF 4WY7H 4TSCH 4N9GA 2ILLA 4ZFOA 3RGHA 4LAQL 3VGBA 4YHOL 1JHKH 5CS7A 3RY4A 1CXFA 1MWAA 3LD8B 5E8OB 5FA3A 5BV7L 4LQ1A 4ZXBD 3MRIB 2YBRA 3C6LD 4QWWC 4F9LC 2KPNA 1CQYA 5DA0B 4ZAKB 4OLXL 1NANH 4PJCF 4Z7WF 2P24B 4HWZB 2Y7QA 1A6VH 1DZBA 4BQBA 1BFOA 4O2FB 4P3CL 5GGRA 3TYFB 3MOQA 1TQBC 4MJIB 4NN6C 3BD4A 1CD9B 2YUVA 5C0NC 3WKML 3HNSH 3X3GH 4JGUA 4LCYB 4PJIE 3S34L 1EEQA 1YDPA 3KPRE 3LH2L 4TUJB 3MYZA 1PVHA 1RULL 4V1DB 1IVLA 5EC2B 3B9AA 3W0WE 3IFOB 2QQNL 2HKFH 3PQYE 2HKHH 2XTJC 1FNSL 3KPSB 3LB6D 3BZ4A 4PG2A 1WEJH 3LQAC 2VJXA 3PWUA 4XHQA 3TVMA 2IMNA 3JTCA 2BY3A 4XMKL 3QEQA 4P59H 1ZGLA 3GSQB 4OGYL 4PJAE 1J8KA 5E00B 3BEWB 1OSPH 4KUCF 1TPXC 4QGYA 1RK0A 5C0AA 4R4FH 4EQ2A 2Q1EA 4LCIL 4PLKD 3PHOB 5I71C 3U0PA 3NMEA 1JF1A 3TFKD 1Q0YL 1UACH 1KT2A 4UBDD 1OY3B 4I48A 2X1XR 3KPOB 3QT2A 3DVGB 3EYSL 1MVUA 1CD8A 4HKJB 3BJ91 1FFNA 2Y07H 4HKZA 1IL1B 1G9MH 3T77A 3SDCB 1S7SB 4QXGL 5C0JA 3HMWL 3E8UH 1QKZH 1T22A 2IFGA 2DIBA 3FB5B 2FR4A 2F5BL 3GSRA 2FSEA 4C56E 3RIAK 2R4SH 3HZYB 3W39B 3TT3H 1NBZA 4MLIA 4XCEB 5D7JC 4BK5A 3EAKA 4MDJB 3C5ZC 1KJ2H 4DN3H 2OZ4L 5BW7C 3ET9F 1J11A 1J1OH 3HFMH 2EE6A 4DN4H 4I9WE 1OQOA 1ED3A 4MXQC 1NC4A 3RA7H 5IESL 3OKDB 3OKNA 1QRNA 2FHCA 3ZDYF 2N7AA 4PV8B 1FJ1B 2A6KA 2UUDH 4U2YA 3CFCH 4XRCB 3D69B 4RA0C 1RY7B 4WFGD 1IGYB 1I1AA 3O6KH 4KC3B 1JMXA 5FDWA 3SBWC 4P99A 1AGEB 3WKNA 4G80B 1F3RB 4MDIA 3VFRA 4YHZL 1UB5B 3QUZC 3JWDC 4JO1H 4PRBA 4LVNC 5F70A 3DETD 3P40A 3BP4A 5DQ9A 3T2NH 3D0LA 1XH3B 3MTRA 1HXYB 1Y0LB 3GIZH 1B6UA 1T3FB 3FQTB 4UV4H 1IM3B 3PWPB 4YE4H 5E8EB 3SDXF 1SYSA 4P46A 1KTLA 5GS0L 4HK0A 2VXSH 2FJFB 3C08H 4JM2C 4OGXH 4YBLC 5JPMB 1MJUL 3KLHD 4MQXC 2VLLB 4XVJL 2GFBB 1TIUA 3CCHB 1NKRA 5IFHH 4OKVA 2DQTL 1OAZH 4ZMAT 3O9WD 1JTOA 2VLKE 5E24E 1I3GH 3VWJD 1KB9K 2ZCLL 3JWNC 2ENYA 4JGJA 5D6DC 1A7QL 4JZNA 4Y5VC 3OKKA 3T0AA 3GGWA 3SQBA 3NIFE 3U1SH 5CIPH 5C0GB 5T1MB 5B39G 3QDJE 1J0KA 5I8CA 1LO0L 4R97C 1U8IA 4LKCB 1Q9KA 3MRNA 2KKQA 2BNQE 2IQAB 3K7UA 1L8JA 4JFDB 5KSBB 3QXAA 2R4RL 1RMFH 3LY6A 3D25A 3VH8B 2V2WB 4PJBE 1PGRB 4HFUH 2DBJA 1VESA 4RFOL 1AY1L 3RPKA 3T4AB 5FUOH 3SPVB 4HWEH 1MI5B 5E8PA 4OLVL 3FO2B 2AJZB 4HQQH 4NYLA 1UYWH 2H41A 3C5JB 4KK8D 3QHTC 3EO1A 2RR3A 3L3OA 3JWDH 4LVEA 4G3YL 3OB0K 5I1DB 5C0RH 1NMBL 5SWZE 3V9FA 1F4YH 5I2IA 3RWIB 3PP4H 2VZUA 1OP3K 1KJ3H 2YK1L 4D9RD 4LPXA 2JKXA 3IDJB 2F53A 1SBSH 5I1CL 4ZODA 4PPTA 1JHLL 5AEAA 5HGAB 2YPLE 3RI5F 3VXSE 1X5XA 3MLWL 2LABA 3T0EE 1T0MA 5M7QA 1D5XB 4XPBH 1AQDA 1ZANH 1KPVB 2VMFA 4OV5A 5M94B 4KMTL 4LFHG 1QO3B 1CLOH 1P84J 4R2GC 1B2WL 1MCNA 4TUKL 1RFDH 3H42L 1B3JA 4NHUA 4D9QD 4OZ4B 1BVKB 1MNUL 1YPZE 4AIXA 2ZUQB 2VZ1A 3RBGA 2MCPL 3NOIA 2VLJA 1S78C 4OZGA 1LP9F 4AQ1B 1NL0H 1X5IA 3GI8H 1CDUA 2L7JA 5FOBB 4DK3A 2CMRL 5C0FA 1ES0A 3HI1A 3RVVC 4NJ9H 2IPKB 3QZWA 2OI9A 5TGBB 4XMKH 4ZUVA 2LVCA 4QHMB 4D3CH 5DHVB 4XXCA 1M7DA 5CP7B 1F3DJ 3MRHA 5EFIA 2EC8A 3UBXG 4TUJA 5MI0C 4IMLB 3MJ7A 1WZMA 3AU1A 4GOSA 4YXKH 5D1ZB 5TPWH 2CDFB 3VXMD 1TCRB 1ZWIB 4FTVB 5SX4H 3NVQA 3VRLE 3KXFE 1R3JA 4HDIB 1KGCD 4DAGL 3W2DL 4QCIA 3AMLA 1HYSC 3TIDA 5A1AA 2Q3AA 2GTWA 2OK0L 1O5DT 3N9GL 5EU6D 1OGTB 3MACH 4G7YL 5DVKA 5I1LA 3SOBH 2B7DT 1AD0A 4EZMA 1W2KT 1GZQB 4ELMB 3ULVH 1OM3L 2P48B 1K3IA 3WLBA 5JW4R 3VXQA 3F7VB 3MOAL 1LDSA 1XGTA 4S1QH 4EDWH 3BD5A 4N1CA 3VXNA 1YMME 3E3QA 2OBGA 3ARPA 4YHLL 1IAIH 4HCRL 4LEOA 4YHML 1BMGA 2WIIA 3K3QA 3RVUD 4M4RA 1A7QH 4WI6A 5I15L 4Y4HB 5MENE 1DQML 4DTGL 4PJIA 5CD5D 3RIAF 2NTFB 5CEZL 1DVFD 2EYSB 3DGCR 4Y1AB 4UMGA 5DK3A 3DMMD 5F72S 3QI9C 2NLJA 5KG9A 3ZYOA 3LKRA 1IGCH 1NGQH 2R0WL 1OHQA 1JWMA 3KPRA 1JNHA 3W39A 3MV11 4GG6F 3T65B 3S3JA 4MQ7B 3UEZA 5CBAA 1MUJA 2ICWJ 3VG9C 5DHYA 4G8FA 3MBXH 1LO0H 3HE7B 2KDGA 4YX2H 3WFCH 1AD9B 2CDGA 2G9HA 4HMEA 4PJDB 1IC5L 3CJJA 1KTKE 1VPOL 1O7VA 1F3DH 3DUUA 2D7MA 5DURB 4QRQA 4NO2B 1RSFA 2NY2D 4JFHE 5KJRH 2DOCA 4XCCL 2NY3B 1G7QB 4ZNEE 5CKAA 4MB4A 2NTSP 4ERSL 5I1AB 2P45B 3B9KC 4M43H 2RIKA 1T1WB 1KG0B 1NCCL 1Y0LA 1CZ8H 4GRMB 2P5WD 4IS6A 4AIZB 5EC1A 2X4OB 5BV7C 2R9HC 3TCXA 3PQYD 4XPGH 1P53A 1WIUA 2WUBH 3L5IA 1H8OA 2NX5A 1M7XA 5CP3H 4NQDA 3DIFB 4LHUG 2XWTA 1FVCB 4LSSL 4TQEL 2LE9A 1DL7L 4XWOC 3HC4L 2UWEF 1A3LH 1A6PA 2B0SL 1MJUH 5LWYL 4NQCA 1N2RA 1R5IA 4ZTOH 1DLHB 1DBJH 3V8CA 1JMZA 4NQDE 1C08B 3STZB 1JNJA 4JO2L 3SO3C 4LF3A 2Z31A 4YZFF 5HYEA 7CGTA 1KNOA 3C8KB 4L8BA 3NCJH 1NBVL 5BZWB 1EZVX 3VFMA 4NM4L 1QSZA 4OD1H 2XFXB 5I30L 2JIXA 5EORH 2VIRA 4OCXL 1HQRA 4XXDB 1H3WM 2P43B 4OLYL 5E8OA 7FABL 5C0CD 1EVTC 5C6TL 5DMKA 3WHE1 3RIFK 1UVQB 2R23A 3BSZH 1JF5A 3IU3A 5EZLB 4ODSL 1PQZA 3FOLA 3SJVE 3CUPB 2ADFL 3EYUH 4XC1L 3KPMB 3QG6A 3B9KD 3PABA 2NY6C 1TVBB 1R3LA 3KPQB 5KANI 3ORJA 4IRSC 5FYJD 3T8XB 4OQ1A 1DVFB 2W38A 4D0DB 3F5WA 4RWHA 3U46B 4NWTL 3IGAA 3CIQA 1I1CA 4O2EA 2DLTA 5EC2A 1YJDC 2RGSA 2VZTA 1AE6L 2VDOL 3DVNA 5DJYA 4K7PY 2ESVD 1I7TB 1DEEB 1OVZA 4NN7B 4XP4L 5T1LD 2CKBL 3OB8A 5JA9A 3LKQB 3RL2B 4OLZH 3RU8H 4X6FB 5FYJU 2W07A 1GZPB 3ALPA 4HIXH 5DZLA 5I75C 2WUCH 4PJ5A 3WIIL 1Z5LB 2O93L 35C8H 1FZJB 5B38G 1RU9H 2EDNA 4OGYH 3KPSD 2AERT 5HGHB 5HPOA 4BSJA 5DI8B 4Q6IA 4H8WH 4PJ8D 4JHWH 2XKNB 4R3SB 4V1DD 4YUEL 4R2GD 3G6JE 5I73B 4Q6YA 1WBXA 4W4OC 3GKZA 4OM0H 1D6EB 4R4BB 5AYQA 2J1KA 4K71B 2EE3A 4KU1A 3WFEH 4R7DB 3DV6B 4ELKB 1UJ3C 4XPHH 4Y5VA 4QNPF 1KCKA 1XEDA 4LCCC 1FIGL 2ORBH 1MLBA 4ZUVB 5IGXL 4BFBD 2Y06H 3KHQA 2F53D 3QUZB 1OPGL 2MQCA 2HAZA 1INEL 3LN4B 1ORQB 1WAAF 5FYKL 5C7XH 3TA3D 3UJIL 1W8OA 5KVDL 4PYHA 1KB9J 4D0BA 3ZKNC 4GAJH 2HVJB 5I18H 1IGJB 3E2HA 2VXUL 1G7IB 3SDCD 3UO1H 5F7DB 2XQYK 3GB7A 3TVMC 1H5BC 2GJZA 3PL6B 3QUXC 2OSLA 1BFVL 4FP8L 5ABDE 2X4UA 5DJDA 1AGFA 3RNQA 1F8TL 1BD2E 4HUMB 5J6HA 1MQKH 2GJ6A 3C2AH 4EI6B 1CDJA 3WD5H 1XGPB 2Q3ZA 5TF1L 5C0GA 3U9UA 4CVXB 4GS7C 1S3KH 1N8ZB 3ZE2E 3GMMB 3O3AA 3NBNA 1A7NH 3UTPE 4OZIE 4Q7DA 4UV7L 2C3VB 2CGRH 3Q5YA 1W0VA 1A5FH 2D7OA 4JZJC 5F7LB 1AGDA 3MLXL 3C87A 3MBEB 1UYWL 2J88L 5JTWA 1LE9A 4UOW1 2HA1A 2BDNH 4X9FA 5AUMB 5KS9B 2KQMA 2FD6H 2W0FB 4XCNB 5C0CE 1NCDH 1A14L 1LK3H 4H1LG 1TQCC 1RUML 5GRYA 3V2AR 5DJ2A 5D1QB 3V5KB 4Y4HD 1JPGA 1OT2A 4WFFD 3GI9H 5LAXB 2Q20A 4YO0B 2ZUSA 1U91B 4PRDA 5DWUL 1CBVL 5C6TH 1I7UB 4HLJA 3MNWB 2VL4A 4MXWL 1AR1D 3CLFL 3NZHH 3VXME 3AM8C 2ESVB 3BESR 1G0YR 1ZLSL 3MV7D 4NRXB 4FG6D 2X89A 4Z7UA 3JWOC 4I3GA 1KN4L 4XP6H 5J9PA 4NNYB 2N7BA 4K23L 1CGYA 5DEFA 1JPSL 1Z9MA 2ICES 3UTQA 1B4RA 1INQB 3CVIL 4CADA 1VGKB 5AG8A 3AB0C 5E2TH 1E4WL 1QYGL 2OR7A 5MHSD 2OZ4A 4NDMB 1FG9C 1JCKA 5JOFA 2FHBA 5ID1A 4I77H 5CFHA 1UZ8A 3FONB 1G7MA 2APXA 3MLTB 5LBSL 2ITDA 3SHSA 1L6ZA 3EYQC 3EGSA 4JO3H 3MLVH 3MUJA 1ZLSH 1TETL 5TDOA 3DOSA 4RNRA 3BQUB 1C7TA 4AH2B 4JJHA 1FFPB 1QQDB 1AI1H 4IOIA 4J6RH 4RFNB 2NNAA 4KI5C 2PTTA 2DQUH 1Z3GH 2H8PA 3QG7L 1JVKA 3LQMA 3ZHLA 4NFBA 3D69A 4XCCH 1U8KB 3OKLA 4FQ2L 1SMAA 5F1IA 5C71A 5D7IA 3AY4C 3NGBC 4G43A 4PJ7E 5FECB 1FH5L 1RZJC 1UEYA 1K2DA 2VWEC 1UG9A 2V7NA 1DBKL 3GSUB 3FFDA 4PJGE 4QT5A 2WMPA 3CLEH 5ALBL 4OIAA 4X80H 3ME0A 4Y2DA 2FJGA 2DD8L 4P4RB 2IWGA 1U8NB 2VQTA 1RIUL 1B0GA 5E1AB 4NT6A 3IYLW 3MA9L 4LSVL 1MVFA 5GGVL 1MFBH 5FA4B 1LO2H 1VKXA 1EH9A 1QBLH 4AEIH 2OR8A 5I9QC 3MYJB 4NO0D 4JFDE 5KSBE 3S4SB 3IFOA 3LB6C 4C83A 4PTTB 4BH7B 2EDYA 2GK2A 3ULSA 4J3UA 3QBTB 2AJYH 4OZHB 1TJHH 4WW2F 2BFVH 1MCWW 1QTYT 4JO4L 3VFVA 3OAYK 2IGFL 2YMXH 1P9MC 3VD9A 1GHFH 1T5XB 4J3TA 2Q76A 3PV6B 5K59E 3P2TA 4DCQB 4JY5H 3FHAA 4Z7VB 2HFGL 3STZA 3KNBA 4R8WL 5H94B 1TJIH 4M61B 3P30H 3V4PL 1BF8A 5ADOL 3C6LB 1FZOA 3DURB 3LS5H 3MCG1 5E2WH 4E9LA 1MWAL 1A1MA 3NAAL 5IVZA 4JFFA 5B38A 2FX7L 1U8LA 3R8BB 3BH8B 3KYNB 5FGSA 2CKBB 3DX6B 1CLZL 5FB8A 3O2VL 4ELMF 4PTUA 2DWDA 1CE1L 3BP6A 1A3RL 1U8MA 4U7MA 4ZNCD 1TTFA 3BQUC 5EOTB 1MIMH 1OSZB 2AJXH 1OAXL 3GMNB 3QH3A 5BCAA 1JWSA 1ZE3C 2F8OA 1CU4H 3RJDA 3STBA 4JEGB 4XVTH 4MNGA 3WNKA 1Q94B 1JRHI 4YFEA 3SDDC 1LE9B 4K7FB 4PRHB 1RJZB 3SEPA 2C1OB 5IGXH 4X6CB 3H9YA 4PP2B 4I9WD 3LIZL 3C60D 4F2MA 2GQHA 2R2BA 3FT2A 1XF5B 1ACYH 4UQ3A 3WBDA 4PJXB 1T7WA 3VFSA 3ZKND 5HHOE 2RQ8A 1G7IA 3B6SB 3HE6B 1TNNA 3DO3A 5CMAA 3FN9A 3QNZA 5E2JA 1WF5A 2O61A 1FNEB 5DVLA 1MRFL 5JQ6H 5DD0H 3WJLC 4PJ8A 1GYAA 2BCKB 5HPMA 2VSCA 4G80A 3W9EB 3A67L 1IL1A 3H2WA 3WDJA 4FQIH 3BZFB 3I50L 2C3VA 3ARBA 4ETYA 1AP2B 1DQQA 1XF2B 4UT7H 4GO6B 3GBML 2J8HA 3OKEA 1EV2E 3W82A 1LP9A 3W9DB 2JB6B 1PQZB 2GJ6D 3JWDL 5T1DL 4XPFL 5DXWA 4X9IA 3WE6B 3D2UB 4Z18A 2GEEA 3ILQD 4F3FB 4QRPB 2OS7A 5FUZH 4DUXA 4ZSOA 3DRQB 2MOVA 2QADD 5L2KE 2BNQD 1OGTA 2MKLC 3UAJC 1NAML 1II4E 1S9WA 2E6JA 2X4RA 4GQPH 2ATPA 1EEYB 1IGFH 5F44A 3FB6A 4TVPH 2VN7A 4PGBA 2IJ0C 1OAYL 1CYGA 3H3KA 1KC5H 2WUCL 4WWKD 5EO1B 3DTXA 3DXAA 1MREL 2AK4A 3REWB 4HIJA 1FC2D 3RL2A 1LMKA 2GSGA 4OD1L 3ALXA 4M00A 3W0WB 3HZVB 2AEPL 3OGCA 1RJLA 3HAEA 1Z5LA 4OFKA 1A21A 2DKMA 3IKKA 3SKNB 4K9EL 4JFYB 3KAAA 4DW2L 3ZLQC 4IEFB 3ARBC 3B5GA 3VI4E 5LBSH 3WIHH 1E28A 5IB1B 2FH8A 1X5KA 2QR0A 2OM5A 5CZXD 5F1SA 1GOFA 4JKPL 3V0WH 4FS0A 5DRWB 4NHCL 1T2XA 3DVIA 4OGZA 3T1WA 1XCQB 2SEBB 1A1NA 3Q3GB 4MA8H 4G5ZL 4XPTH 4X9HA 2IFFL 2IH3B 4M03A 1DUYA 2ZSVB 1KIPA 3QFDB 4H5SB 1QNZL 2I27N 1JUFA 4Y4KB 4OBSA 4ETQA 5DJ2B 5BJTA 4LVHC 4PRHE 4WENB 3UTTA 4P2QD 3RWHA 4GMTL 2D4DA 4WFGE 3TBVB 3ARDC 1U6AL 1XIWB 5TE7L 1CDCA 1J0YA 2EDEA 3LCYA 1UH2A 4KK6D 5F1OB 5F7NC 1KTRL 4PJCE 1AQDB 4DVBA 2EDRA 4QRRA 4NHUE 5GGTA 1CICA 1NCWL 3A6CL 3QUXA 4HEPG 2B4CL 4W4OA 1E6JH 5CD3B 5FUCE 3PWVB 4BZ1H 12E8H 4Y19E 2BDNL 4JKLA 2BZDA 2EDHA 2AJXL 2J8UE 3HI5H 3L3JA 3X12A 1RZJL 4FQCH 1IEBA 5B8CA 3OKYA 5FM4A 2AV1A 4NQDB 1GVIA 5DA4A 4CVXA 2CGRL 2A38A 4X7DC 5DJ8A 2X4TB 1A5FL 4HV8A 1XGUA 4S1QL 3S3PA 4EDWL 1EIBA 3AXLB 1PJ9A 2OTWB 4MVBC 1EHLH 2NY1D 1AGCB 3KPLA 2EDDA 1HZHH 4ODUB 2CK0H 2OXHA 3VI3F 2G2RB 3HE7C 1JWMB 3U6RA 2ZJSL 3VA2C 4R8WH 5J13C 4JQIL 4LF3B 4N0CC 1EJOH 1DE4B 4D9LH 1SM3L 1T5XA 5HVWA 1AD9A 2CDGB 2FATL 3UTPD 5FKPA 1OAUH 3NABH 2FCBA 5HHME 4AG4L 2BSTA 3FQUA 2EICA 2OL3A 3CXHJ 1LEKB 2AAVA 4JN2B 3DMMB 4OJFL 3VD7A 3H7BA 2YC1A 5KBNC 2VAAA 4FQLL 3WJJA 5A43C 2JCCE 3GHEL 4NO2A 1VHPA 1YY8B 2P5EE 1SY6L 3QUZD 2Z93B 3K1DA 3VXQB 5B8CC 5EUOA 4YDLC 1I1YA 5EO0A 1QBLL 4Z6AT 3GIVA 1ZK9A 3BH8A 2WBKA 4LKXA 3TT1L 4NO3B 4RRPA 3W0WD 3U30B 3LPGA 1HCFX 2EYTA 5IB4A 4ZFFB 3VGEA 4U1HB 2VZVA 2AXFA 2BRRH 4B7IA 2FYYB 3PP3K 2RJMA 1WFNA 4YBQD 3B5TA 4P9HL 4WU7A 1HHJB 4J12A 4LPWA 3B5HA 1RURH 4YDIH 4M62H 1IAIL 4HCRH 2CK2A 3LQZB 1HIML 4NZDA 1N64L 2R1XB 5MERB 4Q0XH 5CEZE 3HRPA 4ODXB 1N2RB 3FB8A 2VXVH 4HF5L 3EGSB 2Q76B 1NEUA 2CMRH 4YC2B 2QL1A 4Y5YC 4OLXH 3B2VH 1TJIL 3HG1D 5A3IC 1FLRH 3MA9H 2DQFB 4XI5D 3S35L 4M8QB 3ELAT 5EOCL 1FNEA 2HLFC 2YSSA 1V7MH 3NFNA 4M62L 1N59A 1ULVA 4DOHE 5JHDD 5D1XC 3GBNL 3BISA 2B1AH 4E41D 1FZMB 1RQ5A 2Y9RT 3AROA 4JE4B 4N8VG 5D7IB 4ONGH 4F8QA 2CIIA 3WDIA 4ZXBB 1Q9LB 4UOJA 3TBSB 3MBEA 3V4UH 3MR9A 5F3HA 3BD3A 1YJDL 4HKBB 1CT8A 5DJ0B 3JUYA 5IMKA 4Y2DC 4WW2A 2BSED 3M8OH 3WS3A 4XNUL 1GJIA 1WCBB 2XKSA 4Y19D 4XNZC 2V2XA 3TA3B 1Q94A 1LP9B 1FVCA 5J13B 1C5DB 1T5WA 3GM8A 1T0PB 43CAA 1GPOH 1KIQB 4M6OL 1GGTA 2XG5A 3M17B 3T3PF 4OTXL 4Q9QL 2PXYD 1S5IL 3MNWA 4ODWA 2IADA 4X4YB 4MD0B 3CSPA 1UJ3A 3EO0A 3ESUF 4HWEL 5FUOL 4KJYA 2ADIA 4M4PA 3OG4B 2RAMA 5DRNA 5ITBL 3P11L 2VWEE 4FRWA 1AKJD 1FSKB 2HG5A 5F8QC 4Z78B 3IJSA 4PJHA 4X5LA 1BQUA 1DUZA 1VFAA 2OJEB 3FFCE 3O2WL 3FQWB 1ODAA 3UTQB 3MLPA 4R0LB 3P4OA 1INQA 3QO0A 4NQEB 2AVGA 2YK1H 5EU3B 1JPSH 1CDYA 4DQOL 4AY0A 5GPRA 4BA8A 2FDBP 2DQHL 5C0RL 4S1RL 3BUYA 1I8KA 4F58L 3T0EB 3FQNA 2ZCLH 4ZUSA 5FKAB 3DV6A 4XWGL 3GSWA 1Q1JL 2IAMD 2XPGB 3U0WH 4JQXC 2C1PA 3V5KA 3PGDB 3BQUA 1H3XA 1RZKC 4YGAB 4HJ0C 3ARFD 4NNPH 1JGEB 1QACA 3OPZH 2HH0L 1S7TA 1VKXB 3O2WH 1P1ZA 3EO9L 3QJFA 3WFBH 2BNQA 4HGWB 3P9LB 1NCDL 3B2UD 3DXAD 4F9LA 3BZ4B 3E2HB 1F58L 2C1OA 3QCVH 2P44B 4APQA 2Y5TA 4YHZH 3PL6A 3I3EA 4U0RC 1BBJB 2CLVB 5I1EH 2HLAA 2I07A 3FRPG 4OB5H 1KEML 2VUYA 2CPCA 3UJIH 3I02A 1UWEL 3IETB 3QUMA 2BNRA 3CSYB 1OL0A 5E2UL 4FQQB 4G6AC 4P23A 2I9LB 1G0DA 1JPFB 1YMMD 3IJYB 1BGXL 5GGSA 3I2CL 1NGQL 1J05B 2R0WH 3HR5B 3VXUB 1UXWB 4EI5C 2ZNWA 2HH0H 8FABB 4YXHL 4WWKA 1F6FB 3OX8B 3MRRA 4MMZC 5IFAH 1ACZA 1U8LB 5D96B 3PABB 1T66C 4QHUA 1CE6A 5FK9A 2Q7NA 4HKXA 2BHUA 3ULSB 4Z8FH 4XNXH 5TQ2H 4JG0H 1CF8L 2WBJA 4LNRB 3SKJH 4Y4FD 5CBEA 3MJ9H 3D9AH 4Z95H 4LCWA 3T4YA 2OTWA 1T22B 2PYFA 4L8SA 1YEHL 1MCQA 1FHGA 2B8OT 3DVNB 4N90E 3PV6A 2IAMA 3LZFL 5DJYB 3RKDC 3WS6A 1GH7A 2FSEB 5FV2A 5BVPH 3LSOB 3QIBA 1KJMB 3LRSB 5MERA 1I1FB 1N7MH 3QPQD 1FORH 3JTSA 3SY0A 1U2HA 1T03H 4NCDA 3OHXB 5EU6A 2HWZH 4I4WB 1DLFH 3WYRA 5JNYA 1RK0B 1LNUA 1TCMA 3PDOB 1S9YA 3QUXB 1U42A 4K55A 5SX4I 4B0MM 2K7PA 1FL5B 4QTIL 3NA9L 3UTSE 5EO1A 5TPWL 4JFFE 4JY6B 2YUWA 4YWGL 5FA4A 5D7IF 2FX7H 2O5YL 1DJSA 1FG2B 2YD1A 2YPKB 1BD2A 4YK4C 3I9GH 4X98B 1QR4A 2RBLA 2F19H 1XH3A 1DN0A 4MWFA 1ITCA 3G5XB 4P0DA 1JPST 1WBZA 5AUMA 5T5NF 4OCXH 1MPAH 5KS9A 2A6DA 3ARBB 1A6UH 1UADC 2ZKHL 4UU9A 5C9JB 5ESVB 1V3LA 3CFJA 1OD9A 1MY7A 5K9OB 2VL5A 3GBLA 3QA3B 4K7PH 2F15A 3TZVD 1L0YA 1P4BL 3BGFB 4HJ0D 1QSED 5IR1A 4LSRH 1NSNL 2NY4B 4IOIB 1ZT4A 5HGBB 3RHWF 3RUGB 1X5YA 1WTLA 2BFVL 3FQRA 1S7RA 4G42B 3OR6A 5HSFA 5L7XL 5KVGL 4BSVB 5JIIA 4XP5L 5HI3D 2PW2B 3S36H 1K8IA 1TENA 1A4KA 5BOZG 3RWHB 1HHIA 2GJ6B 3I3BA 4O58H 4L1DA 3ABZA 1WT5C 3G6DH 1FO0H 1P84K 4TQEH 4U33A 1R0AH 1ZT7A 3GJFK 4XH2B 3ARXA 2P1YA 4V2CB 3RDTC 2X42A 3MRGA 4NQTA 3QUKA 2MQ0A 3RVXD 4B41A 3NACL 4RRPG 4H25B 1I1YB 5EO0B 4DGYH 1F4XH 1LE5B 3PQYA 4XMLL 3CLEL 3GSNL 1WIPA 3WSQH 1BWMA 4OCRL 4AL8H 1F58H 3KYAA 1SEBA 2GJ6E 2UWEE 1X5AA 1JZ7A 3VFUA 4DWHA 2XZAL 4DZBA 1S8DB 3X3GL 2Y7QB 4M9OA 3V6FA 3TYGL 4FXGA 4H26B 4RAVB 1CFNA 4HULB 5T1KB 1DTUA 2IC2A 3GMLA 4U31A 43C9B 3O0RL 4LCYA 4MD4B 1QSFB 3AS0A 2YRLA 4XCYB 1OT1A 3SCMA 2ZUWA 3U9PL 1EAPA 5DYOB 3IDYC 1RUKL 3LKNA 1FGVH 1X6NA 5DRZB 4HJGA 2NW2A 1X5ZA 1HHGA 1UWGH 4NGHL 3INUH 4I77L 5K9QG 3WFBL 1YQ2A 1KB5A 3LKOB 5BMFL 1AR1C 3VFOA 2XZQL 4RMRA 1U8IB 4ZFOB 3TCLB 1AXTH 1DL7H 2IQAA 4OI8A 3INUL 4IRSB 4L9DA 5GGSB 3G9VA 4WNQB 3ARSA 4JLRB 1N5AA 2IANA 1UWEH 2PW1B 1PDKA 4U2ZA 4OFYD 5LXGH 3H6JA 5GJSL 2PETA 3FQNB 4Q9QH 4G8GD 4Q2ZB 4APQC 5CEXA 3W11C 4KUZL 1RZKL 2LAGB 1OM3H 3HPLA 4KWUA 4H1LB 4Z0BL 1BECA 2CO6B 2NZ9D 4NC0B 1UXSA 4C4KO 4PJ5D 4KDVA 5C0JB 2XT1B 2Q86B 2JTDA 3QUMH 3QAZC 3LEYH 1IBGH 2CDFA 2A0LD 4Y19A 1N5YH 1D5MA 3GSRB 3QJHA 4Y16D 4K8RC 1JNNH 2AGJH 1ZHLA 3G08A 3GMQB 3QPXL 5GGRY 4O4YL 4UAOB 5HGDB 1B0WA 4P9HC 1OWWA 1NC2D 5CEZH 4HZLB 2G60L 3X13B 1CGVA 4Z76B 4WUKH 4BQ9A 4LLQA 3IVKA 5BQ7A 4KRPD 1V7ML 4XMLH 5J56B 4Y5YB 4Q58C 3WXVH 4ONFH 1NC4D 4TUOA 4XNYL 4OLWL 3RBSA 1S9VB 2DQEL 5JZ7D 5IB2A 1I1AC 2EH7H 3MLZH 3QEUB 1U2CA 4LPTA 1FRGH 1QHOA 1IGTB 3U4BH 3V7AE 2QEJA 3MYJA 3HI1B 2F74B 3MUGA 3EYSH 5FO9A 4FZ8L 1OD7A 4KVCL 3LMJL 4K23H 5D71H 3VE0A 4QRUB 4HUVB 2APVA 4C56D 3SDCA 2BP3A 3CXDH 3QXDA 2WP3T 3QEQB 4U4BA 1NGWB 3ROOA 4TOYH 3EUUA 4KI5F 2IQ9L 1P5UA 4ZD3H 2CXGA 3BVNB 2CRIA 3TA3A 1ZWIA 1I8IB 4YXKL 1SHMA 5GRVK 3BGAA 1QR1B 3FOMA 2X4RB 5DUMH 4QGTA 2VLME 4BZYA 2VDPH 4P4KA 4GFTB 1XGRB 3QDGB 1OSPL 5J89A 2Z4QB 1E4KC 3TF7A 1OB1A 1MH5A 3MACL 2HJKA 4YWGH 4L4TD 3UPAA 1C12A 3QUMB 2BCKA 3DUSB 3MQIA 2W59A 4LSPL 1U8HB 2DN7A 5SWQA 4HBCL 1PZ5A 3MBEC 4MSWA 2D2OA 5DFWH 2XY1A 4Y4FA 3EOTL 1KULA 1Q9KB 1K85A 1X7QB 4P2RA 3U82B 5FCSH 2QQLH 5GIRA 1E6OH 2XZCL 3O11B 4U6TA 5I66B 4JM2D 4PGDA 1BPVA 1IAKB 2WQRA 1Q9WB 3OF6A 3PIQA 5MHSE 3HS0A 1L9MA 1P2CB 1Z9SA 4NKDB 3AGVA 3RNKB 2X4OA 1BQHA 3FB8B 4Z7WE 3LZFH 2WWMD 3V5DA 2VDRL 1HKLL 2VISB 3WXWL 1PSKL 5IBTH 4M5ZH 5CJ5A 2PTVA 4P3DB 4JRXD 1C5BL 2FL5B 5EU4A 2AQ3A 3KJ4B 2YD2A 3OR7A 1D5IH 2ESVE 3B3IA 2I24N 4RCAA 4WY7L 4QHNB 1JF1B 3VFGH 5EBMA 3IDMA 4OIBA 1EK3A 2VDRH 1OAZL 1KXVC 1QZ1A 4TTDD 1B4JL 3U4BL 3VG0H 1FE8H 3GIVB 1P4LB 1JHLH 2XYCA 3KS0H 3LV3A 2VLJE 1JFQL 3BSZL 3IJSB 5DJZA 4AEHL 2AQ2A 2HLAB 5F6IC 5H35B 4HWBH 3MV8E 2HT3D 1ZTXH 4KJQD 1G7QA 2AXHA 4E41E 1YEGL 5I0DA 3ILPA 4JQXA 1XGYL 5DRWA 2EDTA 2A6IB 2H1PH 3RZWA 4UIKH 4GRMA 43CAB 2FEDD 4N5EC 5F7MC 3LHPH 2EXWD 1T83A 4K3JH 4FN0A 4HC1L 1A1OB 3QZWG 4MJ2A 4OZIB 1AY1H 5DSCA 4OUUB 3O45A 4PRIA 1CLCA 3EO9H 5D70L 2ZZUT 3EHBD 3QCUH 43C9A 3K81A 5BS0D 2RB8A 3DHJA 4RBPK 3WIIH 4J1UA 1J88A 2GY7B 4C56B 4BZ2H 3P4MA 4WIQA 4Z77B 1A9BB 2HJLA 5IIEA 2DF3A 3DGGB 1LWRA 5E5MA 2CDEA 2CLRA 1ZEAL 1VFOA 1OP3H 5DRZA 3WIHL 5D2LF 3RDTB 3Q48A 5IW3A 1ZOXA 4JPKL 4DQOH 3TT3L 3U79A 4GH7B 4HXBH 3VWJB 4K3GA 5DQ9B 1IKFL 5ANMA 1Q72L 4G5ZH 3BYYA 5JXAH 3X12B 1U3HA 5DI8A 4YXHH 1D5BA 2V2TB 1OAQL 5KS9F 5C6PB 1NBQA 5HJ3A 1VCAA 5IB2B 2OTUB 1CICC 3QFJD 3CD4A 2XWBB 5I1IH 1JNLL 4K3DL 2CRYA 4K2UL 3BIKB 3SDDA 2EDOA 5HHMD 4IBLT 5CZKA 4OKVB 1FAIH 1A7RH 1FGVL 4H26A 5DDHA 2G2RA 4JDVB 3CSGA 5ERWB 1PG7X 2QSQA 2E5EA 2X70A 5TQ0H 1DVFA 3TVMB 1C16B 3L3DA 3WMSA 3VD4A 3SCMD 4Z7QE 5EOCJ 1M6OA 4Q6IC 3GKWL 4JJ5A 4V1DE 1V05A 4KXZI 1YQVH 5E00A 3GSNB 1TCRA 4DVRL 4RSVA 1RZ8A 1PG7H 4NOFA 3BO8A 5ICZA 4HDIA 3RA7L 3VJ6A 3ZYJA 2V5MA 1TZIB 5BXFA 2YUXA 3P3YA 5DS8B 4L3EE 1T20B 4QO1A 4KVNL 1GCFA 2Y1VA 3IVKB 1ZLUH 3NIDF 4RGOH 1VEPA 2C4FT 3V6BR 4U1KA 3H9HA 3FO0H 1CZ8L 2IPKA 4HH8A 5I8EA 1UZ6F 4HKZB 2HRPL 5GS3A 2W9DH 1EGJH 4RQQB 5ISZE 2JCCA 1QKZL 4X5XA 4M6MH 3O4OC 3QQNA 1QBAA 3BI9X 4R4ND 2YA1A 4ZOBA 3WS3B 5HVHB 1KC5L 1SJVA 3EYVA 3HE7D 4RIRA 5FO9B 2VAJA 4IRZL 2GSIB 4JHAH 1N3NB 3OG6B 4FFVD 3B9KB 3F7YB 1MCLA 1KEGH 4J4PA 3SDDD 1KPUA 1JZ8A 4OTXH 1XF3B 4ODWB 3U7YL 3DIFA 4NFCA 4AMKH 3LDBB 5A16B 1G9NL 3ZT5A 4OD3H 4N0FB 1QO3A 4PLKC 4HT1L 2VQ1B 2XWJB 1BIHA 1FN4B 4TRPH 5JUEH 2LAAA 3MXVH 5IFJA 5EBLA 2EE2A 3GUTB 3WHE0 1X5GA 4U6VL 5BQ7B 2M1KA 3KG5A 4K94H 1NMCB 2ZOKA 3ZT7A 4LOUD 1YMHA 1KCVL 3IRZA 4JG1L 4ZPVA 3NA9H 4GAYA 4OD3L 4QTHA 5FHBL 2XTJE 3GNMH 5I1AA 2B2XL 4FZ8H 4KK5C 4KKCD 1PSKH 3LKRB 1DQTA 5CWSA 2J7LA 4MJ6A 1WIOA 1NANI 4MQ7A 5BRZD 5J1SC 1P7QD 5F9WC 1WSST 3BN9D 1FFOB 4TVSa 4X5WB 4F7CA 5FYJH 4RGND 1EHLL 2BX5A 3Q6GL 3RU8L 1BQHG 4GRWB 3OQ3B 1YECH 3C9NA 3PXHA 4FQJL 3OKKB 4JQVC 3FHQA 2R8SH 3TJEH 1J1PL 4GRLD 4NZUL 5GGVY 1WICA 3MA7A 1IZJA 5J11C 3MUY1 1J5OH 2ESVA 3S5LG 1Q0XL 2CXKA 2IG2L 3P4OB 4X9GA 4E41B 3K2UH 5SWZD 5HGDA 2JJSC 5DJCB 4C58B 5EU3A 5I9QB 2VR5A 3QIBC 2F54A 5JIKA 5CHNA 3IS0X 5JHLH 2VKWA 1T2QL 1QFUH 2FO1A 2H9GA 5FYLE 1WZ1H 4F15B 3P30L 3V4PH 2C3HA 3BX7C 2BOBA 4OCSL 5HD8C 3LDBC 4ORZC 1MHHA 3UXFA 3CK0L 1KENL 4WEBH 4JPWL 1RHHA 1ERNA 3CXDL 1VB9A 4DUWA 4TULH 3RGVB 3O45B 3QDJD 4X6CE 3NCBB 3X11B 4DOHB 3LEVL 2P7TA 3BPOC 3QXTA 4YHKH 3RTQB 4XPTL 1DBJL 4KH2A 3TM6A 1LEGA 2PTTB 4O2EB 2GTWB 1NFDB 3CU7A 1KJ3L 1G7PA 4HBQA 4NGHH 3GRWH 3OJMB 5EU6E 1JV5A 3FO0L 1ZLWH 1HQRB 2AI0L 3KLAA 4ELMA 1TZIA 2YD6A 2DWEA 3LN5A 4KHTL 5HDQL 4OF8A 4PB9H 5E08L 3UC0L 3KXFD 3QIUC 2Q87A 4CN1A 4X4XB 4I13B 5EZLA 4YDJA 1BZQK 4XNZB 4XAKE 4UILL 5HYSB 3PNWB 4Q2ZA 3O3BA 2CKNA 3NIGF 4MAUL 3T8XA 4WI9A 3O3EA 2CLZA 5BS0A 2Y5EA 1ZGLP 4NZTH 5IM7A 5ENWA 1U8JA 4JFOB 4XCFL 3VMOA 3IF1A 1V3MA 3E6FA 2PYFB 5C9JA 3MNZB 2VXTH 3BRGC 3PF2A 3GJFA 4BFGA 4KUCD 1F3JA 1YPZB 1C08A 1VFMA 3DMMC 4U1MB 1BVZA 1LO4H 3JXAA 3UC0H 1KJMA 4D9QE 3P0YH 3QPQC 1KV3A 3FO9B 4MCYB 2FECI 4DFIA 3WNMA 5IB3B 1AJ7L 4RGNB 1EMTL 3SGJC 1NCBL 3VWJC 2XFXA 1OCWL 2Q8AL 2UV3A 1N0XH 1MHEA 5DHXB 1TZHB 4GRLB 1FL5A 5HHXL 1LQVA 1G9ML 1EEUA 1PY4A 4GG6B 5AD0B 4MA1B 2JELH 3QEUA 4WWKB 3TIEB 4PG9B 5LGJB 4LHJB 1CI5A 4MB5A 3MRQA 3WFDH 4HHAA 5DVOA 1JRHL 1I1RA 5I19H 5CILL 1XCTB 4MNQA 3U7AA 1JGUL 1CXIA 3SKOA 2IBBA 1BWWA 5EOTA 5A2FA 1TVDA 3Q6GH 5CLWA 1QBMH 2NY5H 4X7EC 2MNUA 3QHZH 4AM0B 4U1IA 5EDXA 1IGFL 3AAZB 4PJFA 1ZVHA 3PP3H 2Y06L 4L3ED 5EU7E 3D0VB 1QG3A 4HIEB 2D9QB 2MJWA 5L2JA 4UINH 4NQVA 2DI9A 1RAMA 2DQGH 4CUCA 1G6RL 4F7MA 1MCIA 4PJEE 2VXUH 1J1XH 3BRDA 4LPCA 4XT1C 3HNVL 2D7QA 1QFPA 3VXPB 1NEZG 1F6LL 3W81A 3SKMB 3MA7B 2JJVA 3PJSA 5IG7B 4HWBL 2L0DA 1JN6A 4ODHL 1O7SA 4CL7A 1JHTB 5E2VH 1FV1A 4R96A 5FO8B 1CFTB 5H37H 5INCA 5L88H 4N68A 5BVPL 2DQJL 4PJGA 5JDSA 3ERYA 1WC7A 1IGML 3GMPA 1RUAL 5KVGH 1AHWA 2K9UA 4LVHB 2VB5A 2VTFA 4MAYB 4ZS6D 4NRYB 3DXAE 4QTHB 4ONHB 2EE9A 4OBRA 4QF1B 3FQXA 1AC6A 5F7FA 5D2NE 1IAOB 5FHBH 1RZIB 1C5BH 3QAZB 5EOCH 1CLOL 4FQJH 1G9MC 1UXSB 2DQDH 3B9KA 3F7YA 2O5XL 2YZ1A 1TJHL 3ULUC 5L8JB 4X4MA 4MQXD 4HWUA 2CRZA 3FT4A 1DEEA 2KL6A 1LO3L 4K94C 3E0GA 1ZXQA 2VQ1A 2XWJA 3I6LD 4N0CD 1P9MA 3WL9A 4W70A 1LO5A 3TNNB 4CJ1A 3F7RA 1TTUA 3MLYH 2WY3A 2Y23A 3SE3C 1YEDB 1MCCA 2MQ3A 5IFJB 3BWAB 5IB5A 1GRWA 3ZKQD 5GSVB 1HWHB 3GMMA 2YEZB 4J3SA 3S7GA 4Z7WA 1AIFB 4OSUH 5BRZA 4G9DA 4PFEA 5HYJE 2VKXA 4LMQI 1RZGA 4HQQL 3D39A 3ILPB 3MLUH 1RJLB 3HAEB 3ULUF 3MV9E 3MRIA 5IMOB 4JO2H 2IPTH 3O11A 1OARH 3NZ8B 5E03A 5C9KA 3V8OA 2ZUUA 1IKNA 1ZHNA 4OFVA 1BQLL 1MI5D 3FFDB 1URLA 5J1AB 3T0DA 2P5WB 1Q8MA 1FNAA 4X8XA 1AKJA 1NCWH 4APQD 3K8LA 4OZFH 5BZDA 2C9AA 4TVPE 1TNMA 3C60A 2OP4H 3RL1A 4OI7A 4MD4A 1NC2B 3WHXB 3QQ3B 4P23D 2I5YL 4AG4H 4CVUA 3P77B 5DDHB 2GI7A 5JR1L 1I8IA 1DFBH 2Z91B 4CU8A 3MODL 4QOKA 2BJMH 5E94B 3PHQB 2AK1L 4P4KB 3BDYL 4JRXE 1JPTH 3X13A 5LWYH 3OBAA 2QHRL 2V6HA 3P73B 1OP5H 5CGYC 5IHZA 4XNQB 5ANMB 4GXVH 2OYPA 4QLRA 1M71B 4R3SA 1RIUH 5T3XD 3G5VA 2D3VA 5EOQL 4K9EH 5T3XL 3UTSB 3KS0J 2WBJD 1PYWB 2J6EA 2PNDA 1KN4H 3EOBB 1IQDA 1DBKH 2P42B 4EI5D 3BP7B 3MBXL 3UPRA 1LD9B 1RZJH 4POUB 3QIWA 3PWNB 4MNQB 5C0IB 3QPXH 5JMOC 1H3GA 4OQTH 5C09D 2NR6C 5EUKB 4LPVA 4ZAKC 1RHHB 2VDKH 2LQRA 3RTQC 4A6YA 1AGCA 1SVZA 1NAMH 2D03L 5DD3H 2XQBH 5DMIH 4A6YL 3KYMB 4Y16C 1R3IH 2JK5B 4PJBA 1EX0A 1GGCL 4PBWD 5CWSB 1VPOH 5LAXA 2EKJA 1I8LA 3O8XD 5F7DA 4NO0B 1BBDH 2L7UA 4XPGL 3WNLA 4OLUH 3VGGA 5SV4A 4YDKH 1A47A 1QLEL 4I18C 4TVPD 4RMQA 2H6PA 3RVXC 5J6HB 1CS6A 4U6XA 4KRPB 4PR5A 4EXPX 4YNYB 5DUBA 5ID0B 4Y2DB 2DBLL 3V0VA 1RZ7L 2MSPA 5IFHL 5CGYD 5E4EC 3VXUE 1UGNA 5BMFH 3MJGX 4OZHE 3SO5A 5EUOB 4S1DC 5DC0A 1K3ZA 4KKAD 1H9VA 3UZQA 3WEXA 5DJCA 2R1YA 3C08L 3PUCA 4BK4A 5ITBH 1PW3A 1KXQE 4GXUM 3UO1L 1H0DB 5JR1H 1T4KA 5FYLL 5IJKA 3EJYC 1KENH 1XGQB 5H2BA 5I18L 4GMSL 3MR9B 1AO7D 1U3HD 5F3HB 2H32B 3CX5J 1F13A 5D93B 4OCSH 4FQPA 2IAMC 1S7QA 2AJVL 4NP4L 4ZUTB 4NBYB 5F1NA 1FBIH 4ALAH 4KTEH 1A1NB 3EYFA 2BSRB 1FVEA 4TPRL 5J3HC 5EZJA 1KIPB 3QFDA 4KRMB 5JOPD 4OM1H 5ALCH 1VFUA 4FABL 5BJTB 2XRAH 3O4LA 3TC9A 3OXSA 2JJSA 3HG1A 3L3HA 1ZVSB 1X5LA 1F4HA 3GSNH 2P5WE 1A6ZB 4PJXF 5I15H 3OKNB 3ESVF 4G43B 2UWEA 4XBEL 4Y0GA 1J1PH 4MX7B 5A2KH 2A6KB 3FMGL 3LH2H 3MRFA 4P9ML 1K6QH 4CVZB 3MV9B 1CICB 4IM8A 3RVTC 5SWSA 2UVFA 5C0AB 4FNLL 2H2SD 3NAAH 3OGCB 4YHNA 3GMNA 3B83A 3QH3B 4NJ9L 2ZJSH 4X6BB 3G04A 5GRUH 3U0PB 1A6VL 4HX1B 4LLWA 5DJ6A 4Z7UE 1AR2A 1PEZA 4O2CA 3KPOA 4J3WA 4PJDE 3DI3B 1UZ8B 4DGVH 2O5XH 2QQQA 3E2HC 1CGSH 1K4CB 4WHDA 1T66D 4X0KB 3PNWA 4P46B 2DI8A 3AFLA 2NPLX 1J0JA 4ZSOE 4RGOL 1F2QA 5GSRB 4YPJA 1RFDL 2AJUL 1YEJL 5D72H 4PJFB 4RNRB 5BVJB 5F7HA 5DMGC 1YDPB 2PCPB 4MVBA 3L3KA 3ARDD 3FB6B 1U8JB 4JFOA 3EJZD 3IS1X 4NKMB 5CZVL 2VDNL 4KK6C 3F12B 5CJOH 1JZ3A 3H3PL 5IOPB 1ZVYA 4KI1A 4K7PX 5DVNA 4WFHD 2P7TB 5D2LB 3I2CH 5DR5H 3DX9B 3VW3H 1AQKL 4QXTA 3QIUA 1BX2A 5ILTH 4DVBB 1T6VN 5FXCH 3GK8L 2A9NL 4HWBA 3B43A 3CH1B 2YBRB 4JRYE 4LSQH 3UTSA 5C0ND 2FEDC 1P4IL 1WUNT 2OL3L 3K4AA 4RFOH 4OZGB 4X6DF 1ZAGA 5J1AA 1N7ML 5I76B 4NZTL 2FX9L 4P46D 2J4WL 3GRWA 4QHUB 4JZOA 4KGJA 3V0WL 1N6QL 3SGKA 5B3NA 4AZ8A 4WHYH 3OAZK 2HT4C 2GUOA 3JV6A 4OFDA 1JP5A 3QHFH 1MCDA 1U9KA 5HY9A 1IC7L 2FH6A 3VXRB 4UQ3B 2R29L 4LP5A 3DRTB 3ISWA 3RUGF 1UCBL 1NKOA 3LMJH 5IQ9B 1FN4A 4G8GA 2IH1B 4KAQH 1KELL 3JTSB 1EXUA 5MENA 1KLGA 3VXTA 3O6KL 3EYUL 4XC1H 4GLRI 5HHXH 1MHCB 2A73A 4PJ8B 3HB3C 4PR5B 4DVRH 15C8L 1IJ9A 5F9AC 1BGXH 5JW3L 3DI2B 5C0BD 4LNVA 3NZ8A 1BLNB 4YHPB 1QA9B 4GUPA 1FGNL 3DO7B 1EO8H 4R96B 5IWLA 3WFCL 1G6RB 2IPUG 4NSKB 4KJPD 1GC1L 4L8DA 1KOAA 2CJUH 3BGFC 4Z0XB 4Y4HA 1RK1A 4OZGF 3D0LB 2I26N 3NFPA 2YPLB 3UTSD 2Z8VC 2VITB 1YN6A 2B20A 5ESQA 3ZMRA 3HC3H 3IU4L 1M1SA 3I50H 3C5ZD 1I3GL 3RWJA 1JFQH 4PREB 4AEHH 1T1ZA 3G6JB 3MO1A 1XF3A 1JGDB 1UA6L 5C0BA 2OJZL 1VERA 1SVCP 2IMMA 1ZLWK 5FKPB 1OQXA 1A7BA 1JZ2A 3MV7A 1YC7A 2D31A 3ILQC 5D7SL 4XVUC 1Y18B 4NM8H 3TPUB 4UTBL 3WO3B 2EDLA 4J6RL 4G7VH 2CO7B 2IADB 5C3LD 2ICEA 4JO3L 3ARVA 4L3CA 4Q9CA 4N90D 5F97E 3MFFB 4OLUL 2ADIB 1HKLH 4OD2A 5DJAB 4L1HA 4YNYA 3O8XB 5GGTH 1NDMA 2OP4L 3U9PH 1FLRL 3VGDA 4WHTB 4JFYA 4QXGH 1KB5L 3TZVB 5C08A 4XP5H 4ZFZA 3U2SB 1MQKL 5EULV 3QXWA 3QO0B 4P2RD 3UROR 4L3AA 4GQ9H 3T0XA 3L9RA 4MDIB 2P8MA 2HJFA 1P6AB 4D8PB 4LIQL 4RZCA 4LPUA 1LEIB 4JRXA 3ZE1E 1HOCA 2X09A 5CIPA 2W92A 1I8KB 4MDJA 5EUKA 4WEBL 4YX2L 2DICA 2Z0BA 4GSDH 3C60B 3FN0L 4QY8B 2VLKD 4XVUD 1BFTA 5A2JH 5BVJA 1HYSD 2BVYA 3SE3A 1AXSB 3ARGB 4GRLA 4I2XA 1TZHA 3DSNA 5EZIL 3GI8L 4L8CA 4Y8AA 4ZPTA 3VXRD 4ZXBC 2OQJA 1AFVL 1K8IB 4U6YB 5D6CA 1I4FA 3S37H 1LO5B 3TNNA 3DX9A 3U4AA 5TDPB 5SWZA 3SDXA 2OXGA 2J88H 5FYKE 4UDTB 3P73A 3TBSA 4ZOCA 4FFWC 4DGYL 4ZAKA 2FATH 5GXBB 3P4NB 2QSCL 3QNYA 2R1YB 4NZRL 3QB7C 1BFOB 1YECL 3GMRA 5IT2L 1RUAH 2VABB 3E1F1 3IFNL 3O2DA 4ZYKB 1SEBB 3CXHK 3OAZH 5GRUL 1ZHNB 5C2UB 1U93A 5KSVB 3FO2A 5C07D 1K4CA 5DD5H 4F7TB 1XF4A 4GRWE 5DHVH 1X4YA 5CLTA 3MGOB 5C0CA 2WP3O 3HKFA 5JW5A 3KPQA 3CFEB 3HMXA 5GSRA 3FAWA 4YFDB 1GOGA 3EYOB 4QRPE 4HG4J 4X6DB 1B0RB 4LCWB 4LK4A 4HBCH 4MA1C 1YNLL 5DD1L 1I9EA 5D1ZA 5F96H 5I0ZA 1L7IH 1HXMB 4P3WA 2YKLL 3FQUB 4F9PC 1CFTA 2RCSL 5C3TA 2P4AB 3REVB 3QIBD 3ARDB 3QDAA 2YN3A 4HZLA 4HFUL 1WC7B 2EZ0C 5BZWA 4MX7A 1F45A 3JBG7 1KT2B 4D0CB 1R3KA 4O51A 3SO3B 3AS3A 4GBXB 5CZXC 4LLDB 4NP4H 1NCTA 4QWWD 5F1KC 4QF1A 3F7QA 4JM4L 4PJ9A 3TYFA 3ZDXE 3O4LE 4GMSH 5JIPA 1U6AH 3GJEB 2EYTB 2AEWA 1D6VH 1QA9A 4GUPB 4Y16B 3PGDA 1MHHB 1MEXH 2YXFA 3CFDA 1HH6B 3VGHA 3QJFB 4X0KA 3BIAX 5L6YL 3CX2A 5HHVL 2H32H 3QEGL 4LQFL 3OKMB 3RGVD 4X4YA 4KKBD 3SBWA 4LCUB 3HPLB 3QUZA 2WBJB 2X41A 3GMOA 4IS6B 4KRNA 4KAQL 1IKFH 3DROB 3PP4L 4XNMB 1QLEH 2DD8H 2H3NA 2FO4A 3QIBB 2EXYC 4NQEA 2G60H 1NCCH 2F58L 2BERA 2CUHA 2L4OA 4EOWL 5ETUA 3FB7A 1MCOL 3D1MC 2YPVL 3NPSC 1MREH 3T2PA 4P57A 3SPVA 4U6XB 2LFGA 2J4WH 2XI9A 3CH1A 1YEFL 4NJAH 4NO3A 4EN3A 3VFNA 4XP1L 4LDLB 3HC3L 4L3EB 3VH8G 1HXYA 1FVDA 2R2HA 4F80A 4JY6A 1MCOH 5GZOD 4HC1H 3WJJC 5FUCC 1CXLA 2XNAA 3STLB 4WUUB 3WIHA 5KZCB 2PXYA 4HX1A 5DJ6B 2ZPKL 4LHUB 4PJAA 5H2BB 4KHTH 1LEIA 2EECA 3VDBA 5ILTL 1BIIB 1ZTXL 2DQCL 1HSBB 1P7QB 3I6KA 4BM7A 3QQ4B 2APFA 1IC4H 3T2QA 5K9OA 4LRIA 4ORGA 1E4WH 1Z2KA 4NHCH 3EDJA 2LU4A 1CGXA 2XZZA 4JRWA 1TVHA 5KSAD 1AXSA 3ARGA 3F5WB 3U46A 4J3OC 5DHYB 3IDIA 4WTZG 4FP8H 1UWGL 2FIKB 3AS1A 5I1GL 1JZ5A 4XP9L 2BVQB 1N59B 2RFXB 5HYFA 4JVWA 2EYRB 5C86A 3BP5A 2AW2A 4HXAL 4G9DB 5E0QA 1MFCH 4WWID 4POYA 4MNGE 1MCEA 5DFVD 5HDLA 3M1BB 1CGWA 1QLFB 3D39E 1NAKL 1UB5A 3N1FC 5EN2B 4CU6A 4CVZA 2QHLA 4MQSB 5F9WB 5CEYB 5DMYA 4Y4FB 1CT8B 4RMVA 5DJ0A 4X9BA 3T0EA 1J8HD 4CDHA 4DKFL 1R6VA 4UU9B 1LVEA 4MQTB 3QEHB 4RZCB 5IJVB 4WU5A 4FFZH 2IPTL 2FJHB 4KQ3L 1E6OL 1NJ9A 4LLUA 3A6OA 2VITA 3O6LL 1ETZB 3SQOL 5I1DA 2DJ4A 5ITFB 4YQXL 2FD6L 1FQ9C 4HPOL 4ZG1A 3S35X 2VDNH 4P5MB 4P9HH 2OCFD 1VA9A 4NQEE 5E9DD 5I1JH 1HNGA 3AREB 5EZOL 3S96A 4JFXA 4KK9C 4U05A 3FT4B 4D94A 5TE4L 2IALA 5JHDE 3WKMH 1Y18A 1EA9C 3S34H 1IC1A 4XI5C 1ZLUK 3DGGA 5TF0A 4PJBF 3TNMA 2UY7A 3VMNA 3AVEA 3VW3L 1S7VB 4PRNA 3VD5A 3HG1E 1MWAH 2BVEA 3L6FB 5AZ2L 4L5FH 4LKCA 4R9HA 5SWSB 3IFNH 4P23B 4H88L 2E6PA 1T2JA 2IH1A 1IMHC 1VGEL 4UQ2B 3GHBL 4E5XB 3QDJA 5C92A 1KG0A 4YFLI 4L4TB 1J5OL 1CLYL 2AV7A 3BHBA 3M45A 3RVVD 1CFBA 1T21A 3GBNH 4RMTA 4U0QB 5A2LH 3EJYD 3IDGA 1B2WH 4S2SB 2R8SL 1SM3H 3ARBD 1TJGH 3QRGH 3GHBH 1IQWL 2VLKA 2AEIT 1ZLVK 4L9LA 2GAZA 4OLEA 5C08D 5F6HJ 4UB0L 4AK1A 1P1ZB 1S7XB 2F8VA 3QRFM 5E2VL 2VLMD 2X9YA 4NQCB 4J7RA 5D7IE 4Y4HC 3KHOA 1SJHB 2X9XA 4PY8J 2G9HB 4U0RB 2H2PC 1J10A 5IP4A 1FBIL 4ALAL 4C56A 2XN9A 3W2DH 5LGHH 4NO0A 4C54A 4G3YH 5C07B 3ULUD 5E5MB 5KW9L 1A3RH 2P8PB 1RULH 3VXRA 4OFPA 3JUZA 4P49A 5D1QA 2VNCA 4ZUWA 1QPXA 3NCMA 3IETA 1J1XL 3V95A 5F21B 4JHBA 1BVLA 2HMIC 1GC1C 1UCTA 4LIQH 4OCYL 3QCTL 3GSVA 5F89B 5HVHC 2Z8SA 4MAYC 4KTDL 4JM2A 3BPLC 1XGTB 4DZBB 5IKCA 2N4IA 5DC4B 1U95B 4L8SC 3KYNA 4EI6A 1A6TB 1ZS8A 2GTZB 4CMMA 3UTZA 4MA7L 1J86A 1EO5A 3AREC 4I0PB 4P5TA 2FEEI 1DBBL 4R4BA 2IGFH 2YMXL 4LLMA 1FDLL 5GIRB 1IZKA 4UUJB 4PBVC 4N0UA 1ZT1A 5I66A 4ZO7A 3AS2A 2WLYA 4FXKB 1KCVH 4OF5A 3UYRH 4PJFF 3ZDZF 3QO1B 2P5EB 3BMVA 5LGKA 4G8GB 2BSSB 1KJVB 3IJHA 3U83A 5HHOD 3QDMD 5IHUL 4KPHH 2DYPB 1HXMA 4JANA 1K9TA 3E3QC 4OLWH 1NGZA 4G8GE 3F6IA 3ZYZA 4BQ8A 3CGTA 2P49B 4EVNA 1PLGH 4JM2F 2DL2A 4I18B 8CGTA 3PDDA 5DMKB 2VXTL 4AMKL 3NCJL 2E8ZA 4P2QE 4OT1H 2OQJB 2E27H 4PRHD 3JV0A 4BSWB 1LE5A 4R7DA 5D7LA 5SWZB 1OAKH 2D03H 3DX6A 5DD3L 1BAFH 5T5FH 3RX7A 3UJJL 3EOYG 3O6LH 3HR6A 1IFHL 4I0KA 5C0EB 4JHAL 4O00A 2DLFL 1WV7T 4LLVB 3VE0B 4MWFB 4MNQD 2CSPA 5IHLB 3P0VH 4DEPC 1KB5H 4ZQKB 1FZKB 4WV1A 4M6ML 1F11A 4LSSH 4MCZA 2JK5A 4PJBB 2GSIA 3V52H 1AI1L 3T0VA 3BE1L 2J8UB 1ETZA 1EJ6A 1NDGA 1UWXH 2XICA 1QRND 3WE6A 3SDCC 3K0WA 1WFOA 3JVGC 3RWFB 4UNUA 1P6FA 4FMKA 4C55A 4XGZA 2BC4B 2GK0A 3GRWL 3TA3C 1FO0L 4R6UA 5ICXA 3ZE0F 5TF1H 4OF6A 5D1ZC 1NDMB 3BMWA 5GGQH 4FQXC 1WBXB 4PUBL 5JXAL 4EN3D 1S7VA 2OK0H 3D18B 1U92B 1BJ8A 4G8EB 1I4FB 1I7RA 1RURL 4YDIL 1UB6A 5D4QA 5HHQB 4MXVE 3GSXB 4X6BA 3LV3B 3WCYA 2AEQH 3WFHB 4C57C 4I0PC 1T4KB 1I9IL 4FQHA 3FCTA 2V7NB 2IANB 1G0XA 1A2YA 4KROC 1W8NA 2QR0B 3MRMB 4J23A 3G6JA 3MO1B 1WBYA 5D5MA 5DUPH 1CBVH 1BOGB 2VLRA 1FIGH 5J3HD 3EJZC 4P59L 1RUMH 2B4CC 3W11D 3F12A 5INDA 2GHWB 4BFIA 1KBGH 4PGZA 4C83B 3EBAA 3U7WL 4JR9L 3ULUE 4ZPTB 5DD1H 2IG2H 5FEBA 3TN0B 1UJTA 1HYRC 1A6ZA 4WJ5B 3RWDB 5KTEL 5TE6H 2FRGP 1H3TA 4B50A 1GGBL 5D1XA 3TJEL 1CGSL 2R2BB 1FORL 3ARQA 3L95B 4XMPL 4TSBH 4CAGA 2OR9H 2H2SC 5E2WL 4E41A 4JN1H 4L5FL 3TEUA 3ARDA 5F89A 3G04B 2C4FU 1IQWH 4ZFOL 1JGUH 5GJTH 5F9JB 1RV6X 4EBQL 3V0AC 2A77L 5KVFL 2QQKL 4H8WC 3MROB 3I84A 5IEKA 5EZOH 3MV8A 4PTUB 4Z0XA 3V5DB 4PGCA 1DUYB 3MV7E 4JZJB 4Z9KB 4HD9A 2DM4A 1FYTD 3DVFA 1HH9B 3ALWA 5JA8B 4QOKD 2MFNA 3O6MH 2WBWB 2X4SA 4P2OA 5FAAA 4MJ5A 1TQCB 5TH2A 5B3JE 1NFDA 1I9IH 1EXUB 5MENB 1ZA6B 4WI4A 1XR8A 1L7IL 1HHKA 3O2DL 3OB0H 3UDWA 4K3EH 2OL3B 4HGMA 1G9NH 4WCYL 5EBGA 5K9JH 4PRAA 4O02L 1FH5H 1FL6B 1YMMB 3ZHKA 3CAFA 2DQGL 1PZ5B 3KPPB 3DTXB 4L4TA 4I48B 3ES6B 4KHXH 1MQ8A 4ZOEA 4RISL 4ZFZB 5FGCB 4GJTB 1IGIH 3HPJA 5E6ID 2ITDB 2I60H 4ZNEA 3QIWD 5JW5B 3PE9A 1WWBX 4U1HA 5TDOB 1R24A 3SGJA 1KJ2A 4LSVH 1CD1A 2X70B 2HT4D 2WANA 5FO7A 5KTEH 1JWUA 1EBPA 4HS6B 3RNKA 4WFEE 4V1DA 1VFBB 3BVNA 3MLRL 4WUKL 5HYQB 4U1IB 3R06A 1R5VA 3UBXA 2VC2H 3U7WH 4HPYH 1TPXB 4M7KH 5I1JL 4LLUB 3U0TA 5H94A 2ADFH 4ERSH 2BY0A 2QV2A 3EZJB 5EG6C 2EO1A 2BVOB 2HVKB 3BWUC 3JWOH 1NGYA 4P5TD 1IBGL 4Y2OA 3S96B 5I6XB 1OAKL 5T5FL 3IDXH 3UJJH 3TVMD 3G5ZB 2YD4A 2DMKA 2R0ZH 4OAWB 5DQDH 5KSUB 5FV1L 4EOWH 4EDXA 1GIGL 1PLGL 4LU5L 2EYRA 2YHGA 2F8XC 2MHAB 4GG8B 4NN5C 1JI1A 1CICD 4TOYL 4XC3L 1CGUA 4IOSD 4G9FD 5CCKH 3Q5TA 4NC1C 3UTZB 1E27B 1UM4L 5EUOF 4JDVA 4KJQC 1NAMA 2ARJA 1QD0A 1C16A 3L3DB 3HC4H 1KYOJ 1H15B 4I5BB 5B8CB 1K5NB 4N0UE 4ZTOL 4HWNA 1DQQB 1XF2A 3RPIA 3D85D 4L9LC 2BNRE 3KPRD 4NN6B 2DJUA 2NZ9C 1A4JB 3VFSB 2NY1B 5GJSH 2X89D 1MEXL 4PJHF 5A2IH 3CMGA 3RGVA 4ODUA 5IMMA 1SMOA 2F9BT 1ZEAH 5JOEA 4CMHB 3BYTA 4BZ2L 3JTTB 3R8QA 1H5BB 1DUZB 1VFAB 2OJEA 4ZUUA 1N5YL 1T2QH 4Z7OE 4X4ME 4GAYB 3TZVA 1G9EA 4OQTL 4WFFE 4Q97A 1P7KA 4NC1E 4NQED 5FDWB 1A14H 3UJTH 3K2UL 4HLZH 2ICCA 3LHPL 3MRKB 3O4LD 3GMPB 1IM3A 3PWPA 4A2LA 4PS4L 4M48L 3NZHL 1OF2B 3MUZ1 5FKAA 4PP2A 2VXQL 2FZ3B 1J8HE 3HUJA 5IW1A 2OTPA 3MMEA 2V2XB 2BVPB 5EIQA 2VLKB 1LO3H 5IQ7H 3O3EB 3KJ6H 3WIFA 4ZAKD 4JCLA 1MAMH 3OGOE 4X6DA 3TP4A 1DBAL 1NC2A 1EFXB 3WHXA 3RWCA 2H8PB 3T0BA 2F5AH 3TNMB 2NW3B 4X7TA 4UB0H 4Y8DC 5JO5B 3WFEL 3L7EB 4JDTH 3LQAL 2WWMC 5IVXE 25C8H 3DXAB 2A1WH 4Z7NF 4KI5D 4GW4A 2XN9B 1DR9A 2LTQB 2Z35A 3HCVA 3PWPE 4QRPD 1NQBA 1UH3A 4LVOC 1XR9B 4HIIA 4N8CL 2P8PA 2ATKA 4KZEH 3D18A 4D9LL 3L95A 4EBQH 4G9FE 3S5LA 1A22B 4P57B 2BVUA 5HHNA 3T3ME 5KSBF 5J57B 1U36A 4S2SA 1T1YB 1RZGB 1J8HB 4U1KB 3P0GB 3O0RH 1U8NA 4K94L 5TFSL 3PWVA 3VRIA 3KJ6L 3MBED 3TBWA 5IVNA 3N9GH 2WK2A 2SEBA 1EGJL 1OTSC 3BUYB 3MLSL 1F8TH 4S10A 1G84A 1MY5A 4XVTL 5L2KA 4C4KT 1OAXH 1TMCB 3O41A 1FFNB 3TO2A 2E9JA 5HYJA 1XCTA 5ICYB 4DAGH 3C09C 4LLVA 1BOGA 2XQYG 1E0OB 2BK8A 1EEYA 4CMHC 2FYYA 4HS6A 1JWUB 3U7YH 1BHGA 3ZKMC 4MB3A 4NPYA 2X40A 1M6OB 2ARWA 1KPUB 2GYSA 4HK0B 4HPOH 3T0EC 1J18A 1GGIH 3KPSA 2ZWLT 4HIJB 3J8F7 3CZFB 5D7JA 1NUNB 2E7LE 4FFZL 5KANG 3B6SA 1BEYH 3HE6A 5I8KH 2E7CA 1QP1A 1PEWA 4TRPL 5JUEL 4YXLL 3BEWA 4RDQF 2FB4H 4X7FC 2MCPH 4KZDH 4MYWB 4WTZA 1TETH 4P2QB 4MXQA 5I6XC 1A9EA 3BPNC 4FQ1L 4YLQT 5C09B 4K8RH 4N5EA 1MFCL 4LAQH 5E5UB 1FAIL 4M6AA 1Z0NA 1T0NB 1MNUH 2JLLA 1HILB 3IJYA 2XA3A 4PV8A 1ROWA 5GGUB 3CFKA 4KVCH 2AJUH 5L9DH 4BKLA 2ADJA 5F9JA 2JCCB 1D5ZB 2QKIA 4DJMA 4NM8L 5T3ZH 5IM7B 5IEHB 1A7OH 1OSZA 1LD9A 5J8OA 2BXZA 1F4WL 4I8DA 4YGVB 5I1CH 3D25B 5J12C 5L88L 1SJEB 3WV0A 1Z0MA 1FO0B 4PJAB 4RGNC 1FYTA 4MJ6B 1YYMH 2VH5H 3B9VA 1V8HA 3KLSA 2HRPH 1QVOB 2A6DB 3D2UA 3TJHC 1RIHH 4WV1B 3SKUD 1P5VA 4F2MB 1R5VB 1JFMA 3FL7A 3HE6C 4PJXA 1GOHA 2H3NB 2O5ZL 3V52L 1ONQA 4JR9H 1IEAB 3TV3H 1EO8L 1GXEA 1DQJB 3ARGD 4EVNB 3MZGB 4BH8A 5D6DA 1A7PH 2HLFD 1T6WA 1CQKA 3OHXA 3OZ9H 4PJDA 1FCGA 1JGVL 3DVGA 3L3HB 4X6CF 5MP6H 4MAYD 1ORSA 1IFHH 1YMMA 5M95B 3KJ4C 4HS8H 3BWAA 2WLZA 3KPPA 4XB7A 5EN2A 3C6LC 3MV9A 3VFWB 4XWGH 3CSYA 2RHEA 5IUSA 4L4VA 5E8NA 4PRIE 5D9SB 5KSAA 4NHUB 4KDWA 5C07E 5CJ8A 5GS1C 4PRBB 4YJZL 2V2WA 5C0BE 3N85H 1MJ7H 2MCG1 1CD1B 5I1IL 1IM9B 1V7NL 4NNXB 2BXYA 5CP3A 1MI5A 2BHZA 5ECJE 5E8PB 2BMKA 3MGTA 5F88B 1S7XA 4FQIL 4F3FA 3C2AL 1OAQH 3D3VD 1IRAY 4YBQC 1DBML 4YHKL 2X44D 2BSTB 3WIFB 1U3JA 1AGBA 3I6GB 3MODH 4JFHD 4HXBL 1OP5K 1FDLH 3P0YL 3OKOA 4V2BA 4MGXA 1IGYA 5I1EL 4XX1E 4PG9A 5IBTL 2Q6WB 4WEUD 4GXUN 3BPLB 2J3SA 5HHOA 2Y5TB 4G9FA 1CL7L 4XH2A 2CUMA 4MNHA 3VRLF 3MJ9A 3E3QE 3DETC 4JQVA 5I1LB 5T5NG 4R90L 3MZTA 4XHJC 4H25A 1A2YB 3F58H 1RUPH 3CFCL 1KCGC 1EO7A 1A6WH 1A3QA 1PFCA 2DLIA 2ZCKH 3QCTH 3FB5A 2FR4B 5F93C 5I8OH 1T1WA 5I73C 5JHDB 2O5ZH 4L9LB 3OX8A 2CLZB 3D0VA 3BPOB 4ZUSB 3VFTB 3BDBA 3DARA 3S8WA 4K71C 4YEFA 5I1KL 4RAVA 3IRPX 3RZCB 1CLZH 4M9PA 5SX5K 1QRNE 3EHBC 1ED3B 3BJLA 1DEDA 1Y6MR 3L3KB 4D2NA 3QQ3A 3SDYH 4OFIA 4U6HA 5CJQH 2XTJB 5EIIB 3LS5L 1FL3A 2OR9L 3FQWA 3LAFA 5CJOL 4YHYB 5D1QD 5K93A 1NMAH 1H3VA 1I8LC 1JV5B 1XMWA 3QXUA 2D9CA 5HHQA 3P11H 3D39B 2VLRE 1OGAB 5F6HI 1EFXD 2AQ1A 3SDXE 2WWKO 1I7ZA 4I18A 2UZYB 5GS1B 3KR3L 3MRJB 1UACL 4N8CH 2A73B 3K2MC 3SGKC 4GAJL 4RMUA 4LGPB 3MOAH 4XXDA 4MJ4A 4XBGB 1MSPA 1YA5A 1EBAA 4KK8C 4Y89A 2FB4L 3CC5B 4ODSH 2Y25A 4MS8A 1I85A 5DEGA 2EC9T 3OAUL 3Q0HA 4KGLA 2FLBT 2F19L 3WUWG 4ZDHB 1EHAA 4J4PD 2RCSH 3RWIA 3B4NA 2O5YH 2XY2A 2AJVH 4JY4B 4NBZB 4UIMA 1KN2H 5CSBA 5E8DL 2D4FA 5DHVA 5I74C 4I3RH 2AJSL 1NFIA 2JCCF 4M7ZB 1E4JA 5EC1B 2ED8A 1G7LB 4EKXA 4N5UA 3ZKMD 1ADQL 5HYQA 3DSFL 5F1NB 3H3BC 3OJ2C 4YAQA 3QJHB 4RBPH 3FOMB 3CZFA 5D7JB 2CH8A 3HNSL 4JN2A 4XPBL 2Z35B 1CR9H 3L1OL 2NY2C 1CN4A 2DKSA 5JIHA 3MRDA 5FYJL 5D8JH 3NFNB 4KMQA 1WVZA 3KXFB 2MTPA 3L5WB 3FO1B 3DUSA 1R5WB 2A83B 2D0GA 2FGZA 2ZUXA 4LFHD 4OAWA 2YUZA 2B2XH 4CMMB 4JG0L 4RMSA 2EIEA 3CFKB 2UZXB 3MREB 1NBYB 1W72L 2WINA 3F8UB 4XX1G 3DO7A 2KZWA 5I1GH 3C8HA 4H20H 3LQAH 3S37L 1WZLA 1W0VB 5HHMA 1B90A 1A64A 1F11B 2VE6B 2HJFB 3BIBX 3O9WA 3QISA 4O4YH 3HTLX 1MAML 2OLDA 2X