1KJMA

Tap-a-associated rat mhc class i molecule
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
277
structure length
277
Chain Sequence
b'GSHSLRYFYTAVSRPGLGEPRFIAVGYVDDTEFVRFDSDAENPRMEPRARWMEREGPEYWEQQTRIAKEWEQIYRVDLRTLRGYYNQSEGGSHTIQEMYGCDVGSDGSLLRGYRQDAYDGRDYIALNEDLKTWTAADFAAQITRNKWERARYAERLRAYLEGTCVEWLSRYLELGKETLLRSDPPEAHVTLHPRPEGDVTLRCWALGFYPADITLTWQLNGEDLTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVEHEGLPKPLSQRWEPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RT1 class I histocompatibility antigen, AA alpha chain, heav
publication title Crystal structures of two rat MHC class Ia (RT1-A) molecules that are associated differentially with peptide transporter alleles TAP-A and TAP-B.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Immune system
total genus 66
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2001-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1kjmA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1kjmA01
4JQIL 2YA1A 4LHUA 4NM4L 2HWZH 2OX5A 1UACH 1HCFX 4MQXD 5B4MD 4EBQH 4NC2B 4LLYB 2LVEA 4M3JA 5JR1H 4LAJH 4DEPB 5K9QI 5JW4M 2PR4H 1JUFB 1KGCD 2OTWA 4DN4L 2IPKA 1JZ5A 2D7PA 3ZTNH 1AD9A 1YEFL 4EN3B 1MRCH 5J6HA 1P7HL 1SYSB 5F7EH 1T6WA 2CDEA 3VA6A 4N90E 2X7LA 3WO4B 4JFYB 3GJFH 1QOKA 3JTSB 1AHWA 5E2UH 4GAJH 1PEWA 3F5WB 1F3DJ 3WFCL 4MQXC 2LFGA 5B4MC 4OZHA 1D5BA 3O3UN 4G6JH 2NY5L 4I3SH 2GSGA 2DQJL 4ZO6A 1MVUA 3ZKND 4YBLC 4IMKC 1MUJA 3BP6B 4IDLA 3RGVC 1C5BL 3PP3K 4KKAD 2MJWA 3L5XH 4Y16D 5DYOB 5E99L 2E9BA 4N5UA 5DJCA 4TVPL 4BH8A 3QWRA 3BVNA 4ODTL 5SWZD 5DSCA 3CVIH 4F9LC 3HAEG 1MF2L 5DTFA 1RURL 4HUUB 5FCUH 4MMZC 4PGEB 3A6CL 4PLOB 3ZE2F 3CSYB 2P43B 2GFBB 3P73B 1GGYA 1CLYL 4KMLB 5GJSL 2OJEB 3O2VH 5DGQA 5CEXA 4D9QD 5FFLA 5IMLB 15C8H 4NHUA 3ZKNC 2PNDA 2R29H 4HKBB 5JPMB 2E6PA 5IOPA 5EZIL 2Z8WC 3UROR 5HYQB 3LH2L 3BIAX 4KKAC 5AZ2L 5CBAB 3FB8A 5BVJB 4Y16C 2X4PB 3U7WL 1OWRM 4GRWH 4OAWB 2KH2B 5JLZA 1F5WA 1TZHA 1EGJH 3ZKXB 4LCCA 5FGCB 3QIUB 5INDA 3ZYIA 4CDHA 1MNUL 2IGFL 5ANME 5E94B 3DBXA 1T0NA 1CLCA 1GZPB 4MS8C 1R3KA 2XTJB 4IJ3C 1GHFL 3F7RA 5CP7A 3HKFA 4XXCA 4NZUH 2ILLA 1K4CA 4GKZA 1NQBA 5L2KE 2W9LA 5BCAA 3MUJA 2EC9T 1TETH 5DJ8A 3HZYA 1GIGL 1IGYA 4GKSA 3NAAH 4MXVE 1QLRB 2V2WA 4KI5E 4L1DA 4X98B 3D0VA 2AJZA 3QXDB 1EX0A 3R1GH 5E8OB 1S7UB 1E4XI 1INDL 1TVBA 4POUB 1LO5B 2NZIA 5BS0A 4FNLL 2VQ1A 4W6WB 4RGOH 5I0DA 4RGMC 4KC3B 5ID1B 4JR9L 1MI5D 2UY6A 4ZDHB 35C8L 5I1DA 3FN0L 4LSQL 4ODVL 1FVEA 2Z8SA 1A7NH 1A5FL 4YHNA 3B9DA 4S1SL 1C7SA 1GL4B 5JMRA 2OTWB 2ZCKH 4QRUA 1UM5L 2D7QA 5H94A 3TBVA 1E6JH 3T0DA 5F7NC 1IAKB 3MYZA 1EFXA 2FR4A 5T1LD 1BF2A 3WJJA 3K2UH 3MJ8B 2WWMD 4KUCD 1XGYL 2V5YA 2MQ0A 4NQDD 1OB1B 3B3IA 3E2HC 4GQ9L 4IDJL 4V2CB 1A3QA 1MQKL 4UQ3A 1AHWB 2ZUWA 2XG4A 1I1FA 2Z93A 2EIBA 5DJ0A 1IT9H 3DX6A 3L3DA 4I3GA 1K3ZA 4YDLB 3F7QA 1MRDH 3QIWA 5IHZA 3DURA 3V6ZA 5F8RC 4WFHE 4DUXA 1K2DB 3ABZA 3ZKQD 4G9DA 3CFKB 5CSZB 1KCSH 1Q94A 2YPKB 3TBSB 4RIRB 1MFNA 2F54D 5ISZE 1URLA 5E4EB 1MUJB 2X4UA 5ESVA 2R2EA 3FO0L 4PR5A 3CX2A 5KJRH 1KUMA 5E5RB 3PNWA 3PHQB 4CGTA 3GIZH 4HK3J 4I0KA 1EUUA 1IQWH 1I7UA 3QUXB 5LAXB 4EI6B 3OKLB 4C83A 3DUUB 4MA8L 3NIDE 5DJCB 4ZNEA 5DD0H 2IJ0C 4OZFB 4CVXB 1QVOA 2VC2L 2DWDA 1FDLL 3OZ9H 4YR6B 2QSVA 2HRLA 3C2AL 2DKMA 2BNQE 4P2RA 4WUKH 4ZTPL 4X6DB 2APWA 5HGGS 3MRHA 4QXGH 4U1NA 1LK2A 3WNOA 3RI5F 5D7LE 1MCDA 2E27H 3S7GA 1BQHG 1B0RA 1J87A 2DQFA 4U1HB 4YHLH 3RDTA 2CKBH 1E28A 3C09C 4NWTH 2C3XA 4PG9B 1VFMA 3TIEA 1YEHH 3T09A 1T1YB 1DQLL 4KY1H 4DZ8A 5E00A 4WI6A 1FNFA 2CUMA 2WBJA 1ZLWK 5IEKA 2I9LB 1KNOA 1PKQE 4NZTL 5B39G 5A3IC 5DEFA 2XZAL 4R4NC 1K4DA 1U8KA 1AFVL 3QA3B 3G5VB 3EJZD 1MRFH 4PJEA 3MLUL 5FO7B 3ARGC 2F15A 3SOBL 4CVZA 5I1AB 3WFEH 2VLJD 4KUCF 4OLXH 4U05A 2R1YB 3RWIA 2VR9A 4XVTL 1TPXB 4PRIE 3V7AE 4QRRA 4YHZH 1FLRH 2O5ZH 4A2LA 1HH6A 3V5DA 3HZKB 2W1NA 1WWAX 5CGTA 4GKZB 4WWKA 4F58L 1PYWB 2DD8L 4PRHE 4BSJA 5IBLD 2C3WA 5HHQA 1X6LA 1N64H 2YRZA 4HG4K 3WFDH 4IIQA 3RGHA 5FGSA 2DMCA 3D0VB 5KS9E 7FABH 1U8JA 1Q38A 1CXEA 3Q5YA 3KYOB 3OKMA 3EJZC 3VFNA 1F3JA 4KV5F 3TT3H 3RIAF 2J8UB 5JIPA 1QSVA 1KSRA 5IB3B 5EBLA 4WHDA 1HEZB 3MNVB 3M1BA 2CJUL 3ARYA 4GBXD 1TJIH 3O4LD 4YHYB 1DVFA 2QQLH 2Q8AL 2BHYA 3O2WH 2WUBL 1MCCA 4WUUB 2BVOB 3RY5A 3G5XA 2P5WA 1YEGH 1X4XA 4HIXL 3W0WE 4YHPB 3DX8A 2FR4B 2EDQA 4CDGC 5TQ0L 4M6ML 2IQAB 4HXAH 3P4MA 4S2SA 1HNFA 4Y2OA 4K7FA 4N0YL 2VLKE 4FFZH 5ETUB 5C0BE 1CDIA 5DT1L 1MCOL 3WKML 4ODXA 3RHWF 5IW1B 4BFGA 5MHSD 2P42B 3EYVA 3SDAD 4PP2B 4EIGB 4CN1A 4OQTL 3ZE1F 3V6ZB 4HKZB 4QO1A 4QOKE 1RAMA 2FD6L 5KSAC 4GBXC 3WBDA 4G9DB 1MH5B 3QUMH 3BKYL 5L8LB 5F97E 5J89A 1D6EA 5D72H 2YSSA 5IIEA 1JPST 4PR5B 2CK0H 5E6IB 5EOCJ 3DMMA 1KELL 4HH8A 5D7JA 3OGOE 5F3HB 1HHJA 2MNUA 3MMEB 4GKOA 1II4E 2XKUA 4JRWA 4EQ3A 2BOCA 2H8PA 1UG9A 4PJFE 1XF2B 1FO0B 1U8QA 2EC9U 3S5LA 1D9KA 2ADFH 4ZFGH 1KPVB 1R3LB 3HCVB 2V5SA 2ZSWB 1F00I 4I18A 2A9NH 2E7MA 1RUMH 5GGQH 4ELMA 3GMOB 1QVOB 1FAIL 1T89C 2FEDD 4JLRB 3KHOA 3SDAC 4Z8FH 3P0VL 4PJXB 3LS5H 43CAA 1U8IA 2H9GA 5I15L 1CF8L 5CCKH 3TCLA 1L7IH 2CRIA 3GI9L 4GXUM 4ZAKB 1T1WB 3VMNA 3S3JA 1SEBA 2XN9B 4LSTH 2DYPA 4DZ8B 4KUZH 1OPGL 5GRVK 4TQEL 5JXED 4LSUH 1NUNB 2Z31A 4WFFD 3NPSB 5DEFB 1U8KB 4FQ1H 1EBPA 2IAND 2H3NA 1KIUA 2ZUVA 4HQQH 1LEGA 3FO2A 2FEDC 3PWPB 3JBG7 1J1PH 4EI5A 5FM5M 3RWIB 2IPTL 4QRRB 1NGPL 1ZANH 3X11B 1UWGH 1CT8B 4V1DD 1BBDH 1UCBL 5LBSL 3OB0K 3E1F1 5DMIL 1CU4L 1QSEB 1M1SA 3D3VA 5KVEH 1N59B 4MZ2A 3QNZA 4XCCH 4HIIB 3GRWH 5EU6A 4U33A 3SN6N 5B8CA 5HYJD 4E42A 2CGRL 3AS0A 4M93B 5JXEC 3RWJB 4LNVA 5CIPA 5FYKL 1NGYA 3MGOA 4XBPA 1LO2L 3SDXA 2VDNH 4PJ5D 4JDVB 3EBAA 4G6KL 4JN1H 3LEYH 4KROD 4EVNB 4KQ4L 4TNVF 4XMLH 5HHOD 4IRSD 2ITDB 5HPMA 3VFSB 2ZKHL 4OGAC 1OF2A 1A1MA 3WD5L 1VGKA 2DDQL 5DFVC 4NM8H 3SPVB 3VFMB 3OKKB 4MNQB 3MGAA 3V4VL 1QA9B 1MWAB 3IDIA 4C4KO 5C0CE 4CMHB 4XRCB 3V4UH 3LKQB 4G8IB 2PO6A 1EXUB 4X4ZA 4IRJB 1CGUA 5E8NB 1Y18B 2CLVB 4JO1H 4OCRH 1CXFA 4L4VA 3NOIA 3T3PE 4AH2A 5ACZB 2A1WL 4GT7A 1T3FA 3RU8H 2R15A 3QUZB 4MCZA 3P4MB 3OJDB 3WE6B 4KROC 4I0PB 3TPUB 2A77L 4KVNL 1G0YR 1UA6L 3EO1A 5C0FB 2FGWH 2R9HC 4ODXB 4NRXB 1ZGLA 3T3ME 3F58L 2CIIB 4XPHL 4L9LC 5DC9B 3QQ3A 5F1IB 5IVZB 1MFBH 1XZ0B 1JZ3A 4NKMA 4C58B 1H3WM 2AABH 4XC3H 3NBNA 4WI8A 3TBYA 1FV1A 1NPUA 1OAQL 3EYUH 3EDFA 2HFFA 2KZWA 4YK4C 3H9ZA 5SWSE 4LKCB 4CN6A 3WSQH 2XY2A 1PGRB 4PB0H 2H8PB 1D5ZA 2UWEF 4DVRH 1Y0LB 1F4XH 1A0QL 3PL6C 5AG9A 2R2CA 2EICA 4I18B 4RDQG 3AS1A 2ORBL 3FFDA 3DGGA 3MOAH 5EC2A 1IZKA 2G5RA 5AD0A 2CR3A 5H37H 4RRPA 3G5YB 3DYPA 3BP4A 4L3CB 5EDXA 5HVHB 2AEWA 4ZUWB 5MEND 2OI9B 3O6KL 4JO3H 5DJYB 1BJ1J 2L7JA 2W38A 4FXLA 3NMEA 1X5GA 4H1LA 1OL0A 4L3EE 1IBGH 5E9DE 4LHUG 2ZUXA 2DYPB 4Y4FA 1G9NC 3TA3B 4JB9L 3T2NL 1FZJB 1C1EH 2ADIA 1I9RL 4YHKL 4ZUTA 1NBVL 5HGHB 1AGFA 3HTLX 4TNWF 4Y5YC 4X4YB 5F96L 3BH8A 3KLDA 3PQYB 3QDMB 2ADJB 3O3BA 5CHNB 1F2QA 2OQJB 2AJUH 5TFSL 4MSWA 5F9JA 1CLZH 3UEZA 3OAUH 3O4OC 1CXIA 2PW2B 1AQKH 1ED3A 1OGTA 4F7EA 1LQVA 1UB5A 3NVQA 2EIDA 3E0GA 4F57H 1PY9A 5CJXA 3KPSE 1KG0B 1UT9A 4J7RA 2P7TB 5D2LA 1JHKL 3H3PL 1IC4L 3ME0A 1ZHLA 4ELKA 12E8H 2EYTB 4YPGB 5J4MA 3UTZA 5KN5A 3L7FA 3TO2A 1NMCB 2VL5B 3T0EE 3SDXB 5JOFB 1CXLA 2CLRA 4M6OL 1CDBA 4L1HA 4OLUH 4AY0A 1INEL 5D5ME 4AIOA 3D9AL 5C8JB 4AEHL 5IW6A 4OM1H 2NY3B 5IJVA 3STBA 1ZTXL 1T5XA 4DAGH 1A1MB 1UWXK 4HJGB 2X1WL 2EDOA 1QLEL 5B38A 4GG6B 3HG1A 1CLOH 3IJSA 4WTZA 3WNLA 3T4YA 3BN9D 2H1PL 2HFEA 1G9NL 2EDWA 1H15B 3AU1A 5FOBB 1SJEB 5JQHC 2RFXA 4G7VH 1T83C 2PO6B 4WW1B 3D39A 5JOPE 5H37G 1KACB 2AQ1A 1IGCL 5FO9B 1V8HA 3HRZA 1SVZA 2R0WL 4JPWH 1XGRB 2HT4D 3H7BB 5DEGB 1T3FB 4GG8B 2HKHH 4XCYA 4S0UC 4U1IB 2Q3ZA 3MV7D 4ZFOL 2CQVA 2VITB 4BQ9A 2VXUH 3KXFA 1OAXL 4RWYH 2KQNA 5GIRB 2LU7A 4H88L 2MPAH 3B5HA 4ZUVA 1CYGA 1GPOL 2MFNA 4S10A 4KK6D 1C5DA 1H3TA 3SDDA 4HBCH 4NKMB 1W72A 3B83A 3JZ7A 3BN9C 2HJKA 3TBYB 2BXZA 3S37X 3B9AA 3DUHA 4ZXBA 3B8YA 5I8EB 1PG7H 3BDXA 2FATH 4XC1H 3NCJL 1FO0H 3JWOH 1KCVH 3C60D 2HT4C 1KENH 3KNBA 4XNMB 1I75A 4RQQB 1S7SA 1AGBB 1NFIA 2EDLA 5F88A 5ENWB 3MJ9A 3HFMH 5CINH 3FFDB 4RMUA 3L5WB 2AI0L 1YJDC 4LEOA 1XGPA 2YK1L 5E1HB 1MCJA 4LL9A 2QADB 1OP3K 3VDAA 2VXQH 2JB5H 4Y4KC 3SE4A 3SGKC 1RD6A 3RVUD 4JCLA 1FZKA 4KK6C 1JHLH 4Y0GA 1U8OB 4G8GD 3RL2B 3U9PL 3WIIL 5EOQH 5E2TL 5IVOA 3RVWD 1BFVH 4P4RA 3OAZH 3IDMA 1JTTA 1YDPA 4FZEL 1U91B 3LIZH 2W60A 4HX1B 1IQDA 4ALAH 3C60C 2GQHA 1WF5A 2DBLH 4NYLA 3J7HA 3KDMB 4Y4FB 2ZJSH 1NMAL 1AO7B 4ZQKA 5HJ3A 4QWWC 4IBLT 1IE5A 5D2NC 2D3VA 1FPTH 1NCCL 5TE6H 5C71A 2NMSA 4GRMA 5C07B 3FFCE 5K9OA 5DJXA 4BUHA 5DD3H 4WJ5A 1AGFB 1F58H 4NKIH 4F37K 3EYOB 1I1AD 3RVUC 4J3UA 1OT2A 3O3BB 4NO5B 4R2GD 3TPKA 3I6LE 4QT5B 4KZDH 3MCKA 1G84A 3UPAA 3RVWC 3BZ4B 3MJ6A 2FIKB 4JREB 2A2QT 5D8JL 1N3NA 3U6RA 5I1JH 4M5ZL 5E7BA 1UB5B 1QYGL 4FG6D 4YFLI 3STZB 4OZIE 2VLLA 4HS8L 3V0WH 5GHWL 4PJGE 5LWYH 1IGFL 4U1JA 5C3TA 1YJDL 2YN5A 5C1MB 3UTZB 5KN5B 2DQCH 3C6LC 4FZ8L 4W68A 5BRZE 3S3PA 4M7KL 2VWEC 4TOYH 1TMCB 4FABH 5LCVL 2V7NB 1L0XA 1YEDA 1MCIA 4APQD 5LXGL 5IG7B 3ZYJA 3UTSB 4GRWE 1YMMD 25C8L 5T1MB 3KJ6L 3O6FD 4P4KD 5FUZL 1YQVH 7CGTA 1HWGB 1P2CB 4M62H 4JY4A 4MAYB 1G7MA 4NQCD 2I24N 3HG1B 3Q5OA 4MWFA 4UTBH 4WV1B 5C09A 4L8SC 5L2JA 4F8TA 1P7QB 4FG6C 1YNTB 2F53B 4ZPTA 1ZS8B 2RFXB 3C5JB 4YHOH 3ZDXE 1GGIL 4OFKA 3U46B 1U9KA 1KJ3H 3D39B 4X9HA 3Q1SL 4KHTH 1P7KA 2F5AL 3N1PC 1KYOK 3L3HA 2DMKA 1JCKA 4HWBL 4NFDA 1N6VA 2JF1A 5JOEA 2G5BB 2PYFB 3CGTA 3DVGB 4ZUSA 5D7IA 1V7MH 3GHEL 2YD1A 3F62A 2OJZH 1P4BH 1AD0A 2YD9A 4P4KC 1A2YB 1XH3A 4LCUA 2B4CC 4JKWA 3FT2A 3ZDYF 3HNTL 1CGTA 1T2JA 4JFED 1X7QB 2SEBB 4JDTL 2X1XR 3FL7A 5A16B 2HVJB 2X4RB 3FQRA 1MFDL 4I48A 3ZKMC 2ZNXA 4HUNB 3HE7A 4NGHL 3N1MC 5K59F 4QNPE 3M07A 4IM8A 3IU4H 4WTWA 2IBZY 5IMMA 2GCYA 5JHDD 3DO3A 4KKBC 4LIQH 1L7TH 4Q7DA 3KNBB 1WCQA 3QH3B 3OR6B 4HD9A 2O5XH 2BVQB 5F88B 3LDBC 3CH1B 4JPKH 1N5YH 1RJYA 3GKWL 4WCYL 2ZOLB 1KN2H 5D9SB 1RK0A 4XPAH 5J1SC 4LEXL 3E3QC 2WIMA 3NCFB 3GMMB 5BMFL 1QBML 4R8WL 1GZQA 4XNYH 1OAKL 2FO4B 1QSFA 3IDMB 4JO2H 2Q6WA 1RZGA 1ZGLP 4L3AA 1RFDH 4PREB 1A8JH 3BYYA 1S9YB 4YGVB 4ORGB 5FK9A 3WS3A 2NYYD 2LTQC 2Z92A 4BSVB 3U0TA 2EZ0C 1HQ4A 2R0ZL 4MXWL 1OY3B 3UX9B 4O2EB 3X13A 3HNVL 4TSCH 4GRMB 3H3KA 2YD5A 4B7LA 4HWEH 4U1KA 2APXA 1F90L 2EXWD 4KJYB 1SBBA 2WV3A 3DYMA 4PJHE 5DD5L 5DJ2A 1QFHA 5EZJA 4YBLB 4OIIH 3VGAC 1A7OH 3NCMA 1H3XA 2MQ3A 1R0AL 3RGVB 2A9ML 5BJTB 2WWKT 5I1IL 3U6RB 1T22A 2OTUB 4DJMA 1RZKH 3JWDL 4HMEA 4C56E 3OAYK 4BZYA 5J57B 3QEQE 2NYYC 3MUGA 1J0ZA 1F4YH 1GGBL 4GMSH 5CIPH 4WY7H 3U4BL 1DP0A 3VFUA 4JDZA 1OGAE 3SJVA 4P23A 3CU1A 4XCFL 4ZO7A 2OR8A 4HPYH 1JPTL 4B0MM 1WEJL 2ERJC 4NC1E 5ICYB 1YMHA 2HJFA 5EG6C 3VG0L 2QL1A 1PSKH 1WAAE 5GJTH 2R2BB 2ENYA 3NH7H 4NNYA 3S5LG 3VXUA 4KKCC 5C08D 1A47A 2AJYH 4PJDE 2XPGB 3FMGH 2XI9A 3QDJE 1MFEH 4Y16B 2WBKA 1ACYL 4N8CH 4XNUL 2V2TA 2ITCB 1A7PH 2X4OB 2EH7H 3CIQA 3MOBL 1QLFB 1QFWI 4P2QB 1B0GA 3QQ9C 4KMTL 2C4FT 1MHPH 3L3HB 3RKDD 1UZ8B 5HXMA 4XPFH 1RVFH 1X6NA 4PJ9A 4JPVH 3FN3A 5F7KC 5BVPL 3G08B 4IJ3B 4FQLH 3ZSSA 4YNYA 2CK2A 1BF8A 1NBYB 4MDIA 3TNMA 3BPNC 3VH8A 1J9CT 1HE7A 2YPVL 4LCUB 4O9HH 3PG2A 4U6HB 1D6VH 4NHCL 3JTCA 4MA7L 1A7BA 4P9HH 3R4DA 5B3JE 4I48B 5DUML 5H2BB 1YEEH 1RZ7H 1UVQB 2DF3A 5JIKA 1OW0C 1A1NB 5FKPB 4FFWD 1ZHBB 3QDGB 4YJZL 1G9MH 2DQGH 2Q7YA 1J88A 2PYEB 3PWVB 4Y1AE 4NOBA 3UJIH 1BREA 4X7SH 1KJMB 1LEIA 4RGMB 5GISH 4KJPC 2OBGA 2YPLD 4Y8AA 1MCRA 2BC4A 4DOHE 4KI5C 4NKDA 5T1KD 3HI1A 1N26A 2ATPA 4FS0A 4LLUA 3BKCH 1HQRB 4G8EA 4URTB 2CIKA 5TF0A 4H1LH 3IFNL 1QSFB 3RZCD 3U0PA 1F6AB 1MJUH 5HDBF 5FF6B 5KSUB 5IEHA 2Z8RA 1R5WB 3MLWH 4WHTB 2DBJA 3E2HB 2PXYA 3BKJL 3HI5L 4OKVA 4M61B 3HE6D 4OLVL 4PV9A 4RAVB 5IJKC 1MCPL 3SCMA 4QCIA 1BX2A 2H45A 1KCUH 5CLWA 3BKMH 2A6JB 4LMQE 2DQTH 2X5PA 3RPKA 4XCNA 1KB9K 1CCZA 2KBGA 4NT6A 3C8KA 3MRJA 4WWID 3QFJE 1IEAB 3NIGE 1TZIA 1PX3A 1WSST 3EO9H 2QTEA 1U8LB 3GSWB 3LRSB 2QQNH 5C2UB 4KI5F 4OCWH 1A7RL 1X44A 3CK0L 4K71C 5T1LB 1R6VA 1IC7L 4EDWL 4NQDB 5D1ZD 2XOTA 3RX5A 1N4XH 4K3DH 4LAQL 1TVHA 3HE6C 4GW4A 3GMNB 3LRHA 4JZJA 5L6YH 2DLFL 4HV8A 4XTRD 1AKJA 3OPZH 4YDIL 1I1YB 3MLRH 5C6PB 1Q1JL 4UOW0 2GYSA 3ZE0F 4ZS6C 4JQIH 4NM4H 3FO9B 4F9PA 3ZYOA 4YEEA 2F54B 1WZKA 4NUJA 3OXSB 1ZHKB 3C09B 4M1GL 4YHMH 4I3RL 3MBXH 4GAYB 2EDFA 1S5IL 3L9RA 3VMPA 4F2MB 5DI8A 3BP5B 4QRPD 5DVMA 3NTCL 3FQTA 5D1ZC 4RRPG 4GKNB 1CD1B 1Z0NA 1YEFH 3GBLA 3PHSA 4JFDA 4C55A 3S3SA 3BSZH 1HINL 3M8OH 4XTRC 3ARGB 1FFPA 3QCUH 1G1CA 4U6YA 4P2OA 3EDJA 4BZ2L 1X5XA 4PG2A 2FX8L 3QRGH 4JKLA 4PRHD 3AS3A 3WFCH 4H1LG 5DURD 4AM0A 1W8NA 2ZPKH 2QQQA 3VFPB 4WVRA 2NY5H 5JDSB 2WLYA 1W72H 1XF4B 2DQJH 2IG2L 2YA0A 4FQQA 4Y4HD 4HUWA 1C5BH 1A1OB 3NIDF 5T3XD 4RCAA 1RHHB 1JMXA 1KN4H 1EJ6A 4FTVA 4XPGL 5DHVA 5HYSB 3FO1A 1RZIB 3VI3F 3GO1H 1CZ8H 2DIJA 3MJ9H 2VIRA 2VLJB 2Q7YB 5DR5H 1SJVA 4PYHA 1RIVL 2BCKA 5ID0B 3O45A 3A6CH 5CILH 1NLDH 4LPVA 1FLTX 3G6JA 1KBGL 1CLYH 3FN9A 3L95A 5D93B 3ULVD 3V2AR 3VJ6B 4Z76B 4HZAA 4MXQD 3WN5C 2H41A 5MP6L 1MCSA 3O3EA 3G04A 1RU9L 5L9DL 4LLUB 3LH2H 4O58L 1FRGL 4OZHE 3RX7A 4LCWE 3U0PB 1A9BA 3U7WH 2FL5A 3WDHA 1JN6B 3FONA 3BEWA 4HKXA 4Y2DA 1YPZE 4J8RA 4HIJA 2PXYB 4MJID 4Q9CA 2XNAB 1IARB 4OKVB 1MNUH 2IGFH 4Z95H 1BLNA 3VXOA 1HSBA 5DS8A 3SCMB 2YUVA 3IETB 4PDCE 4EDXB 1WZMA 4W4OA 1GHFH 5EU5A 5D7KD 3V95A 3KPRE 5KSAB 2PN5A 3O4LB 2OXGA 1A14L 1FGNL 1BZ9B 4K8RD 1SMAA 1X9QA 2M26A 4ZD3L 4G8FA 4OSUH 4NO0B 1QBBA 3W2DL 3GKZA 4K3JH 3S96B 2DTML 4Z77A 3QNYA 1NUFA 1ADQL 3P4OA 2FCBA 2BJMH 1IAIL 5IFHL 3BE1L 3SDAB 3GM0A 1EO7A 5EPMA 4G9FA 2EYSA 3HPJA 3QG6A 5HHMA 2OR9L 5ILTL 35C8H 3FN0H 3H9SA 4PY7A 3VCLB 4Q6IC 4K8RC 4QRSA 1M05B 5EC1B 2DWEA 3UBXG 3OKNB 1FL6B 3PWLB 5GGVL 5DMJB 4PY8J 4LCYB 5JNYA 5GRVL 3HI6L 5L88H 3RA7H 1J8HE 4NKQB 2YKLL 4GQ9H 1B6DA 4IDJH 4X6BB 3O41A 4GLRH 4U6YB 5ADOL 1I3GL 4OCXH 2GKIA 4XP9L 1JRHH 5DJAA 2VYRE 3SKJL 1J0KA 1ONQA 4MD0A 3HC0A 1SQ2N 5BS0E 2AK4D 4XMPH 4L4TD 4JQXA 1ORSA 1S7QA 5I30H 3B9KA 4X7TB 2XA3A 1MCLA 1E4WH 1IKNC 3OJMB 2FH6A 4ODHH 4PJFF 4UDUB 2W0FB 1G6RA 4KDVA 1ZEAL 4PRNA 1G9EA 2LQRA 4MA8H 2Q76A 5E8DL 3OR7B 4UV4H 3FO1B 5IM7A 2NR6D 4Z7UA 1DQML 3P77B 1CQKA 4U0QB 4XAWL 1OAZH 3KLHC 3NACH 2VC2H 4LLVB 1P5UA 1KB5A 3VRIB 1ZMYA 5C0CD 3PWUA 1QFWM 4XT1C 4EOWL 4ZTPH 4BQ8A 5LKNA 3L95B 3BWUC 1U8HA 3HR5A 1I9JL 1DN2A 2CUHA 3I6KA 4O2CA 5DD6A 1U8PB 2B1AL 2F58L 2VDLL 5I18L 5I17B 3KYNB 2DB8A 1IM9A 1U3ZA 1WTGT 1JJUA 3ELAT 1G7QA 4PJ5B 1CE6A 5GS0D 4XCEA 2XZAH 4HIJB 4KROB 1BECA 2M1KA 4YZFE 5J1AA 2AV7A 3LKSB 1AFVH 5HHOB 1AC6A 3MLUH 3FJTA 3SOBH 5F7WC 3Q2CA 5FYJD 1HXMA 4L9LB 2DL2A 2W0LA 4XVTH 4ZNEE 3Q6GL 3TN0D 3VU2A 1HSAA 1HI6A 5F1NA 2GTWA 2ADGB 1KJ2L 1YNKH 1DBBL 4OGYL 3EW3B 1T7ZA 5CZXC 4GMTL 5FA4A 4Z7WF 4NQED 2BFVL 4OF5A 2DD8H 1HHKB 3SY0A 1YY8A 5LG1A 3TV3H 3FB6A 3PL6B 3EOYG 5CLTA 4NZRL 4KTDL 1UB6A 2D7TL 2NPLX 3MV8A 3I6GB 3PXHA 1X3DA 4AMKL 3SO3C 4R7DA 2B20A 2EH8L 4CJ1A 3TN0C 5E24E 3GMPB 5EPMB 4FXKB 3MC0A 3QG6B 1HH9A 4PJ7E 5HHMB 1WITA 1I7ZB 4PY7B 4H20L 5HHPA 4PJEE 1CFQB 1YUHB 3B2VL 2EDEA 3T04D 4PGCA 3QHTC 1Q0XH 2Q8AH 3P3YA 2VXVH 4MQTB 4LSSH 4QHLA 3S36L 4N8VB 1GGCL 1WVZA 2P5EA 3TWCL 3T3PF 4HIXH 5LQBL 1UENA 1A9EB 3SKOA 4O4YL 5F7DA 4AZ8A 4P5TD 3OXRA 5TQ0H 1IGJB 4Y5YB 1AE6L 1FZMA 3P0YL 1UXWB 1MCOH 4ZFOB 4Y19B 2WZPD 1BWWA 4MA3A 5F9OH 4EUPB 3GIVB 1EAJA 2XWJA 4HHAA 5CEZE 4HJJL 4OQTH 2UZIH 5EBWA 3O4OB 4P49A 2FD6H 5D96C 1MIML 1UM4L 3HC0B 3SE3A 4AIZA 1JWUB 5KSBE 3PIQB 4XP5L 3RZWA 5DZOA 4JM2D 1S7QB 4OCYL 1S7XA 4PJIB 4GFTB 1V3MA 1INQB 4P5TC 5E1AA 5FYJL 5T5FL 2F19L 4PJCE 2PCPA 1DCLA 1TNMA 4HIHB 2P5WE 1HYSC 3QQ4B 3TBWA 3VE0A 3LEVL 1E4XH 1MAML 3P0VH 4HK0A 4KXZI 4M6NH 1I8LC 5I15H 1CF8H 1AR2A 1U8HB 4TPRH 2R2HB 5C9KA 3IRPX 1ERNA 4O2CB 3GI9H 4WRLA 4I1NB 1ZLUK 5ALBL 2FH8A 3T0EC 4LDOB 4R7NA 4U6XA 3P9LB 4J1UA 3FQNB 3W9DA 4XNQA 3MJ7A 4UILL 1E27B 3C6SA 1EDQA 4Q0XL 1CGSL 3TF7C 3WIFB 3P9WB 5HVFB 2QSTA 1K8DA 4TQEH 2CRMA 3BH9B 3UTTB 4H0HB 5F9WC 1J05B 1C16A 4R4FL 3D25A 2P8PA 3KPPA 1BD2B 4LSVL 3O6LL 1NGPH 5CSGA 2X4NA 1X4YA 1KFAL 4LIQE 2GTWB 4YLQT 4ELME 5LBSH 1ND0B 3WXWL 3KYMB 3FQWB 3HMWH 1CD0A 5BW7A 1BP3B 2P49B 2J1KA 4TYUA 1T5WB 2P1YA 1W0YT 1IL1A 4RFEA 3AXLB 2Z8VC 2CGRH 1T6VN 1Q9LA 4X4ME 3VH8G 1DQJB 1A22B 3QR2A 3VXRA 1MEXH 1TNNA 3VXSD 4R7DB 3R8BB 4Y4KB 5L0QC 3IKCB 1JPGA 1FE8L 3DXAD 1EUTA 2E7HA 5DRWB 3BP7A 3QEHB 4ETYA 4EJ1C 3WD5H 4MB3A 3IRZA 2G60L 1CQYA 4JEGB 3QUYA 3LQAH 4UIMA 3V4VH 2P24B 2B1HL 2VERN 3CCHB 5IFJA 1OTSD 1WTLA 4KPHL 2C5DC 1X5HA 3C60B 2IALA 2R0KL 3MV9B 1T0MA 2CRYA 3U9UB 3MLXH 4K3GA 4D0DB 3IYLW 1ZV5A 3RWFA 5IHBA 4GUPA 5EN2B 5D2NB 4E5XA 3QO0A 1DE4B 1JPFA 2A1WH 4F7TB 4G3YH 5EU6E 3UAJD 3GSXB 4D8PA 3FB7A 1FZOA 1U95A 2X89D 3CUPA 1UA6H 4OUUA 1AR1C 2CXKA 3KPNA 1DLHA 2HKFH 1PDKA 4JY6A 4XPHH 2XWJB 4YBHA 1SJHA 2ESVA 3C5ZD 4BQCA 3QO1B 4HEME 5I9QC 3HUJB 4AIZB 3C08H 2NX5A 1FYTD 3PJSB 1CBVL 1NGZA 1VADB 4DWHA 1ZWIA 3G5ZA 1FL5A 1CFBA 1A3RL 3SBWA 3CX5K 3C6LB 1YYMH 5GGUB 3UYPA 1D5MB 2PF6A 1A0QH 5I16B 2HWZL 3UAJC 1TIUA 1UACL 3MRLA 4EBQL 5JW5B 3QWQB 1RUAH 3SGDI 5JR1L 3O3DA 4L4VE 3TZVD 4FQ2H 3MRPA 3RWEA 4RGND 4HK0B 1EVUA 4FQXD 3MUY1 2HMID 4L8SB 3O6KH 3EYFA 3RP1A 4AQOA 3IXAB 1UQSA 5KVGH 2AKRA 1ZA3B 4R7NB 1RY7B 4HDIB 2I07B 4NQXB 2DOCA 5IMOB 4XP4L 1A6ZA 4R9HA 1K8DB 1CFSA 4JB9H 4GAJL 4L8DB 3T0BA 5AEAA 3W39B 3VXQA 1HXYA 4PRAB 5C0AD 3JVGA 1YMMB 3VFRB 1XIWA 5DHYA 1EEZA 3DECA 4OD2A 2XKNA 5KAQG 5F96H 1E6OL 2VMFA 4Q74A 5IROC 1I4FA 1TITA 3V5KA 1J12A 1N0XH 1S9XA 3D85A 2VE6A 5IBUB 5TFSH 2HMIC 1TQCC 4X5WA 2GJZB 3IGAA 3L5XL 5ANMA 4YAQA 1NAMB 3IFOB 4PRPD 4PJAE 2JJSC 4BH7A 4NO2A 4W6XB 4JRXD 2DIAA 3AFLA 1OWWA 3H3PH 3LKNA 2JIXD 4RFEB 1R3HB 3QCTL 1A4JA 2E7LA 1T2QH 4PGDB 2HLFD 3V4PH 5J3HD 5L2KA 3LDBB 4KZEH 3O2VL 3T2QA 4GRWF 3VXMD 3PHOA 3D9AH 4YPJA 3U2SA 4AEHH 5HY9B 2O26U 1NEZB 2RCSL 2FJFB 5FO8A 1ZTXH 1FG2A 2ZWLT 1XR9B 4DW2H 3T1FB 3QUYB 3ARFA 4MJ5A 1R5IA 4OLWL 2FECI 1GYAA 4JKPH 3L5IA 5GGSY 2NY2D 4R3SA 5C0EB 5DQDL 1SM3L 2ZSVB 3MA9H 2LTQB 3SDCD 1Z9OA 1IGCH 4XWOD 5HGAB 3O8XC 2R0WH 3HZMA 2QBWA 5CZKA 2XTLA 4XBGA 3RY4A 1TCRA 5D2LE 3S9DB 2A83B 1F2XK 3MO1B 4HKJA 2A6KA 4H88H 4OUUB 5CJBA 4X6FA 3AVEA 2RQ8A 1VFAA 4LMQI 1GPOH 1M6OA 4JRYA 1KLGB 1TETL 3DV4B 5FYLD 3BDYH 1KOAA 3ARDA 3NAAL 5FKAA 2AVGA 1IAMA 2BOBA 5F9AC 3L3KB 5FYKU 2B39A 3IJHB 1FC2D 1JWSB 3R1GL 3T8XA 1G6RH 5GRYA 3SDCC 1MLBA 3G5ZB 5CUSL 5D7SH 1GH7A 4AL8H 1BFOB 1GAFL 3JSSA 3LSOA 5ISZA 2CXGA 2IBZX 4RGOL 1LHZA 3E8UH 1KB5H 3MLTA 5E2JA 1JVKA 1I7RA 1BQLH 1P84J 4KHXL 5FGBC 4CNIA 1F8TL 1A7NL 5I1GL 3RWEB 3DI2B 5ERWA 1K5NA 3QIBA 5LGJB 1RI8A 2NW2A 3QEUA 1OM3H 1UQSB 1JZ7A 4PJ8D 2AKRB 2GJ6D 2VZUA 4NQSA 4M1CD 2BHZA 2BNQA 3K2UL 2VISB 2UUDK 5KSVB 3UJJL 3KG5A 3EFFA 4NC1C 1BFTA 2IADA 3EYQD 5EUOA 1CL7I 2BNRD 3WV0A 5KBNC 1NMAH 4WO4C 1CFSB 1OSPL 2Q86A 3VFOA 1DQQA 3B9VA 1KF9B 1MRDL 3PABB 5I1CH 3EJYD 3S4SA 2Z9TA 4OD2B 3D0LA 4HXBL 1R3IH 1SMOA 3BPNB 4KGJA 3QWOA 4JY5L 4PJHF 1NL0H 4S11A 3GGWB 1DN0B 1I4FB 3L5JA 3D85B 4ZOAA 1FJ1A 3AREA 3OMZA 5F7LB 1DBKL 2A74B 3GIZL 3K1KC 5D8JH 3NGBC 2HLAB 2J8HA 1YN6B 3RPIB 2Z4QB 1QQDB 5DD0L 1QYGH 4NO2B 4EN3D 3EYQC 3N9GL 2XQBL 1IGFH 4NFCA 3VWKA 4DK6A 2X09A 2KUTA 4WUKL 5L2KB 1XT5A 5J6GB 1C8PA 3FOMA 1GC1H 1F11B 5LCVH 4N0FB 4AIXA 1JV5A 5SWZA 5LXGH 3PGDB 2E27L 4RA3A 5KS9A 25C8H 4YHLL 1NDMA 2V9TA 2CKBL 3KJ6H 5INCB 1H0DB 1YEHL 5HGBB 1CN4A 3F7YB 3A6BH 1MELA 1LILA 4UDTA 4PGJA 4DQOL 5TF1L 5E08H 4Q2ZB 1Z5LB 1GGIH 5DK2B 2FZ3B 4MNGB 3H7LA 2H2PD 3WFEL 4HGMA 3I75A 4I9WD 3C5SA 5EIVA 1DDHB 5EUKA 5CAYB 2ZOKA 2YPLB 2BSSA 4PB9L 3O3AA 5CP3A 5MEQB 4UQ2B 1LE9B 4H26A 4CADA 1S7RA 1U8NB 3IVKA 1K8IB 5CBEA 1VKXA 2ICWB 4NQTA 5IBTL 1JI1A 3HNTH 4HBQA 3ZT6A 3IDNB 3N1QC 5B3JF 5C0BA 1N64L 3B2UC 3FQXA 3WFDL 5FKAB 1MFDH 4F33B 1KT2B 2BOBB 2H2SC 3OWEA 4K71B 7FABL 5IF0B 4NGHH 4Z5RB 1S7WB 4Z78A 3H9YA 5J7CC 4KMQA 4QOKA 3N06B 3B4NA 3HE6B 4XHQA 3QIUD 1WBXB 3AM8C 1TXKA 2H2PC 4OUOA 3TT3L 5C09E 4MNHB 2IAMA 1TJHL 2DRUA 5ISZB 5MEPA 4AG4H 3FOLA 2AW2A 1BIIA 4MDJA 2VAAB 3WNPA 3O6ML 1XCQB 3LY6A 4FFYL 5HGDA 5DRNB 3GSOB 2XTJD 3RY6C 4JJ5B 4UUJA 4CNIB 1TJIL 1ZLVH 2O61B 3RNQB 2QQLL 1VFOA 3MPCA 3O2WL 5TDPA 4R96B 4LEXH 2RGSA 1P1ZB 2NW2B 4M43L 5BMFH 1QBMH 2VZVA 1YEGL 3RL1A 2C3VA 5D7IE 1MI5A 2BNQB 4P3DA 5D1ZB 3TIDB 2BRQA 3HN3A 3ZKXC 5MERB 2FECL 1GOFA 1GOHA 5D7LB 2R0ZH 1IEHA 2I5YH 5EIQA 5CGMA 2FO1A 2Q86B 4MXWH 1NGQH 5KW9H 2DQHH 3HNVH 2R23B 2PTUA 1CDGA 3ULUD 4KU1A 2DJUA 1JF1A 3HLAB 1B0WA 1PKQB 3LAFA 4H25A 4RMWA 5D1XA 5D72L 3NIGF 5DD5H 1FJ1B 3AREB 1R0AH 2A9MH 3THMH 5GS2H 5I1IH 3TNNB 5DJZA 1NJ9B 4TUOA 3JWDH 1KIRA 3PP3H 4PRIB 2Z35B 1DQTA 1RUML 1JWMB 1WWBX 2WMPA 1GGBH 5GGQL 3QHFL 1F4AA 3U4BH 2H6PA 4D9RE 3DVNA 3VWKB 1X5AA 5BQ7A 1NFDF 4PRHB 4X5XB 4XCFH 3D2UB 3LS5L 4IMLA 4Y5XA 5CCKL 1JPTH 3DX9A 3K8LA 4JPIA 1WEJH 1N2RA 3VG0H 1ES0A 5HDLA 4F7PB 3EOAB 5KS9B 3L6FA 3NA9H 5FHBH 3QULB 1B90A 4WFGE 1RJLA 4XGZB 4P99A 2E6QA 1OP5H 4LSTL 2VQUA 3QXUA 4JHWH 2YS4A 3MUZ1 3BQUB 1ACYH 1NC2B 3EOBB 3PWNB 4UNTA 4XNUH 3QUXD 3GSQB 3MNZB 4RDQF 1MJJB 5JW3H 4HQQL 3QWRD 3MRDA 2C9AA 2EDXA 1J1PL 1AHWC 4V3EB 4KMTH 4ONOA 1S78C 5EOCL 4W4NA 3MRNA 3FRUA 3V7MA 1BBDL 1JGEA 4LVNB 1CL7L 3DUSA 4KKNA 3MJGX 3O3AB 5MI0B 3W0WB 3X12A 5KVEL 4DFIA 4GO6B 2YPVH 4XCCL 3SJVE 3VFTA 3ARTA 3GRWL 2CUIA 1HKFA 2VLKB 1FN4A 4MA7H 1MHHB 4NZDA 1WT5A 4ZPVB 4ZFZA 5ICXB 4Z78B 3B43A 3VXUE 3DPBA 3IDUA 2IH3A 5JZ7D 4QOKB 4M9PA 4JN1L 2Y1VA 2XZCL 3BWAA 4XMLL 3ALPA 5I8CA 1XR8A 3A67H 5EZLB 5HGDB 3ISWA 3FCTB 5SWQA 4PJFB 1A4KB 3OKYA 4M3KB 4MA1C 2A6IB 3WUWA 1BIHA 4NDMA 4W6YB 4OZHF 3NFNA 3RL1B 2C3VB 5HI3D 4OF8A 4JO1L 5F89A 4OCRL 3IFNH 2PKDA 3GMLA 3P30H 1NGXB 5JZ7C 4LCCC 2NY4B 3DGCR 2VOTA 3JV6A 4HUKB 3BKJH 3HI5H 4ODSL 5IR1A 3JWNC 4OLVH 2WAHA 5KVFL 1JBJA 5HYFA 2YEZA 1MCPH 1MFBL 4KTEH 1TPXC 2AABL 5KANG 4XC3L 4JFXA 3IFPB 3U4EB 1JHTB 1FBIH 4XXCC 3U82B 4MD4B 3S35L 3OG6B 1CXHA 4E0RB 1LNUA 2J7LA 4P3CL 3EYUL 4JHAL 2DL9A 3IDJA 4PV8A 1FVCB 1KJ2B 2EIZB 1KEML 5HI3C 4J2XA 1ZK9A 1FORH 2VZ3A 1LP9A 1VEPA 5IB2A 4R6UA 4LKXB 2E6JA 5DUBA 1IC7H 1MVFA 5MEOA 4CKVX 5F3BA 3H3BC 5DMGD 3MOAL 4CUCA 4LAQH 4M6AA 3BZEA 2DLGA 3EDKA 4YDIH 1NCDL 3N50A 4WHCA 3CFDA 3QISA 1Q1JH 4JFFA 3KS0J 5FM5O 4S1DD 4Y5XB 5A2FA 4JO3L 2NTSP 3QIWD 4G7YH 4ODWA 2WBWB 2AERT 1NDGA 2FX9L 2AK4B 2WP3O 4RAUA 4L4TB 4XZUA 1CG9B 1P4IL 3O11A 2FLRT 2Y36L 5D5MA 1RK1B 5E6ID 1LEKB 4PTTA 5IB5B 3NTCH 4LSRH 1I8MB 3GSVA 3BIKA 2C7UA 1XF5B 3GJEB 2AS5M 2F8OA 3BEVA 3WJJC 5DMGC 2LVCA 4PD4K 3ROLA 3DX7A 5C0RH 2OK0L 4WTXA 2YHGA 1HINH 4YIQA 5C0CB 2AJUL 1EVTC 4BZ2H 1AC0A 1M7IB 4P2RD 1CLZL 3VWJA 3D69B 4FQIH 3QIWC 5SX5K 4DCQA 4BKLB 1RIUH 5BZWA 2IANA 1AQKL 3CU7A 4XX1G 1HN1A 3CPLA 3BPLC 3D1MC 4ZAKD 3FT3B 1Q0YH 1SHMA 5DVKA 4LLMA 4DKDC 4V1DA 2XN9D 2WBJD 3JWOC 1CS6A 3KWWB 1RUQH 3LZFL 1S9VA 1JK8A 4XPGH 4XH2A 2ID5A 3HS0B 4BFIB 4NBYB 3SO3B 5BV7L 4HIEB 1LO3H 4KAQL 3P9MA 2XZQL 5IQ9A 4DAGL 2AAVA 3MRBA 5HYJA 3PWPD 3TN0B 5SWSB 3WFHA 1ZAGA 4LPCA 2EDKA 3QZWA 3QI9A 4JFDE 2FB4L 4QRRD 1U6AH 4KK5D 4F3FA 5DRXA 3CSPA 1RZ8B 3KPOA 5J9PB 2KL6A 3ZHDA 4G80A 4IRSA 5IHUL 2FX7H 5MP6H 4NNXA 1HHGA 1RU9H 5L9DH 4Z9KB 1LO4H 3PGCB 4DUWA 4JPWL 5D6CB 4HMDA 2WBJC 1U58A 4CRPA 5GSRB 3GMLB 3UYRH 3JV0A 3ZHKA 4YZFF 1OLZA 4RX4A 2L4OA 3T2PA 2VB5A 2VXUL 2NTFB 4R26L 1GSMA 1T1XB 4NO3A 3WLBB 4XVJH 5IR1B 4NN5C 3U36B 4F80A 4N0UA 1R24B 4X6DE 3QNXA 3CNKA 5ADPL 3HNSH 4L3EB 4LOUD 1AIFA 5EO0A 3MRKB 5E9DB 4KK5C 4FTVE 4LF3B 1QFWH 5JUEL 2RIKA 5D96B 3BZFA 4MNQD 1PG7L 1BBJA 2K7QA 4WWKC 1WBZB 1A14H 1YC8A 1DVFD 4PJXF 4ZD3H 4ZUUA 4KKLD 4XMKL 5FDWA 2NNAB 3G6JE 5DQJA 3STLA 4P9MH 4TN9A 1MAJA 5I76B 4M93C 4IIQC 4AEIL 1DBML 3DARA 5DUBB 3PV6A 4X83A 3W2DH 5DO2D 4X5LA 2DTMH 2FGZA 5CINL 4XP6H 4RNRA 2NW3A 2X4SB 3LKOB 3CC5A 3PF2A 3RVVD 1F6LL 4I0PD 1MFAH 1X5JA 1MLCA 4CL7A 1IAIH 1JHLL 5IFHH 3BE1H 4LOUC 2ARJA 4OZIA 3FB5A 1Y6NR 3KPSB 3MREA 2EYRB 3TFKD 1H3GA 4P5MA 4PJGA 3JUYA 1UWEH 4PJEF 1OCWL 4RAHA 3U7AA 4BELD 5ILTH 4I4WA 3T0EB 1DVFC 1UCTA 1O7VA 4KKLC 3BGMA 1EK3A 2DBLL 1NCUA 2V9QA 4O51B 4N0CD 5E5UB 1GRWA 2XZZA 2ZJSL 4Z7OE 4MHHG 3DMMD 3ULSB 1Q72L 4LLQB 3BIKB 5IB1A 3DWTA 5TE6L 5ESQB 5DO2C 4S1QL 1FNGB 1D9KD 3HI6H 5F9WB 3VGGA 1QHOA 1F58L 2XA8L 1NUDA 4YDVA 5GGRA 3DSFL 3IDGA 3CXDH 2JB6A 2AEQH 4L5FL 5IMKB 4KZDL 5CP3H 1QNZH 1I3GH 4PGBB 3TYGH 4XP9H 5SX4I 4MCYA 3HAEB 1RUPL 4PLJD 5EIIB 3CDFA 1JI2A 2YD2A 4NSKA 2LE9A 3CPLB 2VN7A 4G6AC 4P57A 3OB0H 3VI4F 4E41E 5ACLA 3V0WL 1YNLL 2AGJH 1JZ8A 3DMMC 3MRCA 5D7JC 5LWYL 5CEZL 4D9LL 4H0GA 3S4SG 2DYPD 2HFTA 3TA3D 4TOYL 1D9KC 5IB4A 4FABL 1AGEB 3I85A 4C4KT 1A6UH 1JK8B 1S9VB 4I18C 4C57C 1DQMH 1FHGA 4WHYH 4XHJD 5L0QB 3M45A 1ACZA 5B39A 1Q9OB 2V6HA 1IEBB 3CMGA 5IQ9B 1YQVL 4EI5D 3PQYD 3QDMD 3RIFF 3WFHB 5M94B 4UI2A 4FQHA 1XEDA 4PLJC 4F3FB 3OJVC 4Z7NE 1O7SA 3DETC 3ZZ1A 1I9JH 3GSRA 4F7CA 3MYJA 4WU7B 3CSBA 1U42A 1JGVH 3D3VD 3NCBB 4YHOL 3ILQC 2GTZB 2F58H 4NNXB 5I18H 1KJ3L 4QHUB 2YMXH 4ENED 4KHTL 2I9TA 5KVDL 3D18B 1RULL 3AB0C 3KLAB 1U3JA 1JYXA 4U1LA 1JGUH 2Z31C 3CD4A 5DDHA 4KVCL 3QJHA 3GJFB 4RSVA 1S9WA 4XHJC 4PBWD 5C0NC 5JORA 1J0IA 4EI5C 4HWUA 2Y6SC 2JJTA 2OL3A 2NY3D 3RWCA 1R5VB 1AIFB 2IFGA 4J3OC 1RV6X 1QRNE 4YDKL 4ELMF 3MV7A 3BISA 1UKQA 2A6DA 5I9QB 1KJ2H 4OGYH 5IT2H 2ZCHL 4GMTH 4QHKJ 3FFCB 3CSGA 3DJ9A 1H5BA 3IU4L 4OI8A 2BFVH 2X4QB 1UC6A 3B8SA 5B8CC 2PO6D 1RZKC 5E8PA 4LIQL 2EDRA 1K6QL 5EU4A 4NZJA 3MX0A 1RIHH 4L4VD 1TQBB 1U2HA 3WFZA 1IFHH 3BHBA 3BO8B 3GNML 4NZRH 4KTDH 2D7TH 4JPKL 5I1LA 1N5YL 4ZYKB 3JV4A 4HUXB 4JFQB 3O9WA 5EFIB 4AMKH 2OM5A 3S6CA 1VACA 3MBEA 4C56A 2EH8H 4G6FB 3MR9A 3MROA 3VRJA 4HMCA 5K9KB 1KCRL 3IB4A 1QSEE 4PJGB 3BZDA 2XG5A 4TTDC 3V0AC 3MZTA 1WCBA 4JO2L 5BRZB 1FYTB 2IQ9L 5JO5B 1EO8H 3CMOL 3VD9A 4QHMB 5CSBA 4QHNA 1V3JA 2PO6C 5A2JH 5C6TH 4G8GA 4GRWB 3ILPA 2DQIL 1WAAA 2YWYA 32C2B 3LKRA 3QPXL 1DEEB 4J12A 3RWHA 5LGKA 3TYFA 2CLZB 3TWCH 1ZT1A 1S7VB 3UPRA 5GRWA 4O4YH 1YEKL 2HH0L 4PJDA 43C9B 3VGEA 5EU3A 5EB9A 4M4PA 5GGRB 1KJVA 3H9HA 5I2IA 2QADD 3KPLA 3SDXF 3AGVA 4OIIL 1KPUA 5DJ6A 5FUCE 4RFOH 1QACA 3ZT7A 4JFOA 1Z9LA 1HOCA 1PQZA 1TQCB 3T65A 3MV8E 1T1ZA 3UBXI 4WIQA 2Z91A 3NABH 4WGVB 1FH5H 4R4BA 1RZKL 1UM4H 4NSKB 3K8KA 1I1AA 2CDFA 4MD5B 1F4YL 4P9HC 1PZ5A 2F74B 3LB6D 2NY7L 4OCYH 4GG6F 1BQHB 3DROB 3K7UA 2P8LB 4Y4FD 2H26A 3BRGC 4NUGH 1AO7D 1I3VA 5D70H 4HPYL 2F19H 5C07D 3MSPA 1RJZA 1ZLSH 1G9MC 5GJTL 3AY4A 3AAZA 3NH7L 4M8QA 5B39B 3ECBB 4JHZA 3WMSA 1MCWM 2AJYL 5FCSH 3VD3A 3LEVH 2BNUB 3FMGL 5HHNB 1MAMH 3MFFA 1B4JL 3WHXA 4N8CL 4U1SA 4APQA 3UTPE 2W0PA 3IJYB 1A7PL 4ONHB 3E6HA 3RBSA 3LB6C 3O6FA 2OMBA 2QKIB 4UILH 4Y4FC 4Q0XH 1CGSH 3O8XB 3WL9B 4NQCA 1MHPL 2X2YA 4TSBH 4IOIA 1H3PH 2UYLB 4JPVL 4YO0A 3O2DA 4K2UL 4FQLL 4LDEB 1P5VA 1FAKT 4JVWA 3CFEB 2DI8A 3ARBA 3W11C 2G2RB 4R4FH 5H35A 3CDGB 3MXVL 5J06A 1ETZB 3UTSD 1EZVY 2JTDA 2R1WA 4O9HL 4HFWA 1QRKA 1D6VL 4LSVH 1LE5B 3O6LH 1ROWA 4P9HL 4UT6L 3SKNA 3L7EA 5IQ7H 4WFEE 2GI7A 1YEEL 4L8CA 4K94H 3RTQA 4P48A 3HG1D 3DNKA 1AQDA 1P84K 1IM3A 4LVEA 4YBQD 3T77B 5IV2A 1IC1A 3OX8B 5CJXC 5T33H 2Y9RT 3RWDA 2X4TB 4JFEA 2FJHA 5E8PB 3D39D 2DLEA 1I3RA 1G9ML 2DQGL 1OTTD 5EU4B 1IGTB 4PJHB 4X7SL 4G5ZL 8CGTA 1T66C 5IK3B 3QFJA 5F1KC 4PTUB 1JNLL 4KQ3H 4IEFB 5SV3A 1I8KA 3KXFD 2Y72A 1PD6A 2E7BA 5CEYA 2GT9B 4DTGL 3MBEB 2BVPA 4QTHA 3EFDH 5JHDA 5ICZA 3GHBH 3QEQB 5I0ZA 4NCC1 1UEYA 4K7PY 1OP3H 1OSZA 4HS3B 3BKCL 4MZ3A 2G60H 3SDDD 3AMKA 1MJUL 4I13B 2CKBB 3ARSA 1OGAB 4ZXBD 3MLWL 2Q8BH 4KPHH 3QXAA 2R0KH 3RWHB 1T4KA 4WO4B 3H6JA 4O02L 1P4LB 4D0CB 4N9GA 3A0OA 4LU5H 5FECA 4TVPD 4PJDB 1KCUL 3WUWG 5D2LF 3QDJB 3L3IA 3GK8H 3HB3D 1Y6MR 4G43A 4LPXA 2DQTL 5CJQH 8FABA 2BSRA 3M17A 4G59A 5I2IB 4X99B 1B2WH 5DJ6B 1P6FA 3NCYP 4U1GB 3SDDC 3EO9L 3MRFA 2DKUA 2NY5C 3S34H 4L29B 2QQNL 3S36X 2GJ6B 3DRTA 3RUGA 3NGBB 4OCWL 1R3JB 4UIKL 4ZXBC 3ES6B 5I66A 3K80A 4JZNB 4PRDA 4ETQA 2B8OT 4V3DB 3T0VA 2AK1H 1JYWA 2DQUL 5L6YL 3OPZL 1EEYB 3MLRL 4HEPG 4Q58C 3UTOA 2BK8A 3ARWA 4NCC2 4PY8I 3LRGA 3BUYA 1J18A 1ZLVK 2HG5B 3HB3C 1CFVH 4GRLA 2RHEA 3AAZB 3IF1A 3SE4C 2AJ3B 4X7FC 4YHML 3VRLE 3MBXL 3RWGA 2AP2A 3RGVD 4HFUL 4Y1AB 3LCYA 4OZGE 4E9LA 1IGMH 4PRBA 5CWSA 1BVKA 4M5YH 3Q6FB 4AENB 1MHCA 2B7DT 3HC4H 3BSZL 3M8OL 3MRIB 5EOTB 4DOHB 3T1WA 4OV5B 3TBTA 2ESVE 4X0KB 5C08A 5KG9A 1W0VB 4MJ2A 4XP4H 5A1AA 4K9EC 3QCUL 1T7VA 2AXJA 1AH1A 2NX5E 2YZ1A 5B22A 3TESA 3QRGL 4CN4A 2ZPKL 4LCWA 4Z7QE 4JZOA 3RVXC 1W72L 1E6OH 4NRZB 1YPZA 4OZ4B 1BWMA 1AY1L 3QUMB 1GCFA 2J3SA 4QF1A 4Y5VA 3RTQB 4QRQA 2WWKO 4WGWB 1AQDB 5DK0A 5JMOC 5FYJU 4DZBA 1KN4L 2VLRA 1ZVSB 1AP2A 1K9TA 1XGTA 3VFWA 5EBMB 3KPRA 3GO1L 1CZ8L 3MJ9L 4UU9A 1WC7A 5DQ9B 1IRAY 5DR5L 1OVZA 3I3DA 3L3GB 3QCTH 4P2QD 5CJ8A 3OKDA 3JTTB 1ZXQA 2OR7A 3QFDA 3VXPB 5CILL 4AT6B 1NLDL 1W0WB 4UTAH 2MTPA 1T21B 4MS8D 1NCNA 2DM7A 4JFPA 4RWHA 4NKOA 1AGCA 4XX1E 4BZ1L 4ISVA 1OP5K 2RCSH 3MRMB 2H32A 4QXTA 4OLWH 4TULL 1F3DH 1NFDB 4K9EL 4A6YL 4ZMAT 3HE7D 5DQDH 4LNRA 4KXZH 1AXTL 1G7PA 1SM3H 3BW9A 5T1KA 2GK2A 4HUVB 1C12A 4O2FB 2W91A 3I02B 3QZWG 2Y5EA 2HN7A 1KLUA 3L3OB 4Z95L 1ZSDA 1JGDB 3QDGD 1NBQA 3CLEH 3RZCA 2PYED 3L3JA 1RJCA 3FTGA 2LU4A 8FABB 1Q9KA 2BSRB 4YQXH 3WDIA 2VLMD 3REVB 2E7LE 3AC0A 2R69L 1G0XA 4OSUL 3UTQA 1J8HA 5LGHH 1HK6A 2F53E 1MCHA 3REWA 3UYOD 5AAMA 3HE7C 5I66B 1QSFD 3BX7C 4K3JL 1JFQH 4EXPX 2FHBA 4Z0XB 1T2XA 5CUSH 3OAYH 3ZMRA 5HHXH 2BJML 2C1PB 1B4RA 1GAFH 5CKGA 1FNEB 3BUYB 5T5NG 2KQMA 2Q87A 4LHUB 4X6CA 4JO4H 4HAFA 4GS7C 4R90H 5FUOL 4KHXH 1F8TH 5EU7E 4CMMA 4BK5A 5I1GH 5JPNA 2AV1A 2K7PA 3NCCB 2G75A 2YBRA 5D7IF 4P46A 2IPKB 4EEEA 4M8VA 3WIHL 3GM8A 4HUMB 5TGBA 1AD9B 4HJ0D 5I1HL 2J6EA 1BVKB 2L0DA 3BFOA 5J6HB 5L88L 3Q3GA 3RA7L 4JRYE 4N8VG 2CDEB 3GEWB 3UJJH 5FEBA 2X7LB 1FG9C 2NXYC 3CFBA 3HC3L 1BOYA 2PW1A 4KGLA 4QRPA 1OSPH 5HI5D 1UKTA 1SEQL 4OCXL 3SJVD 1JRHL 1TFHA 2OL3H 2AXGA 5C0GA 4OZHB 1D5BB 4LCWB 5GZOD 3GSUA 3KR3H 4HXBH 4BA8A 2FWOA 4OCLC 4ODBD 3MA7A 2GSGB 1DUZA 2XYCA 1MVUB 2J5LC 4JY5H 1EAPA 2PTTA 4XMPL 4Y8DC 5DWUH 5I30L 3VXUD 2ARWA 1E4WL 4U3HA 1DBKH 4ODHL 4PUBL 3ZE2E 4BFBD 4JQVA 4HJ0C 2XWTA 1JP5A 5HBBA 3K3QA 4P3WA 1E4KA 5A3ID 4P5KA 4UV4L 4BH8B 3BVNB 2V7HA 4JKKA 4R4ND 5DSCB 2MQCA 4DKAA 1NGWA 1OAZL 5DTFB 3N9GH 3NACL 4DFHA 3DO7A 1MSPA 2XQBH 5HI5C 4Y4HA 3ARGD 3W5NA 4P23C 3DV6A 5C86A 2VABA 5GZOC 1VEOA 5F6HJ 5CEXB 2NLJA 4WI4A 4MB4A 5EUOE 5CS7A 1KGCE 2NY0C 4NHUB 1X5FA 4ISVB 4MA1B 5CD3A 1LD9A 5IOPB 1U41A 2P46B 3TP4A 1W8OA 1CFTA 3FB8B 1ULVA 3SGDH 1CK0H 5JLZB 4DQOH 1TZHB 4L8BA 5TF1H 4LCCB 4MXQA 2F9BT 4PJ7A 5INDB 2YUZA 3MRGA 5E03A 1TZGL 2VAJA 3DBXB 1T0NB 4J3TA 3P40A 1I8IA 4PJ9C 5I1EL 1R3KB 5CP7B 4WEUD 4PB9H 5I74C 1YNKL 3FZUC 5F6IC 1K4CB 1YN7A 1EHLH 3ZTJH 5IBTH 3TJEL 2VZOA 5DJ8B 1EMTL 3HZYB 3REWB 1IGYB 4GKSB 5SWZE 1VESA 3TV3L 1KTLA 1YEJH 2V2WB 3O81A 4ZFFA 2AJZB 2FBOJ 3EHBC 1S8DA 1TVBB 2N1KA 2PXYD 1N5AA 5BS0B 5KSBA 1TJHH 4D9QE 3IU3A 3SGEI 2VQ1B 5BO1H 5TDNA 5BV7B 3SCMD 3O6MH 1YEIH 4RA0C 1UJ3A 5I1DB 4FFYH 5D93C 1FVEB 1NKRA 5KSAD 3KGRA 1Q0XL 4CMMB 1H9VA 4YHNB 2VXVL 3IAPA 4PJCA 4LSSL 5ECJE 2X40A 4QRUB 1O0VA 5IKCA 4M43H 4NPYA 5H94B 3TBVB 4X80H 3RNKA 3QPQD 3LQZA 4NO0D 1EFXB 1XCTA 2X9WA 3B3IB 2PXYC 3O2DH 1WLHA 4LLAA 3H0TA 4UQ3B 3CFBB 3NZHL 2D2OA 1I1FB 2Z93B 5FYKD 1NKOA 3OGCA 5F9OL 5DJ0B 1M71A 2EDBA 3DX6B 3L3DB 1FFNA 3SCMC 3GSNA 3QIWB 4OBSA 2UZIL 5CGYC 5IHZB 3DURB 1Q94B 5EZOH 2CSPA 1N8ZA 3T4AA 3BPLB 2ZCLL 3EAKA 2X4UB 5ESVB 2R2EB 3WUZA 5EH1A 1WISA 3PNWB 4FOMA 3QPQC 5GGSA 1I7UB 5D71H 4JG0H 4C83B 1JGLH 3I3BA 3CJJA 3LS4H 1RQ5A 4LFHD 3F12A 3G6AA 4X6EA 1T0PB 3QHFH 2DWDB 4JZJC 1MI5E 2NY1C 4M7ZC 1Z2KA 4P2RB 3ZTJG 1S3KL 1E4XL 2QHLA 1K85A 4M6NL 3MRHB 3LKPA 4F9PC 2NLJB 2MCG1 4TPRL 4U1NB 1LK2B 1H8SA 5C9JA 3BD4A 4X4MA 1B0RB 5CD3B 2DQFB 2R4SH 3RDTB 1E28B 5EBGA 3TIEB 3LQAC 5IWLA 3R0MA 5E00B 1HHHA 2WBJB 4NQDE 5IEKB 1KNOB 4L8BB 3EIFA 4J6RL 4CAGA 1K4DB 4AYFA 1C08A 1G7IA 4PJEB 4NN5B 4CVZB 2EKSA 5AUMA 4WU5A 2GAZA 5DRZA 4P2OC 4ZO8A 1WZLA 5EOCH 1QFOA 4OGAD 4PG2C 5DFVD 1CL7H 1HH6B 2WM0A 4N1EA 3V5DB 1MFCL 2EEDA 2HAZA 1FNSL 3HMWL 4I5BA 1JMZA 1FNHA 4WWKB 3IDYC 1A6TA 5F7HA 2AXFA 4KV5E 1WZ1H 1LWRA 5HHQB 1U92A 4S0TD 3V6OA 5HYIA 5C0JA 4IIQB 2HJLA 1U8JB 1MEXL 1YC7A 3K4DA 4MJ6A 1AGDA 3OKMB 4Y2DD 4NQEA 1A6AA 3VFNB 1F3JB 5KAQF 1MHEA 2B0SL 2XZCH 2N4IA 3QJFA 2R9HD 3RI5K 3C9NA 5EBLB 3LQAL 4N68A 3M1BB 1A7QH 5DVNA 3KPMA 1DVFB 3DHMA 4OIAA 2FIRT 3X3FH 2VL4A 4GW1A 3MLXL 3G5XB 2P5WB 1I7TA 1XMWA 3RNKB 3LN5A 3LQZB 3DX8B 2IWGA 3HPLA 5BXFA 5GXBB 1BM3H 4Y2DC 4G3YL 3H42H 3PL6D 1I9IL 4S2SB 1KTDA 2VLJE 2HVKA 4K7FB 2QV2A 4UINL 3T2OA 3W81A 1U3HA 2R1XA 3H0TB 4YXHL 1ZT7A 2OLDA 4ODSH 3SGJA 4L9DA 3EYVB 2HKFL 1IILE 3V6BR 5KVFH 4XVUD 4HULB 1P9MA 1QBLL 2ICWJ 3MLZH 1BVLA 3EDEA 4W4OC 4G9FD 2WNGA 3O0RL 5HHMD 2W9EL 3C08L 3S35H 4OLZL 3H9SD 3MV01 4P3CH 4JHAH 1D6EB 5E70A 2YSSB 5IIEB 2FNBA 3G6JF 3DMMB 5D7JB 2JCCA 1HHJB 1KEMH 1HKLH 4J4PA 3ROOA 2BOCB 1YYML 1Z6JT 2BMKA 3V0VA 1U8QB 1XAUA 3S5LB 1D9KB 4NRYA 4YFDB 4OTXH 3RIAK 1ZA6A 3VGHA 1FQ9C 2JLLA 5E8EA 5I8OL 5J11C 4ELMB 4JM2A 1MCEA 1RUAL 4PJAA 5E4IA 4FQ2L 4XVUC 1NCDH 4I8DA 3VXNA 3NFPA 1F6FB 3O4LE 4Y19D 1U8IB 4FQCH 1BOGA 2H9GB 43CAB 1NCWH 3TCLB 3U4AA 5FA3A 5KVGL 5CMAA 2FX9H 4JAMA 5GRJL 1SEBB 1P4IH 1OAYH 2Y36H 1D3CA 3AB0B 1HHHB 1G7HA 3PWJA 1JTPA 2DS4A 3U1SH 1QR1A 2Z31B 1MOEA 4BSWA 2H3NB 5MHSE 3TO4A 2Q3AA 4OGZA 2OK0H 1LEGB 3FO2B 2EDYA 3K74B 4EI5B 1LP9E 2ARJQ 4WU5B 2CR6A 4LP4A 3TC9A 1CWVA 1BZQK 1X5IA 4GH7B 1N0XL 5DC4B 4Z0BH 2D31A 5TPWH 5TDOA 4M7JH 3UZQA 4WI2A 5TE7H 3D3VB 4I2XA 1CIUA 3V5HA 3QNZB 1AJ7L 5EU6B 4JFFE 4JQXC 2EO1A 3DRQA 3B9KC 5B8CB 4E42B 3TVMA 2BSTA 2VKXA 1T2QL 5CIPB 2VTFA 3V4PL 1NGYB 1A3LH 3MGOB 4XBPB 2ZZUT 4EKXA 4KZEL 2O5YL 3DTXA 4OCNC 3LZFH 1FP5A 5J1TC 3UTTD 1YZZA 1BJ1H 3QUKA 4JFZL 5BV7H 4KAQH 2A73A 4KDTA 4JCMA 5HPMB 2XZQH 1OF2B 4DW2L 1VGKB 1BD2D 1UZ6F 2FB4H 4JKPL 3WS6A 3IDIB 3VXSA 2MWCA 3DXAA 3MA9L 2W65A 5IHUH 5KVMC 2XICA 1J1XH 1NH6A 6FABL 2IANE 4R0LA 4L4VB 2BY2A 4AH2B 5SV4A 1BJMA 3B6SA 2ZUSA 4X7CC 4MCZB 1KTDB 2HVKB 4R26H 3EO1B 1DUYA 2YD6A 4V1DE 4PJIF 4Y4KD 1ZGLB 1NBZA 2BVEA 2YWZA 5HSFA 3ESUF 4XAKD 3QQ3B 4YEFA 3NIFE 1CDHA 4MAUH 5ADPH 3ZHLA 2ZP0T 4Z7UF 3BDYL 5ALCL 2MHAA 2UWEE 4J3XA 5JUEH 1FV1B 3S8WA 2X89A 5HYJE 1QO3A 1G6RL 2HFFB 3KHQA 3HHRB 1WGOA 2IH1A 3GDBA 4XMKH 4G42A 4LDLB 4N5EA 5D7SL 4PJ5E 3MV9D 4AL8L 1IC5L 1D5ZB 3C5ZA 4HGWA 1X4ZA 2P5ED 4AEIH 4QWWD 1DBMH 3UBXA 2F5BL 3E8UL 1KB5L 4X8XA 1MJ7H 3DGGB 5KZCB 1BQLL 5EC2B 4IOFD 1IAOA 4RMQA 1RZJC 5AD0B 1TTUA 5KANI 2GSIA 1GC1C 4LSPL 1CICA 3BP4B 4ZSOA 3CZFA 1HHIA 5EO1A 1OM3L 2AXHA 1OCWH 1IMHC 4JG1L 2NZ9D 4N0UE 4BM7A 4Z7VA 3HMXL 4H1LB 3TZVA 3ULVH 1ZLUH 3BPCA 1DSFL 4PBVC 4PJBA 2IEPA 4ERSL 4FQXA 4A6YA 1Q72H 1FL3A 2ADIB 4WW2A 3C6LD 4ZUTB 4S1QH 4NP4L 3RQ3A 4OI7A 5I1CL 4IOFC 2XA8H 1R3IL 4K3EH 3DSFH 3BH8B 3VXTA 3ETBF 1NL0L 3DIFA 4H5SA 1SYVA 4L5FH 4MSWB 5F9JB 3QXWA 1CDUA 3R8QA 1MAKA 1RUPH 2JJVA 4XVSH 1AXSA 2NZ9C 5C0AA 4YUEL 5D1QA 1ED3B 1OGTB 3SE9L 3SE3C 4F7EB 1VPOH 2GK0A 2V2XA 5D2LB 2R8SL 1YNLH 3MRQA 1LDPL 3BIBX 3GB7A 5ITFA 1ZHLB 3TVMB 4ELKB 5CEZH 4D9LH 3L7FB 3TO2B 3U7YH 1RZJL 4PRPA 2CLRB 1GC1L 2G9HA 4LLWA 4YHIA 4MLSA 2D7MA 4JRXA 3QUKB 5IW6B 4QXUL 5MENE 1ZHNA 5IJVB 1X5KA 1A6PA 1A6VL 1T5XB 2JIXA 5H8DA 4J3VA 5GSVA 2FYYA 1TCMA 3FQUA 3A6BL 5B38B 1SY6A 3IJSB 3BDBA 3T4YB 2V5MA 4QYOA 2HFEB 3ZKMD 3AU1B 2KPNA 5E08L 2XFXA 5DEZA 5I19H 1LO0L 2RR3A 3WIHA 4ZNCD 4M48H 4KRPC 1L0YA 1UYWL 3HRZB 4O5LL 5KVDH 1RULH 4KKBD 3HUJF 2VDMH 4OFYD 4XCYB 3FT4A 2X9YA 3VXRD 2ATKA 5DHXB 2W9DL 4KVCH 4HWNA 2UVFA 3KXFB 4GW5A 3GSNH 4KK9C 4HH9A 5C2BL 4ZUVB 1KIPA 1C5DB 5ESAA 2WK2A 5IGXL 2X1OA 3SDDB 3GMQA 4DK3A 3EO0A 4YDKH 1W72B 3UZVB 5HDQH 2HJKB 3QUYD 4MVBA 1EZVX 4ZXBB 3OB8A 2IBBA 3LN9A 4RZCA 2ZCHH 5BW7C 2C4XA 3UMTA 3BXNA 4PFEA 2IH1B 4LBEA 2BY1A 1W2KT 2EZ0D 3JWDC 4HGWB 1K6QH 1VENA 2FJGA 1QBAA 4AG4L 1S7SB 1TTFA 4HS6A 1NFIB 3C2SA 1V3LA 3OV6A 3GNMH 4LEOB 1XGPB 1A64A 3S97C 3UDWA 1T04A 2GIYA 2CDGA 4OD3H 4WENB 2Y7QA 3RAJL 1FZKB 5IVXA 3X3GL 3KAAA 2BXYA 5EO9A 1S5HA 4ORZC 5E0QA 4ZTOL 1KCRH 4ONFL 4NN6C 1HDMA 3QUYC 4P4RB 4N90D 1YDPB 3CDYA 3R06A 4QRTA 2IQ9H 4K7PX 3CMOH 1VFUA 1I9EA 2M2DA 2W60B 1IQDB 4BQBA 4ZS7H 2BZDA 4NYLB 3MV7E 1I85A 2DQIH 2J88L 5HJ3B 3QPXH 4ZQKB 2I5YL 5A2KH 1NGQL 2EIEA 4WW2B 2DQHL 5KW9L 1ORQA 2EDNA 1KC5H 4PJ8A 1WK0A 5K9OB 3LVEA 5DJXB 5JXAL 4F7MA 4WJ5B 1YEKH 2HH0H 1VGEL 1KPRA 3LV3A 2OP4L 5GS0H 4N9OB 2BNRA 4TUKL 1MPAH 3MCKB 2JK5A 4LCIH 1D5XA 2DJ4A 4KKCD 2E9JA 3ZDZF 3THML 1N3NB 4KJQD 5D1QB 1LK3H 4MHHI 2VLLB 2BVUA 4LLYA 4YH6A 4U1JB 2NY7H 4FP8L 3SBWC 4OFPA 3TJHA 1PJ9A 1IKFH 1JUFA 4JGUA 1BEYL 3QQ9D 5F7YC 1KXTB 4UB0H 1SJXA 2EXYD 2J2ZA 2HT3D 1YEDB 4G8GE 4EN3A 4XWGH 3NA9L 5FHBL 3VRLF 4JKMA 4JFYA 3TH2T 4JY4B 1G7MB 2BVTA 3D85D 4KJQC 3OF6A 1B4JH 4MWFB 4JHWL 3AMLA 5C09B 5L2JB 2Q20A 4K07A 4ZPTB 2HA1A 2HTKC 2M8XA 1VFBA 1MIEH 5JW3L 1J0JA 1P7KB 2VWEE 3BP6A 3CH8A 2IMMA 3WJLA 5IESL 2EXYC 4HLZH 2HT3C 4K2UH 4LPUA 5L2KD 3JVGC 5DYOA 2MKWA 4GW5B 4ZUSB 4Z7QF 2VO5A 4KJPD 1XIWC 5D7IB 1MCQA 5GS1A 2IF7A 1AD0B 3MXVH 1XH3B 4ZOBA 4KI5D 3FT2B 4TSAH 2VR5A 4HUUA 4PGEA 2IC2A 3BGFC 4UT6H 4YFLF 3FQRB 2GFBA 3P73A 1M7DA 3E6FA 4DKFH 3HE7B 4D3CL 4RZCB 2OJEA 5SX4H 1OLLA 1OQXA 4HKBA 1DANT 1FCGA 2GCYB 5IMMB 4FQJL 1VDGA 3MLYL 4LGPB 2Q1EA 5HYQA 2E7LC 3A67L 2VZ1A 1YMME 4G5ZH 5CBAA 3QG7H 4OF6A 5BVJA 2X4PA 4OAWA 1RJYB 2QLVB 1JNLH 1MCKA 4GS7B 1T04B 2CDGB 1RK0B 4NQCE 4DTGH 3QIUA 3QYCA 2HTLC 2DM3A 1DR9A 1DBJH 4GSDL 1KCGC 2R4RH 3H8NA 1GZQB 3ARFC 5E94A 3GUTA 5DF0A 1GZPA 2Q6WB 5A2LH 2DLHA 1J8KA 1RZGB 3ARDD 3P30L 4LRNH 2CPCA 5FK9B 3WS3B 2HYMA 4KRNA 2Z92B 2NXYB 3U0TB 1HQ4B 3UP1A 3GBMH 4WFHD 2V5RA 4HF5H 2UUDH 3EGSA 5EU7C 4LHJB 3VGFA 4O02H 3X13B 1KYOJ 1JIBA 3B9EA 4KTEL 5C0DA 5ISZD 3QT2A 3UJTL 4U1KB 5T3ZH 1QLRA 4ZS6D 1UM6L 1FBIL 1KPRB 4PS4H 3QXDA 4JFEE 3KYKL 1PX4A 5E8OA 1S7UA 2J5LB 5DJ2B 5EZJB 2JK5B 1BFSA 1X5ZA 1LO5A 4U4BA 1FORL 3QIBD 5D6DA 2BVYA 1T22B 4MXVF 3ARDC 3BUTA 4UIKH 5ID1A 1HZHH 2C26A 4HLZG 5JHDE 1KTKE 4HK3N 4ZDHA 3TM6A 2BNQD 3MUGB 4JJHA 3INUH 2VDRL 3F7PC 2DQUH 5JA9A 3VFUB 5D7LD 4JDZB 5HD8C 3SJVB 4P23B 4IRZH 1J0YA 3WHE0 1IAKA 2AJSH 1YMHB 2HJFB 3CVHL 4G7YL 1CTNA 2NY0B 3MJ8A 1OB1A 4NNYB 3VXUB 4B53A 2X10A 3QIBC 1PBYA 4OCMC 3BT2L 3WFBL 4IS6A 3ARED 4LSRL 4HFUH 4GXVH 2XIDA 2V2TB 4ZOCA 1VFBB 1MREL 1K2DA 3CFKA 3HA0A 4PRID 5CSZA 5C0RL 2YPKA 3TBSA 1WIUA 4RIRA 4DGYH 2I60L 1B0GB 3RUGE 3VWKD 4PJ9B 2E8YA 3PHQA 4MYWB 1WFNA 4FQIL 2DLTA 3D2UD 3QUXA 4NJ9L 4YNYB 5LAXA 4EI6A 3OKLA 5I74B 1RIUL 3DUUA 4MDIB 3TNMB 5GS1B 5F6IB 3VH8B 4QKXB 4OZFA 4IOSD 3K81A 4CVXA 4YR6A 1Q0YL 4LVOC 2DKSA 3AREC 1AY1H 1M7DB 3E6FB 4X6DA 5DC0A 1N7ML 3UPCA 3BQUD 2XT1B 1NC2D 1RUQL 4QXWA 1T03L 4HC1A 1S7TA 2DQDH 1L0QA 4U1HA 1LO3L 4Z18A 4PG9A 5CD5D 3WHE1 2WW8A 3VWKC 3F8UB 1LEIB 1T1YA 3GZKA 1U6AL 5HDBE 5EUOF 2I9LA 2BC4B 4PYGA 5C08E 3W0WD 4NKDB 3HI1B 4BZ1H 3QA3A 5HVGB 2ATPB 2FX7L 3G5VA 1PFCA 5FO7A 3HRPA 4RISL 5I1AA 1LO4L 4G8EB 2CIKB 3GUTB 2CMRL 4FHBD 2R1YA 5AWNH 2VLKD 5C0BD 1DQDH 4TULH 3BQUC 4QHKI 3ARXA 5IEHB 2YUWA 3UYRL 4K9EH 4A6YH 3HZKA 1CVSC 1AXTH 2MKLC 1PYWA 4QOKD 4XVJL 5CD5C 3EGSB 4PV9B 4NWUH 2IAMD 3HNSL 2XY1A 5C0DB 4QCIB 2E7CA 1BX2B 2VLRE 4LVNC 2C4FU 1QFWL 1QSZA 5MI0C 4XCNB 3KYOA 5EULV 4NT6B 3LPGA 2VXTH 3C8KB 2R69H 3MRJB 2FBJH 1TZIB 2EO9A 2J8UA 1PVHA 3TH4T 4P9ML 4AQ1B 5IB3A 5E2WL 5KS9F 1HEZA 3ZE0E 1G7JA 3MNVA 2MOVA 5AYUH 4XP6L 4MNGE 1TVHB 4GW4B 1MFAL 2N7AA 4JZJB 2NY4D 4HV8B 1AKJB 2BP3A 3IDXH 3I2CL 4X8JA 5D4QA 2NY1B 3BESR 2IAMC 4M7ZB 4WUUA 2YPLE 2BVOA 3VG9C 1DANU 4E41A 2LABA 1XF3A 4YHPA 5I75B 1UWEL 4M1DL 1F4HA 4XB8A 4NUJB 2IQAA 5FUOH 1SY6H 5ETUA 5D1XD 3L9RB 5DI8B 5IW1A 4IS6B 4YE4L 2XXMB 4PP2A 3WIHH 3FQTB 2PUQT 4HKZA 5I1HH 3N1GC 1MH5A 4JFDB 2WUCH 2NY4C 2VDKH 3CXDL 5BOZG 2AEQL 1Z0MA 1FFPB 3HC3H 5E6IA 3KLHD 4P2OB 5F3HA 4NNPL 2OYPA 3MMEA 1QNZL 3NFSL 1SEQH 3TYGL 2AEIT 2VXSL 1XF2A 4AM0B 1FO0A 2WWMC 5I71C 1KPVA 1FNAA 1R3LA 3HCVA 3WO3B 2ZSWA 3IDYB 3MLPA 1KB9J 5D1XC 3GMOA 2I26N 3VI3E 1NC4A 4PP8C 2AGJL 1GXEA 4FQQB 4JLRA 4X6CE 4HUWB 4PUBH 4PJXA 5TE4L 4RFNB 5FYLH 4XNXH 2R0LH 3BD5A 1A6UL 3ZO0A 4Y7MA 4FTVB 5DHVB 1QRNA 1S7TB 3N85H 3I84A 4UAOB 1T1WA 4ZAKA 2VIRB 4M02A 4ODUA 2BCKB 3O45B 2XN9A 3G6JB 4Y5XC 2QSCL 1EERB 5CZXD 1JGVL 4QRPE 5CZVH 3ARRA 3O3EB 3G04B 3PWPA 2YMXL 2EDHA 1FSKC 1G7LA 3WNKA 4H8WC 4G6MH 1A9BB 5F71A 5JIIA 2FL5B 4MGXA 5DK3A 1CT8A 2BRRL 2VDQL 1JGUL 3FONB 3HMXA 3X11A 3BEWB 4HKXB 4Y2DB 4J8RB 2VDPL 1QSEA 1N59A 3LPWA 4HIIA 4OFIA 1BLNB 1TZGH 3VXOB 1HSBB 5DS8B 3I3EA 1UH2A 5I1EH 5FM8A 2EE2A 1B3JA 5SWSD 4FFEX 5EU5B 3RWJA 2Z0BA 4U31A 5IT2L 5KOMC 4JDVA 2EDJA 2R39A 4EVNA 3GBNH 4G8FB 2BHUA 5T3XE 2ITDA 3TJEH 3WLWD 1U3YA 4FMKA 3VFSA 1EMTH 1WT5C 4IHOA 5GRXG 1RIHL 3SPVA 1G7JB 3VFMA 3OKKA 5B21A 1IFHL 2IFFL 1BVZA 4MNQA 4Z77B 1QA9A 2WP3T 3QNYB 1DLFH 5J11B 1MWAA 3P4OB 3QAZC 4XRCA 5IBLC 4X8JB 4OIBA 3LKQA 4G8IA 2LAAA 3ZL4H 1EXUA 3ULVE 4IRJA 1RHFA 4E41B 4S1RL 5E8NA 1XF3B 1Y18A 5HHVL 1F4WL 2CLVA 1H3UA 4G9FB 2EYSB 3HPJB 4L3ED 2UZXB 4NJAH 5ACZA 5E9DD 3H9SB 5JHLL 4OT1L 3QUZA 1EO8L 2LV4A 3OJDA 3WE6A 4H8WL 4I0PA 4QRSB 3TPUA 4DKEL 2DWEB 1OTUD 3WLWC 5C0FA 5C6TL 4NRXA 3TFKA 5FAAA 2CIIA 5F1IA 5IVZA 1XZ0A 4MJIE 2OZ4A 4CVUA 5JNYB 2E8ZA 4XNZC 4U3CA 3J8F7 4MB5A 1FIGL 5HTSA 4N0CA 3O41B 1WFTA 3NA4A 3NZHH 5D7KE 3T3MF 4LKCA 1HYSD 4RFOL 4P2YA 4JFFD 1UH3A 3KPSD 1Y0LA 5DJAB 4X9FA 2FEEI 1NEUA 3NABL 1FH5L 1ONQB 3QHZH 4LSDA 4MD0B 4HCRL 5M95B 5SX5H 1OTUC 3T0ED 1NC4B 2ZCLH 1ORSB 4LARL 4K94C 3B9KB 4LPWA 1JPSH 3G5YA 5E5MA 3KPQA 4L3CA 1G6RB 4NUGL 4ZUWA 4N1HB 4PRNB 5D70L 2OI9A 5E2VH 2Q76B 5DJYA 2VZSA 1QRNB 5IM7B 1ZLSL 4Z7UB 3DYOA 1A02N 4ODUB 3MNWA 5JQ6L 1KB5B 1QFUH 3QRFM 3PWUB 1S3KH 3TA3A 1F45A 1FZJA 1HWHB 3VWJD 3HR5B 5JOPD 2EDDA 3I6KB 5I6XC 5JW4Q 5DD6B 5HGHA 4H0IA 4X4YA 2BX5A 4JM4H 5GZND 3PQYA 3QDMA 2ADJA 1G7LB 2OMNA 5CHNA