1KJNA

Structure of mt0777
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
152
structure length
152
Chain Sequence
TGKALMVLGCPESPVQIPLAIYTSHKLKKKGFRVTVTANPAALRLVQVADPEGIYTDEMVDLESCINELAEGDYEFLAGFVPNDAAAAYLVTFAGILNTETLAIIFDRDADVLEELVNEIMETLDAEIIAARAHHNPAPLRVRIDRFMEEKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MT0777
rcsb
source organism Methanothermobacter thermautotrophicus
molecule tags Structural genomics, unknown function
molecule keywords MTH0777
total genus 48
structure length 152
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09001 DUF1890 Domain of unknown function (DUF1890)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10160 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold MTH777-like 1kjnA00
1KJNA
chains in the Genus database with same CATH superfamily
3HDVA 2VP6A 3QX3A 3O8CA 2V97A 1SVNA 1XK6A 2P3OA 1HKUA 4G84A 5DI3A 3HE3A 5E7MA 5IBCA 4U1RA 1YR7A 1T2DA 2JFZA 1GSAA 3TLGA 2LUOA 5T57A 1OGJA 1OTHA 4RV4A 4BE4A 4EGCB 2H2HA 1RM0A 1TVCA 3G49A 4JJ8A 2WJ3A 3RFUA 2VRNA 3IVXA 3BIFA 3OZCA 2I67A 3QWBA 4ZYVA 1V7QA 2XWSA 2I71A 4RV9A 3WP0A 4F8JA 5I9LA 4IJWA 4X6XA 5EZ6B 1F4VA 3P9PA 2O8BB 1JDSA 1SB8A 1V2HE 5LZ7A 3DFUA 4OLBA 5JC1A 1IOZA 4FT2A 3C98A 3SVZA 3DVRX 3BD7A 2JIPA 3HJRA 1B6RA 2ECKA 2F43A 3ZTWA 5TIIA 3ZGZA 3L7MA 3PUZA 2RGYA 1HRDA 3WGYA 4V1CA 4CTMA 4I99A 3FCXA 5DULA 3UUEA 3F6PA 1NOKA 1S8FA 1YZGA 1BAPA 3UCFA 3DAGA 4CTOA 1ULUA 2KBFA 3OPQA 3VVBA 1K97A 2X3FA 4YX9A 2Q3BA 1M1YA 3LQKA 1GQYA 4CI0B 2PFSA 1K2VN 2CJWA 2FSSA 2HA7A 2REBA 4OLAA 4MYCA 2VNJA 4P38A 2CLFB 5K0NA 821PA 1ZZEA 3KQYA 1E1RD 1W6UA 1P0PA 4HRVA 4JBGA 4A4DA 5BSKA 1AUVA 3SXJA 1YNSA 3U31A 2PSFA 5BN4B 4D79A 3AM3A 1NYQA 3WNVA 4A8PA 2I80A 2BONA 2CVZA 5KSZA 2FR0A 3ILVA 2HUPA 4QDUA 2ZXFA 4KWCA 5EUCA 3VH4A 1TD1A 2ZYGA 2NM0A 2XRFA 4D26A 2JGJA 3QXGA 1BHO1 2FQQA 3WO1A 2DR2A 4EI7A 2RH9B 3EMKA 3C4VA 1T9HA 4DSUA 4AZTA 2BTOA 1M2FA 1TUBB 4MH0R 4EUKA 1IXSB 3OFVA 2J3EA 2XECA 5CBKA 2X4LA 2OZKA 1H9CA 2G71A 2ZIGA 2VDJA 4JYMA 3WLIA 1RRFA 3DMNA 2P3SA 3A0RB 2EJBA 3QXSA 4I8DA 3TTYA 4EIWA 5C4MA 4TMTA 4CKZA 4KHZA 5GPBA 1PFWA 2EX1A 1J42A 1LSJA 1RD4A 3O38A 3EG9A 1UXJA 3PXEA 3Q3VA 4LTNA 1Y63A 2R1UA 2VI5A 3UMJA 2R9VA 4D0RA 5FUQA 3WLHA 2JVIA 3TL2A 1P7CA 3REQB 4GOLD 3RTBA 1IEVA 4M8SA 1T1GA 1X92A 2R6AA 1EXNA 3EFHA 4LHXA 4BNDB 3CVJA 2Z8ZA 4BNLA 2VF2A 5C0OE 1RYBA 3UC9A 3R8XA 2F3UA 1PS0A 1SG0A 2GNAA 4A91A 5KINB 3EPHA 1GUYA 1PEAA 4X84A 3LIIA 2HIMA 4PR0A 4D7AA 4Z7OB 4PCVA 2E82A 4DR1B 4Q9DA 3ZIDA 2BFWA 4XVQA 2OXCA 3GQVA 3EPJA 3NHYA 2G7ZA 4OH1A 3WGOA 3AO0B 4DCCA 4KVFA 1CUWA 3GEIA 3ROMA 3VUEA 2AXEA 5K0ZA 2ZUTA 3SYRA 3AR6A 4CDRA 2WILA 3K9FC 4KNWA 3ZDCA 2YZ7A 1BX0A 3PDIB 1OFTA 1QKKA 5DO9A 3AGPA 5K8VA 2QU7A 3GC6A 3K05A 3HUDA 4RGBA 3CR8A 4GXQA 3VVMA 3IKMB 1GYQA 1JVBA 2JI9A 4P84A 3L4BC 2FPWA 2YOGA 4E88A 3QLEA 2PL9A 1STOA 4F2HA 4MKGA 2PUBA 5IAAA 3TQCA 2XMDA 1D2MA 2EJVA 1E9FA 3QVJA 4P33A 3THYB 3M0EA 2BC9A 4EPVA 4JJAA 3M89A 1AN0A 1PZGA 1Q21A 1UQUA 2GJKA 2I87A 3QVKA 3ZCRA 1K8ZB 2PHZA 3BWBA 3GDGA 3PFBA 4TMFA 1SA0B 3ASVA 3ROFA 2HEIA 3VDXA 4OUKX 4EO9A 4RTOA 1K4KA 3HCCA 3DE7X 1CUCA 4JITA 4F45A 4JKOA 2F9FA 2I3GA 4HTAA 1XNGA 5F77A 1DGQA 3ACDA 2HJRA 3LQ2A 1AS3A 4IGEA 3WLRA 2XOEA 3LP5A 4R3NA 5KWEA 3NS7A 3ZHZA 5KVSA 1ATIA 4JEHA 1KK1A 4EI9A 1NXPA 3KK0A 2D0OB 3IEXA 3MTDA 3WKEA 4KXXA 3FYSA 2IS1A 2JI6A 3GH3A 4QJ4A 2P9BA 2R2GA 1IBKB 1TCBA 4PHCA 4TT3A 1UL1X 1Y33E 5JYDA 3Q7RA 1CSEE 4X6YA 3LLVA 1CF9A 2D2VA 3U13A 1S4MA 1HKHA 5K01A 2PDAA 5G0UA 1VMAA 2XAAA 4ZZIA 4NU5A 3HG7A 4ZYTA 1CJBA 2XE4A 1LPMA 4OOEA 4R2MA 4GIBA 5J23A 4MVXA 1CEQA 1RPAA 1EYZA 1XLVA 1ZW6A 2IW1A 2MINB 5A4FS 5EE9A 3WB0A 4AO6A 5IXSA 2GKSA 2H29A 3L05A 2MYNA 2G06A 3AF6A 1NYLA 1EU1A 2XODA 3RG8A 4C0BA 1PKXA 3PS9A 1VBFA 3DPSA 3H7AA 3EVGA 4JI5B 1TO2E 4BCCA 5J4VA 5FH9A 1DQYA 3ABRB 4RLQA 4RCZA 2P2LA 3FYHA 4M1KA 1JGTA 4HGOA 4M21A 5CH3A 2WUVA 2JFGA 3L8MA 3E22B 3KFXA 2AN9A 3C15C 4BB0A 5FFFA 1LWNA 2Z30A 3N8KA 1IUPA 3SYNA 4KGVA 3VTZA 1MO3A 2J7PA 4BBJA 4Q6BA 4FE4A 3FRIA 3IMFA 3OLWA 4MQ4A 4OCZA 4J4TA 4WNCA 5KDOA 1EFRA 3PLNA 1T43A 1NXTA 1YC5A 4HGYA 4YJHA 2Q4TA 1GEEA 2DETA 2O0LA 4LF4B 3EVDA 4B2YA 1IXKA 2IHTA 1M1YB 1SXPA 4NULA 1QHHB 3C4JA 3G8DA 1U2GC 1DAKA 1U7UA 1SCJA 4MYRA 1C8KA 2ZRMA 1RLTA 1CV2A 1FMJA 3PPIA 4PPNA 3BXGA 5K5EA 2V3CC 4MR7B 1O6BA 1CLUA 1VZ3A 3QVWA 4KQ2A 1TQDA 5DI9A 3BIJA 4KXFB 4EJFA 1H6DA 1WHSB 2GCIA 4OQMA 4JP2A 5FWDA 5EWMA 4YONB 3LA6A 3SIPA 3VYUB 1U99A 3W2TA 1F2UB 1Q12A 3OCCA 3KJGA 3GRZA 1P91A 3KTFA 4RXMA 2CKMA 3I8OA 3NIBA 3ZCXA 5BRAA 1UC4B 3G17A 5J40A 2DPLA 5B57C 1PQUA 3DB2A 3TDMA 3VYWA 121PA 4ZT6A 3I61A 1GR1A 3BWEA 3KZNA 1GZ6A 3ADCA 2XVZA 3IAM1 1WZ2A 1QRRA 1UBNA 1Y1QA 1YB7A 3R5KA 3EGVA 4F2GA 4BC0A 1PTJA 3ZVLA 5L3ZA 4EPXA 3UT5B 2FWNA 5G4LA 1J7KA 1IWPB 1U0GA 4MMYB 2A9RA 1TL7C 2VUUA 4ZVPA 4YREA 4BEWA 4LQLA 2Q6LA 3ZX4A 4C6TA 2XNDA 1MX9A 2BCGY 3ESBA 3EVFA 3MWEB 4ZYUA 4MS3A 2V7EA 4GH5A 4W82A 5T64A 4LKOA 3DOOA 4XR4A 3BEDA 4ESVA 1ISSA 1UUFA 1DWOA 1KO1A 5E95A 3ZV5A 3ZKWA 3QOXA 4BNNA 3H6HA 4NP6A 1GYPA 2WVGA 4P7KA 4R9NA 1E3DA 4MCJA 4H7EA 2M6KA 4Q21A 4DJJA 4Q9HA 2N1BA 2IU0A 2GTPA 2XDWA 4NHEA 1KZYC 3LW8A 3E3MA 1UWVA 4UEOA 1FC0A 4ZAVA 4G09A 2W0MA 4FR5A 1IHXA 4GRIA 5JBQA 1V1JA 4EFLA 4DSAA 5FOQA 1IZ0A 1UQTA 2YTZA 3D4IA 5IDQA 3JSAA 1V96A 1QH1A 4GLJA 1IN8A 2CLMB 4FYJA 4V03A 1RWOA 3C7AA 4QT0A 3JQPA 1EJ0A 5A0TA 3EVCA 3AY7A 3INRA 1X7WB 2QDXA 1EZZA 4FEAA 4I3HA 2VL7A 1YRBA 1V3VA 1KJJA 4X93A 4L8WB 4YALA 4ZOLF 2H9IA 3ZQKA 4YT4A 4OXRA 2BDEA 4UBIA 2GZHA 4WLEA 2GZSA 4XCXA 4D9CA 1Q17A 2BOVA 2C4KA 2ETXA 2WT4A 4JJ4A 3SQOA 2PRSA 3I6MA 1T6BY 4Q24A 1EFUA 3FFAA 1J20A 3HKDA 2IHYA 5LBUA 3BMCA 3S5UA 3RFVA 3UANA 2AR9A 5KSOA 2F1JA 2FFBA 4REQB 2Z5VA 1G64A 3TEJA 3GT7A 4OUDB 2FWMX 2IJGX 2PS1A 3DOEA 4HTFA 4ITVA 2F9LA 1E2FA 4KNVA 5B1IA 2AI2A 4AWAA 5DZSA 4OMDA 3OZBA 1IY1A 1EQUA 3TW8A 5FL7A 2C4MA 3FOAA 4AKHA 2OSBA 1LNSA 4BJ5A 1PK8A 2IYZA 4N6NA 5ALGA 1TK3A 2X3YA 2XT6A 1E32A 3NEPX 5A2GA 1F5NA 1XZPA 3R44A 1O6FA 1U11A 4ZRNA 3CSSA 3U3KA 1W75A 3RJTA 4MEAA 1XZHA 4XM0A 1CWUA 2YNMC 1ZUIA 3RG2A 1G8YA 4BO4A 3HR8A 1B7GO 4UOQA 4CLOA 4CLRA 5IKMA 3RWMB 2YNMD 2MSEB 1JKFA 2FP3A 3GLVA 4GR9A 4LYGA 5F4BA 3ZHTA 2GN0A 5BWLA 4FJ2A 3RFFA 3OTHA 5A0VA 4WQMA 3OP4A 1NC1A 5F7ZA 3WBJA 2B37A 1KYXA 3VAAA 3LIPA 4FT4A 5BVGA 5CLQA 1B00A 1HY3A 3C5VA 3D6VA 1XHEA 2DCMA 3EXHA 2C0CA 4R6WA 3W3AD 1GTRA 3ZLJA 1Z74A 3GLGA 3KSBC 1NX9A 2AEEA 4Y2HA 2ZBPA 3HB0A 1RE1A 4BKOA 4MYHA 3GRKA 2P6MA 4OA8A 2BIFA 4PYQA 1ZJ6A 2VYFA 3EZLA 4Q1CA 4OJTA 3NUZA 5LMUB 5DCLA 4ESHA 2GEUA 4M87A 3ZIAA 1QIIA 2Z2YA 4DT1A 2Y1KA 3CINA 3N2KA 4KLCA 4RA6B 2CL6X 5T7BA 2YFQA 3C4QA 3VC1A 5L40A 1EWTA 4Q34A 4EW6A 3Q88A 3ICOA 3S70A 4CWAA 4L9SA 2AJ8A 1W6RA 1L1RA 3HMQA 2W0SA 4G81A 3HRKA 1HYBA 4XH9B 4BNJA 1U7PA 3Q8WA 3PQCA 3ZBPA 3ZY4A 4F85A 2WD7A 1I7DA 4RPJA 1Z68A 4LYHA 2Q0HA 4KIFA 4BFCA 4D99A 4MV4A 1L7AA 1BU5A 3L0CA 2REQA 5H5JA 3FOEC 4LIPD 1L5MA 2EKBA 2QTFA 3W9BA 1J2TA 4G23A 4HX5A 1ZIOA 4Y2GA 4LRXA 5KAMA 1KKUA 1YVPA 4OGGA 4ZO9A 5L7YA 1EIZA 5ESWA 3WA7A 3IDQA 1Q83A 3PV0A 1OHHD 5DW3A 3WK7A 1AE1A 3KKZA 4XDGA 4XYMA 5AI5A 3JS5A 3GIWA 4TM8A 1VIAA 1DAIA 5A06A 1W36B 2Q29A 3INTA 4NZYA 3G9UA 3ZD9A 4BKMA 1RHQA 1DOZA 1OZHA 5CR9A 1C4WA 3V8EA 2WJGA 4QUBA 3JARB 5IDVA 2Z5GA 1E3WA 1UINA 4KJZA 1VL0A 1F7UA 1Q1GA 2VHYA 4N5DA 2HA4A 1SG6A 1U7OA 3K09A 1ZD8A 4EA6A 1ESEA 4PO3X 3KKQA 1LC3A 2QU8A 3BCUA 1E2JA 5GJCA 4NL4H 6GPBA 1KZ4A 1AO0A 4JCOA 4R05A 1FDUA 3GJSA 4WASA 3ZD7A 1VJTA 2WWIA 3Q3IA 3D7KA 3K32A 1E4YA 3VNAA 9ABPA 2AN3A 1ZH4A 3UXEA 3GA7A 1NJ2A 4FFMA 2CLDX 4YAUA 2J32A 1MHTA 3TR5A 2OAQ1 4BFXA 3AL0C 3W5JA 5LQSA 5EMMA 3BVPA 1A9TA 3FYDA 3IEIA 1IXRC 4QNRA 3KWJA 1XCLA 4B82A 5IYZA 3ONVA 1KQNA 2I4TA 4ZT2A 2YASA 4HAZA 1X15A 3RAFC 3BBLA 2V7TA 1J24A 3EUEA 1QSGA 1GKIA 2X0JA 4H4EA 3V2GA 1JALA 1CDDA 1EFKA 3I05A 3QKWA 3T35A 1WG8A 4WBSA 3GLGB 2AD5A 4E5PA 3UJDA 1SNYA 2IY8A 1TAGA 4JHXA 2IOHA 4FDVA 4JC0A 4IIBA 4ZI3A 1F14A 3RC8A 2ACVA 2CDBA 4IOKA 4PEVA 1E3QA 1KAGA 2PA3A 5LC1A 2PUGA 2R11A 2NUBA 3ERCA 3E5MA 3O9VA 4JB2A 3HDQA 1S1CA 4JQZA 3EDMA 2VUIB 2X9GA 1KJ8A 1JIUA 2VOEA 1GGNA 3RTDA 1SXGA 4CLDA 2PFKA 2Y8EA 4PYRA 5LQUA 3TQQA 1NONA 5BV7A 1J56A 5DHPA 4YAWA 3GLHE 3SIWA 3QEMB 3HBLA 1TQHA 3OIUA 2ZP1A 4DLRA 5F4ZA 3W3AH 1ZGCA 3Q1KA 2O23A 3BJIC 2ZRCA 3PC7A 5H02A 4WY8A 3DDSA 2JASA 5F23A 4OHBA 1SR8A 1G98A 2GYVA 3LX4A 4BUCA 5DNUA 5E6SA 1BFUA 1ZVVA 3OCZA 2JIZA 1E9BA 2EKPA 1T5TA 2RSLA 3CG0A 3D6TB 4RPIA 4YV7A 1CYEA 3C3XA 1U3CA 2YINC 5I48A 1Z88A 3IH5A 3MT0A 3FCOA 5ICGA 3FKSD 3H0KA 5CK5A 4A3SA 2VIIA 1ZNWA 1T0IA 1IB0A 2DFDA 2WBLC 3BCRA 4KE8A 4IGIA 4O2BF 2RKBA 4TMXA 1KJ9A 1RVDA 2Y0PA 2AT1A 2M32A 2ZR9A 3MJEA 4OHFA 3VU8A 3CB4A 1OYVA 3ENKA 2R44A 1J07A 1MB3A 3HKCA 3KJIA 1AQJA 4YUVA 1NVMB 1TIKA 3NASA 2V6MA 3UFXB 3WICA 4ETWA 1FDTA 4WLFA 5JXJA 1C7FA 2IU6A 5K09A 1NP7A 5FCDA 3PXGA 1KARA 1USVA 1O0CA 4Q3DA 1E20A 2OZLB 2M9MA 4FLMA 4WFJA 4MAMA 2FW1A 2QQ0A 5JQWA 3KZMA 1DEAA 1UKEA 3FPFA 1E0KA 3KU1A 2R00C 3PWZA 4MKXA 3ZWCA 3EMBA 2W9XA 4KYTA 2NXNA 2J0UA 3DWFA 1O97C 4YP6A 1ZQ9A 1VSUA 1ZVKA 3OX1A 1XIVA 2V59A 4ZT5A 1PFKA 3K0SA 3GV0A 5F9HA 1L8QA 4FEEA 1WB5A 3KJFA 4XDZA 1I2BA 5JJCA 2A0UA 3GDFA 3IV9A 3MWDA 2HV8A 1EE2A 1RM4A 4OBBA 3ZZMA 4BKQA 3R5TA 4ILEA 1GSIA 4OMUA 1YFKA 2JGLA 3ELBA 5LM3A 1VLJA 3O0DA 3HVUA 4N5LA 1I3MA 3CUSA 3X1JA 4MGKR 3BDIA 2YMMA 4KQCA 4Z0HO 3EMDA 3OQHA 5CBPA 4GUAA 1PKEA 2YDYA 3WL3A 1ZUHA 3B1KA 1WA5A 3FVRA 5J1TB 5AUNB 2FN8A 1O95C 2G17A 3BJZA 3EZ2A 3W6PA 5CVTA 6Q21A 1BH2A 1NBEA 4KB5A 1J0EA 4E7PA 3FUTA 1O58A 3KALA 4G26A 1IUOA 3CJTA 1SCDA 1ML4A 1MQ8B 1QG6A 1W4ZA 3HFGA 3IEUA 4F7WA 1A50B 1IH8A 5DISB 1C0KA 1IMJA 3G5UA 4MPJA 5K8LA 2FW0A 2VLIA 4HGPA 1HOTA 1R0LA 2GF2A 1ZL0A 2O2HA 4UUPA 4RIGA 2GLUA 2PT9A 1GKLA 3QG1A 5LMZA 5AJXA 4R1MA 1G8PA 2A9KA 3JARA 4IOJA 5AM0A 1CF2O 3TQFA 4B40A 1VPWA 2B8TA 3ICEA 2UUOA 2CHGA 2VZ0A 4B6EA 1ZYUA 2ORYA 1CDZA 1C30A 3GLFA 1YCGA 2ORED 1AUOA 3ZGVA 1KH1A 4KLNA 4ZI7F 4F5EA 2NTVA 2H4XA 2O52A 3QPAA 1Q7TA 1MC4A 2JAUA 1PJRA 2WAOA 1MJNA 3F5QA 3ZYZA 2EGUA 3A3PA 4GG1A 4HXYA 2VF8A 4F6CA 2DXIA 5A7FA 3WK8A 3C8ZA 3TYXA 1TA0A 2ES4A 2VNHA 4XFJA 1FNSA 4N03A 3ND8A 1LKZA 4PYNA 3P9IA 3AHJA 3QIVA 5KYUA 1A69A 2IEGA 1FVFA 2QZ4A 2WUGA 2NV6A 2O8VA 4U8GA 4O63O 3D2AA 5DGHA 5BSVA 3SD7A 5A2QA 2HQSA 1CFZA 1UXHA 3KJQA 3N6RA 1E7RA 4UULA 2GO1A 5DNVA 4F7DA 4FKMA 2FSIA 1ICIA 1I5OA 4GLOA 3ASYA 5DI3B 1WXWA 2IZ6A 1DXOA 2B61A 1QYWA 1LC0A 1W94A 1ZXXA 2HSDA 4O25A 4DIFA 1JAIA 2NTEA 5ERGB 2ACKA 4RK6A 3T54A 1LK0A 2W71A 4IBOA 1GPKA 1NV9A 3EIQA 3MW8A 4XZ3A 3T9CA 4AYWA 1DDIA 3MVEA 5EKUA 2FSVA 1NIPA 3I12A 1ZUWA 3U7JA 4BFLA 1R0XA 3MT7A 2D13A 1FX0A 4I50F 4QBKA 2GM4A 1FU4A 4M7PA 2CF6A 2E7ZA 1D2NA 3GEGA 3OFJA 3G02A 3ZV6A 1USGA 4W5OA 3DZCA 2I4RA 3JYNA 1MAVA 4GZ6A 4MWDA 4BZXA 3A32A 5EZYB 5JAOA 2HY7A 2OB1A 2J6HA 4D4IA 1BYUA 3V32A 2K2QB 3UYKA 4HEQA 3ROEA 1JPUA 4F4HA 3P9KA 3KE8A 3W1EA 4PSDA 1MABA 5HIIA 4AKGA 1YZNA 4QREA 1KZGB 3NBQA 1E2KA 2XWJI 4JLKA 2ZJ5A 1ZGHA 4HZUA 3BMNB 5YASA 1BE6A 1XQYA 2AUNA 2QSYA 3KYDB 3TAUA 4A1OA 1WV1A 2R66A 1RHRA 1NWCA 4O33A 5IARA 5JWOA 2C99A 3CW8X 4KUHA 4JGIA 2QGZA 2BEKA 3ZTTA 4C4SA 3FZEA 3JZAA 4JS0A 4H6XA 5ECWA 3QE4A 1AN9A 4DANA 1JJBA 2Z3VA 1FXWF 3UGTA 1IN1A 1ZK1A 5E1BA 5CCBA 2Y1DA 1VTKA 4C0XA 5D6OA 4G85A 1I4TD 4QM7A 3UB3A 4GOMD 4QTYA 1XCMA 5I4IA 2PZFA 2WWYA 1MLDA 4Q1DA 5BN5A 5JJIA 4DV7B 1CETA 4Q19A 3GLUA 4YCAA 4Q7MB 2P67A 3PFKA 3RIMA 1IZ9A 4H1UA 2Q99A 3I6YA 2I3ZA 5CCXA 1QV6A 2DT8A 2P78A 2W98A 1QO0A 1YRHA 2YVUA 2BFFA 3KTOA 4HQKA 3ANYB 3W77A 2FSGA 4YHHB 2B2NA 2NU8A 4YBRA 1XHFA 2Q1YA 2P1DA 1HDXA 3TZLA 4AL4A 1ZMXA 1WZEA 5JV5A 2IOFA 3AJ8A 4D44A 1EDDA 2NO1A 4TMZA 1V3QE 4B5LA 2ONZA 5BW4A 4YJ2A 1WP4A 2WWTA 5JZVA 2QB5A 2QYHA 4US1R 3JQAB 1F2TB 1PZMA 2N46A 4P2GA 5J2TF 1EFAA 2XBMA 2WT8A 3K9HA 2R85A 1YBVA 4J76A 3DQZA 4JYAB 3E8XA 3JPWA 4LA4A 2W37A 4DA8A 2Y77A 4RZUA 2W8BA 3UMRA 2HPVA 3PYMA 2G83A 1ZIYA 4MHOA 1KE2A 1CUHA 4BMDA 3OWXA 3SZMA 2QRJA 4N4AA 3ZOKA 1EFRD 1TMGE 4RADA 1QFJA 4J6EA 4A82A 5TPWA 4RGQA 1H94A 1JG6A 3HACA 4F71A 3GF4A 2YMQA 2YQ4A 3GIDA 3N74A 1L5LA 3SHTA 4C5BA 1KI4A 1Z4MA 2BDTA 2IVFA 2PS3A 3DTVD 4BQRA 3VOBA 3OZVA 1QH8B 3IBFA 2Q2VA 2YN2A 2VO1A 3V8PA 3WAGA 4X1KB 1Y3HA 4IXNA 4X1YA 1YD7A 1QS0A 5ALDA 3H1GA 3BZUA 3U1VA 1FUEA 4ACAA 4YDQA 1P4HA 3A1VA 3GAAA 1SIOA 4O4HA 4U0KA 5IHPA 5GZ3A 5JDIC 4O3MA 4M3NA 4Q3AA 4AZVA 3OJLA 3NXKA 3ZY6A 1DC6A 2YIMA 4EG1A 3L4JA 3D8RA 3ZCSA 3LCVB 4X91A 1X9IA 1Z6TA 2I76A 2B5OA 4NEGA 3RREA 1WOMA 1Z4OA 4OM7A 4IV0A 4MVCA 3DE1X 5FEMA 3TR6A 2G9ZA 3LRPA 1QMPA 4RPLA 3EN0A 1AZSC 1W4CA 4D3YA 2JLXA 4EITA 2XSZA 3ESAA 1T4CA 2C03A 3PXXA 1JLHA 4CLXA 4TV9F 5FWXA 1DBPA 2QLBA 4HD8A 4NIMA 1C3LA 4DVJA 1YCDA 3WLOA 3UGJA 3I6IA 3U4QA 2A35A 3L0IB 2VCHA 3BG5A 5EZYA 1Q11A 1U5BB 3Q7SA 2B6NA 1QIJA 5B7PA 1L6RA 1B74A 3DBLA 3F3KA 4OHYA 5ICCA 2K7ZA 1YZLA 3RHTA 4R71A 1RQLA 1GKYA 2RK3A 4CCSA 4TLAA 3AINA 3C74A 2IX3A 4BIIA 1K66A 5BNFA 3ZPXA 5A1JA 5CFRA 2ZRIA 3AL3A 3LQ1A 4JEIA 1RJ9B 1QHNA 3NIDB 1ENOA 1PL7A 4WCFA 4A5SA 4DGQA 2C5FA 3DZIA 5FF9A 5KHAA 4KQXA 5I8WA 3R3XA 3CLKA 3OQIA 2ERXA 4CQLB 2VTBB 1D0IA 1Z0ZA 2D4AA 4IDOA 4FFSA 1QH0A 4MA0A 2OHFA 3G7SA 3TLAA 2HYIC 1O95A 1W1IA 2WJIA 4KYUA 1V4VA 2CVQA 3DVQX 1FLNA 1XNRB 1D6JA 3WB1A 1PL6A 3GGGA 4X3CA 1BA2A 3D3NA 3G5TA 3KSDO 1Z18A 2ODPA 3QVXA 4LBVA 3HXPA 4RHXA 1W52X 2E18A 1FYFA 5AT1A 1J8YF 1J1ZA 4QBGB 2Y4NA 3ZHBA 3UB2A 4EPTA 6NULA 1DPFA 4POAA 1LZLA 3VR3D 2JK1A 4LF6B 3F9RA 1X7GA 5DCUA 1ENPA 1G66A 2E2WA 2O3JA 3OSUA 4Q03A 2WA2A 4CKWA 1PNRA 4DMKA 4CN8A 1B16A 2K7FA 1LVHA 4GUDA 4WN9B 4QSHA 1KIMA 1O0SA 4XGQA 1JIIA 3CSUA 1Q1AA 2VSXA 1UPTA 4IZHA 3VR1A 3PXUA 4R01A 1MXFA 4NBWA 4K6HA 1TU0A 1T0BA 1VBMA 4JR0A 5CNIA 2B30A 3UV3A 5HZKA 5AVXA 5JAPA 4R2LA 1E5DA 2IHKA 1WQ3A 4L4YA 3U56A 5K8CA 3F6BX 1YOBA 3O8BA 4KN8A 3ZWAA 2HCJB 1O5TA 3KXLA 3QUBA 4N8SA 1D4ZA 1OA1A 2EQ5A 2F1HA 4QQRA 3SN6A 1KQFA 1KL7A 3TZBA 2ZULA 3GLRA 4DMMA 3L9XA 3SX0A 1CE8A 3DFZA 5JCJD 2RJOA 4Q01A 1UH5A 3UAWA 5HKLA 2FK7A 2W6ID 5GZ6A 2ZWAA 3BMXA 4CMIA 3TTSA 3OTIA 1BN7A 2WMYA 3WWPA 1E4EB 1JLLB 1KJIA 3BSYA 1PG0A 3M7IA 4J1TC 1M6YA 4W8GA 2DULA 4QDTA 4V3CA 3HGTA 4JA0A 1N8SA 4S0XA 2XVXA 4NAHA 3WB2A 1RXVA 1O8CA 2HLPA 1AURA 2WWVD 5E6UA 1NLYA 1IL0A 2O57A 1QQAA 1EUZA 3R4CA 3ENWA 2OQIA 2AOUA 2WY2D 1M74A 2O14A 4PG7A 3RTGA 3W1VA 4MCIA 1JR2A 3ESXA 4LJLA 3T6KA 5M7EA 1XQ1A 4CUZA 2O4UX 4MV9A 3O21A 3BKXA 3KNZA 4LV6A 5INTA 2FPXA 4AKEA 10MHA 3RYFB 1PWEA 4PZCA 3DDHA 1XZGA 4G2TA 1S2MA 5FTLA 4YFYA 1E62A 2DLDA 3TVDA 1UAGA 4JP1A 1M6HA 3COSA 3G0BA 3R24A 1KOGA 5PNTA 2QLMA 3WWCA 3EDYA 2H48A 3I9OA 3TH5A 1DB3A 1M9NA 2QXUA 1RHKA 1V48A 1ZD1A 5A4MS 1QR6A 3Q0IA 2AVNA 4BNYA 5I8PA 2ZT5A 3OM0A 2C92A 2HCTA 4XLLA 4BNIA 5EJ8A 1W35A 2IITA 4DR7B 2YWHA 1RQXA 1ZNZA 3FB4A 3B7GA 4PHFA 5IEJA 1U4OA 2E4AA 5H7XA 3W8FA 3WMGA 1FNNA 1JT9A 3ECCA 2FNAA 3PRYA 4B6RA 5IZCC 4F06A 3FGPA 3N2NA 3HO6A 3B6EA 2V7XA 1BSVA 2C5SA 1ADYA 2CVPA 4MQFA 4AMYA 1Z06A 1PQWA 4JLJA 2GFQA 5AM4A 4DOMA 3QPVA 5C18A 3IAAA 4D4JA 1GKKA 4L7QA 4G65A 4M1ZA 3MQFA 2VUSA 3UMCA 1IBCA 4S2EA 3TCNA 4E09A 3LPMA 4N18A 1ULAA 2XBLA 4IIGA 2A2ZA 4FILA 4II3A 4C0LA 2P2NA 2FPGB 3STHA 2GAFA 3L79A 5DASA 4KE6A 1GNVA 3ID6C 1IE3A 1G1AA 4J0DA 5EJIA 1N33B 2XUKA 3KUCA 4A0QA 2YBEA 4X45A 4J2HA 5TEVA 2H7CA 2IYEA 2ATCA 1HL7A 2ID7A 2JI8A 4FOSA 3A0UA 3UK2A 4RD2A 4Q4LA 1DEXA 3GR6A 1XD2A 2G4VA 2ZRNA 3SM3A 3P96A 1Z3IX 1WTCA 2WABA 4PR3A 5C51B 2ZT6A 3AR5A 3MK31 1H0SA 5JNWA 3DXZA 1GOTA 1U0SY 2GF9A 4IH9A 4MV0A 4EOGA 1JECA 1ISRA 3CZ5A 3Q7IA 3LYAA 4XX0B 1JRLA 5CDHA 4J16C 5CFZA 3WJ2A 5KIAA 2AR0A 4V0SA 4JEMA 1C7ZA 3LFTA 1ID1A 1RBQA 3NWPA 2VBCA 1I3OA 2P77A 5KC9A 4UU0A 1BDMA 1ZGGA 5KX5A 4QOHA 3KQUA 1V37A 3QWIA 5DIFA 4KPYA 4A7PA 2J9YB 2ZJ1A 1Y37A 4V1CB 3PC8A 4I55B 1J2UA 3FDXA 1NP3A 4AG5A 2NOAA 3RANA 2QRZA 4UATA 4WEOA 1NVAA 2X77A 2ZRLA 1DQRA 4MLCA 2GXQA 4CLHA 4KQFA 2FB9A 5GVRA 1P4AA 3U4IA 4G0VA 3WC4A 1U2DC 4J7XA 1MD9A 3EOBI 2ZJFA 3HJFA 3LDFA 4G1FA 2FWJA 3JPYA 1LS1A 1G60A 1BEZA 1LTKA 1SD5A 4YI3A 4F96A 4ENRA 3OIDA 3ROPA 3THWA 4WW0A 3CLUC 2LVBA 1XCPA 1AB5A 2O8BA 3HDHA 4WN3A 1JLRA 2QQEA 2PMFA 1U0HC 3C3CA 3DEFA 1XB2A 4LDNA 4GYWA 4RACA 5IVDA 1JKJA 1X94A 3TX6A 1HMPA 3RQIA 3E7DA 4NZMA 1XU4A 4N5MA 3RB8A 1XEXB 1I4OA 1KJWA 2HBZA 4HRXA 4QPJC 3DONA 4Q93A 3MLBA 1YHZA 4DLBA 3RS9A 1HZJA 2OXTA 3I9MA 4P6VF 4IWNA 3H3FA 4QXMA 1QQ6A 1ZISA 2PXHA 1MC1A 1GUBA 3DDZX 2ERYA 1MU0A 3CH7A 1FRFS 3IKLA 2FN7A 1K5DA 2BHSA 4WZBB 1ZSNA 1R0KA 1YJ8A 4Z9AA 5K2OA 2VQSA 4CUJA 4HO1X 2I4OA 4M37A 4R1LA 2D1FA 3WYGA 1U1FA 1KVSA 2XCQA 5BPHA 1F60A 1LI7A 2OOKA 3DP9A 3H17A 3RROA 3NX4A 2MDTA 4MVJG 3GLHA 1Z8FA 3EGEA 4ZVVA 4Z4FA 5MHTA 4AF8A 1N2CB 1H1LB 1WXFA 2GJ8A 4LBZA 4AZWA 3A10A 2O19A 1KP2A 2VH5R 3LRTA 2A78A 2BRUC 2J5XA 5H3LA 5TT1A 1N2ZA 1NGSA 1B6GA 2XB6A 1JA1A 2JEOA 4F86A 3MMSA 3VJRA 2YWDA 5K4GA 2SKDA 2FGJA 4EPWA 4IUYA 2WR8A 3ZYCA 1Y42X 1PLLA 5HFAA 3CIFA 2H5EA 1RYEA 2ZR7A 2X1MA 1P4RA 1Z7GA 4X3OA 1RLOA 4W1QA 3FYUC 2F7SA 5JD5A 1VP9A 1DJNA 2H92A 3AY6A 8ABPA 3R9IA 4JYBA 4PLWA 1T2NA 4YXWD 2ONCA 2F6RA 3K70B 3ZHUA 5EJ4A 3UPTA 4NBSA 3B9PA 3ANXA 3BHMA 5DN6D 5EPUA 1BKDR 2MMGA 1GL6A 1I7PA 2C8LA 1YQGA 2NZ8A 3DM9B 3OZSA 3QHAA 4Z49A 4QG3A 3CRQA 1NBIA 4NK5A 3JQDA 4MV1A 3ZJTA 4ETNA 1RRPA 4Y2UA 1DRKA 1A1SA 1KMCA 1Q3TA 1UMCA 4LK2A 4RLFA 5TQ2A 3FZNA 2JDID 4WBNB 4HFNA 4DLWA 1M2JA 1UEIA 2MSDB 1T36A 3M1LA 3H86A 3ORHA 3EPPA 4FSDA 4FNOA 4LMBA 4MUJA 1C0LA 4WLOA 5EZSA 1XTSA 4CODB 2V58A 1FRVA 1MGOA 3VDMA 1AUXA 1CTQA 1UEXC 2OFWA 2WINI 5BUSA 2I54A 3R6TA 4LISA 1SHTX 4NBVA 1TMOA 2C78A 2ZSUA 5AI4A 3ZCQA 2BI8A 1RABA 4DHEA 1WEHA 4P32A 4NZPA 3WG9A 3CNOA 1N8KA 3SBDA 3L46A 5AKEA 4X94A 2GZRA 4MUKA 1O89A 1GGFA 3DAHA 3P19A 4GMDA 4ND7A 2XCIA 2HQRA 3D6UA 3DXYA 3UTDA 4ZVKA 4COOA 2WSSA 2ZUCA 4Q1FA 3I1JA 4H7FA 4IIYA 3RWOA 3CVYA 1J5EB 4GKVA 5EIFA 4K6MA 1SB9A 5AVOA 3BN3A 4PYMA 1KSHA 4IVPA 4TQUS 2OHVA 1JS1X 3F0TA 5TJ9A 3WLKX 5GGYA 3I5UA 1Z28A 4UJ5A 1WMDA 5IK2A 3W5CA 2NZWA 4HDMA 5EFZA 3KXDA 1S2GA 1TZCA 2HH9A 5CURA 4I3GA 1TM2A 2AEJA 4JVOA 1Z5UA 3LNCA 1XD2B 1QRUA 1VKRA 3MYRA 3GUVA 1BG6A 3A1FA 4NCXA 3NCTA 5BNZA 4TWRA 3FBTA 1EFHA 1RXUA 1XMSA 2D5LA 3FWHA 1D2RA 3FWPA 4O4IB 5IVPA 2AK3A 3FSRA 3JD1A 2GEKA 1WXHA 1GAJA 1NA5A 2Z1NA 5A4DA 1V8BA 5HG0A 5KMGB 2I29A 2C5LA 1BVUA 5GQSA 2XB2A 1BEEA 3ZEAA 4XX0A 1YZVA 2FPIB 3NBYC 5AIAA 3BILA 1I7NA 1QORA 3EWIA 2WZDA 4Q4JB 2P41A 2PWYA 2X5NA 4HLUC 4MUXA 1NHWA 5FTWA 4Y6RA 2FMUA 2OFFA 3KDSE 2EP7A 3TUJC 2ZWVA 3AY0A 2WAYA 2ZT8A 3ZH2A 1FLAA 3IUNA 5AKYA 3VR6H 3ZV3A 2KBEA 5CIQA 1JEDA 2HO5A 4UTPA 1LDYA 3A1CA 3JVVA 5IFLA 2OO5A 4QGGA 3QKRB 3IHTA 4HOYA 4P98A 5DLDA 5JNSA 1Z8NA 3GVCA 3PFFA 1CUGA 4EG4A 3L41A 3KB2A 4KBGA 2Y6UA 3IQDB 3DZHA 1C7IA 3IVRA 3PVCA 1UKBA 3I04A 4GNKA 5GJBA 1Z75A 5FRDA 2NAFA 1DIRA 1GTG1 4HN9A 1WB4A 3MT8A 1YZQA 5FPPA 2OXIA 3K4QA 3WWEA 4C4PA 4CT4B 2WHRA 3D4NA 2DBQA 3GARA 4N49A 1OX5A 2GH1A 1E1YA 4DMUB 1UM8A 2C1EA 3B1YA 3EK2A 5JAZA 1EESA 3SE0A 4RVSA 3SS9X 1P81A 4NFHA 4KDEA 3BXPA 3C1AA 3L5KA 4LJAA 1CR0A 1GNRA 3O3CA 4ZV4A 4F6LA 3RYCB 4B87A 5LP1A 4AKTA 3NM4A 3R0ZA 1PFVA 1WMBA 2KMLA 5B1YA 3SHWA 2O5RA 3C97A 3FN4A 5CD9A 1ZC3A 2FN3A 2XYQA 4I50A 1TF5A 1JIVA 2HLDA 4ZI5A 4G5RA 1HF3A 5H3HA 4BZWA 2QI9C 3D8SA 3RBAA 3EZFA 4C7JA 4DIUA 1A4RA 1KBOA 1D04A 2D06A 3K2QA 4KOEC 1G2IA 2FEAA 2HO4A 2OCIA 3AQ4A 5LQMA 4QZVA 1U0OC 3HZHA 2AOVA 3RVBA 3ETJA 2ZATA 2FDCA 3B5EA 2HDNB 5GINE 5F7JA 4BVHA 1HQDA 2A9QA 2JIBA 3DBOB 5M3BA 3VR0A 3Q0EA 4YLEA 2HK6A 4IY1A 5P8WA 2QL9A 3HJHA 3SJZA 1OLUB 4JU8A 3H75A 3WLNA 4ZEMA 3EZGA 2QJTA 1YMVA 1PYGA 4RDIA 1RYFA 3NVDA 5KHOC 1B8OA 2XPCA 1M6VA 3LYHA 4IHAA 5EHGA 3QMVA 2BUAA 3MJTA 1CERA 2G5GX 4U7PB 1MW9X 1PTKA 1WF3A 2YWGA 1GNPA 1O08A 2YMPA 3PNVA 5KNDH 1E5XA 4E31A 2FZVA 1W85A 3KQPA 4C7XA 3DZBA 4MW9A 2B1GA 2P6UA 2AMJA 1Q95A 4US0R 3L7IA 1T2VA 1L8AA 3SE7A 1Z45A 3AUJB 3VR5H 1QPGA 3M9WA 2ICAA 2QPLA 2H1VA 1AIPA 4JLSA 4WZAB 1YUNA 1QTRA 1X80A 2WDPA 4BPBA 4ZI7A 1GGHA 3QYPA 4DBVO 5EJ2A 1XFAA 2WQ6A 2AOTB 1OCEA 1MEOA 1QPZA 3K6SB 2YVQA 3OO1A 5HJ5A 4XI9A 4BKPA 3P9CA 4RJLA 3KT6A 5KPDA 4EA9A 1DBQA 1EDEA 3CR3C 5IBRA 2MT9A 3GEHA 4HK4A 1CUXA 3P4YA 1QANA 3NANA 4TV9A 4ZP1A 1U4SA 4JLNA 1JHUA 2CE7A 4OUDA 5FNZA 5AHRA 2ZS8A 4E13A 1K75A 1XJ0A 2IYSA 4XPIA 2D7CA 1EFPA 1JL3A 1DBRA 2JI4A 4RK1A 5TC4A 4WMLA 1FFXB 3E2IA 2CJXA 3KM0A 2Q5OA 1SUCA 2CLSA 1EXWA 4Q7EA 5DHRA 2C2KA 3FDJA 3SMQA 4CKYA 3LQRA 2C1XA 3LL4A 5C8DA 2DPHA 1RFGE 1Z5VA 4L9AA 3OQNA 3CX4A 4KI7A 4ZVOA 1H0HA 1UBRS 3WIVA 1PD1A 1EP1B 1XZJA 2CK3D 3RVDA 3R5XA 4P7FA 5EMJA 3ZU4A 1A76A 4IDCA 4Z7QB 2E3JA 4I1OA 4CLRB 5JBNA 3HP1A 4UE3S 1Y1RA 1U7XA 1XYYA 2CBZA 3GT0A 3L0OA 4HV4A 1DKOA 1WTAA 3LK7A 2W43A 4TMKA 4KE9A 3FPEA 3H9UA 4FC6A 4PU0A 5CYPA 1W5BA 3NT5A 1CG6A 5EXXA 4ZV7A 3ZHCA 1NFQA 1RJFA 4J7CA 5BVGB 4DLLA 2YZMA 1ZEMA 3WB9A 4DCSA 2VAPA 5C7YA 4DZRA 2IEYA 2O1EA 3L8CA 1FQOA 3QLTA 3DLIA 3HCWA 4Y1RA 4AURA 1Y82A 2CXQA 3OA0A 2EZTA 3W5IA 3W2GA 2R6ZA 4Q66C 1SBIA 1Y4UA 1T15A 4ZALA 1AF4A 4BKUA 1W48A 5JD6A 2JW5A 2QUBA 1NVBA 2FPIA 3NRCA 4QTTB 2FGKA 3QOWA 4P92A 2PRYA 2XB4A 4D8XA 1QQTA 1JE0A 1Z2PX 2W6ZA 3QFTA 2XF2A 4JI1B 5JTTA 2FMTA 1PNQA 2UUPA 5D5HA 1R6UA 1WZCA 2V3WA 1I4EB 4A23A 4CNBA 2FTKE 1MRNA 4LJKA 1R9GA 1NM5A 2VPTA 1L5YA 3PQ7A 1XX6A 5AVZA 1XQWA 5K0LA 5HIMA 5LJLA 1QK4A 4N3GA 3CF6R 3DPUA 1E9DA 3OZ7A 2W42A 1P9RA 2BGMA 4GBMA 2A8YA 2H4WA 4G4IA 2V7UA 4ZJUA 2DERA 3DB1A 4K03A 2YJNA 2FWIA 3RRNA 4YMVA 4KR7A 3NHPA 4ARZA 5IS2A 3QTTA 1W8DA 1D07A 3O8RA 3OU6A 1VM6A 2J1LA 1RWKA 2NSDA 2IHZA 1WABA 1ZOLA 4P93A 4PF1A 3S1AB 1GN8A 1T10A 2ZI7A 3VGPA 1ZUD1 4RIIA 1VMEA 3D59A 1JAHA 1O95D 4GZMA 2GBLC 3TSOA 4C1BA 4CFYA 1ADBA 3FBGA 1WO8A 5BVHA 1KEUA 2I33A 4S04A 1MB2A 1ETUA 2PH5A 4TS9A 1F6WA 2VDQB 5G02A 5IUJC 4BWYA 3QZUA 4PN7A 2RC6A 1LY1A 3Q7PA 3PPVA 4BUJA 1QFXA 4QYXA 3O4HA 4URVR 1TJ5A 3AG6A 1ULSA 1K6MA 1UP6A 2CXPA 4B09A 4C4OA 3COVA 8ATCA 3F6SA 4KFSA 2NXEA 1BA3A 4KQIA 1G55A 4YJ2B 3D3QA 3R7BA 2B8NA 1SU4A 2IDZA 1K3FA 3ZHSA 3IVAA 5DWDA 4ZOLA 4XW2A 2CNDA 4IYJA 4L74A 2I1VB 2GVDC 1MO2A 3QFFA 2R1VA 4V3BA 4Z8YA 1OXSC 3T95A 2G04A 5JWRA 4RQAA 5LQKA 1BO6A 3QEAZ 2BF4A 3NC1C 4I08A 4XYLA 1JI0A 1GRVA 2H1RA 2QV7A 4PBRA 1AO3A 3JW8A 1AX9A 4HQ0A 4XKJA 5BSTA 3UJ9A 4AW9A 1UKYA 4QPDA 3NM5A 3KVRA 4UVEA 3IO3A 1ZCZA 2QT0A 2VZLA 3BX1A 3D0OA 2VQDA 2F00A 3WIOA 4DMCA 5JCXA 3V42A 3LWBA 1ZIDA 1M2WA 3PL1A 1GNQA 2GM3A 3HLYA 2G36A 2RJNA 2C0PA 2Y1FA 4UHJA 4XSHA 3IQZA 4DQLA 4OP3A 4UU8A 5AHWA 3VBCA 2CY0A 1EUQA 1NUQA 4PCLA 1ZM4A 3RS3A 4HMOA 3C6MA 1EK1A 2F2TA 1IOLA 1KO4A 1M0TA 1N57A 1G6Q1 2O50A 1FXWA 3FPHA 3K1AA 4MQEB 2XUFA 4IGFA 1H8EA 4UMDA 4DNQA 1NQOA 4CIBA 2VTBA 1XXLA 2VDUE 3IEMA 3II6X 4PAGA 4YMSA 2HA0A 3PGKA 1RLMA 3REFA 4I8XA 1VRWA 3W78A 5B3KA 4H17A 5CA1B 4LGVA 3PEVA 5JHHB 2GCNA 2CHVA 4JROA 1TF7A 4JEUA 4COKA 5FWXB 4L8YA 3CHYA 1JTEA 3IMEA 4L5IA 4OFBA 4RGYA 5GONF 3EQZA 2D1YA 2RGXA 4FW8A 5B1DA 2F43B 1C1DA 2O2JA 1C7QA 3LBHA 3VOAA 1Y9AA 4J4HA 3SOZA 3MD0A 2G25A 1TU3A 2A30A 3P0RA 1YI0A 4EF4A 3A6JA 3BFXA 5EGNA 3PT9A 2YXEA 1PG5A 2H7XA 3H5OA 2GWHA 3QHPA 2GFIA 4ODIA 4OP2A 3RJ9A 4Q00A 4D82A 5JO9A 1ZRNA 3CEPB 2AHRA 5EP1A 4UBJA 4UTNA 3OP1A 2XWPA 5DOVA 3PF8A 1G5RA 3DKVA 3UKJA 5D1HA 1RVV1 1ECPA 1U9JA 3HCBA 4F4FA 5BOSB 5A3SA 4PSAA 1SVWA 3HU5A 4U6SA 5EP3A 1RXIA 1T1EA 4BQIA 1SVOA 3IT1A 3RU2A 2OHGA 5EP2A 4E5NA 1OU4A 2GM9A 3HGMA 4MICA 1XJ5A 4A8JC 2FW8A 3VO1A 2PUJA 3G8BA 2XTJA 3RJ5A 3RYTC 2GX6A 3TLEA 4RTSA 1OTYA 3RBVA 1OTXA 4W5TA 1JBQA 3GJ7A 4LCJA 4IKEA 3R09A 1VBNA 4DMGA 3NFRA 1Q3KA 2FHPA 4YMUA 1UXIA 3VHLB 1ZL2A 3DF9A 3TPCA 2ASEA 3P9YA 1AKVA 4IJ5A 4GX2A 1MG0A 2YXLA 1E1CA 2FPKA 1NN0A 1AGXA 3OF5A 2B20A 3RVMA 4DNPA 5JH7B 1FPMA 3QNMA 3K2BA 3MMXA 5KSWB 2GBIA 2WJPA 3DBIA 2C42A 3JWHA 1JIXA 1KYWA 2JFQA 3CX8A 4NFLA 4PW0A 1P1RA 1OIWA 2EDAA 3G68A 3G89A 4FGLA 3ZLTA 1P7WA 5JVDA 4GMXA 5KTOA 1U1EA 4UCWA 3V5NA 3KT0A 3ER6A 2IUFA 3FGOA 1MV5A 1Q84A 4OJMX 1PZXA 1E18A 4RHYA 4BU1A 3I2IA 4BNKA 1C3OB 1SUPA 4GU5A 5I51A 5FD8A 3KOUA 3QF4A 1GV1A 2O3QA 1FEZA 4CIWA 5DHQA 4MVJH 4BNVA 1U9IC 2ZBVA 4PYIA 3AIIA 1SMKA 2TYSB 3OIFA 1UJ4A 2C7RA 3WR5A 3HBAA 1IULA 1CDEA 2GSDA 4QHYA 4WA8A 5B6IA 2LIVA 3T0IA 4O2RA 5B6PA 3T3MB 2MTBA 1N75A 1MF7A 2WFZA 2W2VA 1K6EA 1OGYA 1QHXA 1N2IA 1TJ3A 1Z3CA 2JEZA 2VN8A 3IP9A 3IPLA 3MTAA 3OZAA 2ZI9A 4TLBA 3DV0B 3K30A 1LXCA 1KU0A 1ZJZA 4WTOA 1T1JA 5E7QA 1TGYA 4B2IA 4AQ7A 2DLNA 3F5FA 1V47A 2O2XA 3GOQA 3FOWA 3PITA 4IX1A 4JX9A 4LPSA 2EG9A 7ABPA 1XTKA 1ZOSA 3S1LA 3WQBA 4FC7A 3U7HB 3N7UA 4JCCA 3HZZA 3BXXA 5ARDA 1FU8A 2IDJA 3O75A 4LX0A 3FCCA 4UFNA 5L3QB 3QFHA 3SG0A 4CVNA 2O8CA 2ERCA 3N1UA 2VYCA 3FVWA 3FBWA 1JXQA 3QXHA 3UUGA 4P4GA 2OD7A 4HB0A 1WUTA 5CFMA 3RWBA 4YJ3B 2IYAA 5JAIA 3KQLA 1T9DA 3L3BA 3P52A 1T9GS 1IEWA 4NARA 2R8XA 4QEKA 2YXDA 1YC2A 5DE3A 3TIIA 3ABZA 3LXMA 1W7AA 4HDAA 1SOWA 5EUQB 3WLJA 3ZD6A 4Z0TA 5A02A 3NKVA 1DJLA 1JVSA 2HOQA 4NXNB 1MORA 3UXHA 1TVKA 5FUMA 1PSWA 3AM5A 5AW8A 2BZ1A 4LNUB 5K8IA 3PI6A 1Z0FA 1OI2A 3B78A 2IQIA 1Q77A 1I6WA 1KR5A 1VE3A 3GB9A 3KR2A 2EJWA 4JODA 4X92A 1YQEA 1NW9B 1T5HX 3QJYA 2OHJA 5KOIA 5FPTA 2CHQA 3LLMA 3M3HA 1Q16A 1YDEA 5J3JA 1Q14A 1UAYA 2SCUA 7MHTA 1FQKA 2OBLA 4KZPA 1XF1A 2CB0A 1TRHA 2W5UA 1UBUS 1U4NA 2O3SA 4EEZA 2HF2A 3OQMA 3WVNA 1AY0A 3OO0A 5BR8B 5AJZA 1V5GA 3PD1A 4GQAA 4G5OA 3ZZNA 2VDLB 3P2IA 2HK9A 4RESA 4HN4B 4A8JB 1N6OA 2BZSA 3ZDBA 1J2EA 1TKRA 3HA3A 3IAXA 3GGDA 1BS1A 1IN4A 3R8FA 1A9OA 1XCJA 5DNEA 5KS2A 1Y8CA 2XUDA 3G1TA 4HBGA 5ITVA 2YC2C 3FF4A 4X71A 3PUJA 5AXCA 5IWCA 4HR7A 3MTIA 4QOIA 4HEA6 1ORDA 4A26A 4CU5A 3AIOA 4IF6A 2C7GA 4MV8A 5IAEA 3W6OA 1IBMB 2HU8A 3LOUA 3IIEA 1IFXA 4KI0A 2PZEA 4QL3A 1GJRA 1G3MA 3QF4B 2FQ1A 4JOSA 3SQWA 4BB5A 2GCEA 2VUHB 2XQIA 1EK2A 3R9XB 3C3PA 4CEHB 3ECSA 4YYZA 2H85A 2XNKA 4OAQA 5K8TA 4B46A 3BHNA 2ZSFA 1U2GA 5I9IA 3OCUA 4M8NE 5BR7A 1XDSA 3TBHA 2D7DA 2R97A 2Q5IA 2Y66A 5FLEX 3DUFA 1JKJB 3GRUA 3MJDA 2JBHA 3PQ5A 3SLKA 5B1SA 3UT0A 4DWJA 4OQFA 1KWGA 3AONB 3OX2A 1FUYB 2FQXA 2VF5X 4YS6A 3ODGA 2PE5A 5K7SA 1U3FA 3GZTB 4HLDA 4HDNB 3EH1A 4P7BA 4W7SA 1DBWA 3HC7A 4L3OA 1WUHS 1JMYA 4X8MA 3STTA 2IUYA 1LU9A 5ADUS 2GAIA 4NEHB 1KFKB 1YR1A 3UK7A 4RHTA 5D3QA 2WB2A 1H3NA 2PMDA 2I99A 1EIWA 5CDSA 1BGWA 4WZBA 1QNLA 3QY9A 4H1HA 1TCUA 5G2OA 2VPXA 4FMDB 3EYAA 4ALNA 2Z6UA 5EQTA 4O4JF 5ICSA 5BT8A 4BLQA 4DIEA 4WK4B 1UJNA 4HNTA 4REOA 1QF6A 4ZARA 3A8TA 3D6JA 4FGWA 3H5NA 1D2AA 1HQYE 3Q4GA 4TXNA 1PTJC 1H1LA 4OYYA 2KE5A 5CDFE 2FJ0A 3QQ5A 3BFKA 4JBNA 3SZUA 1PGQA 4K40A 4GEKA 4JI3B 3EARA 1U8EA 1FTNA 1C81A 2HMVA 2EV9A 1H2BA 1GTJ1 1KK3A 1RNLA 4S3MA 3VPDA 2XCRB 1PWYE 1BX1A 3CZRA 3DZKA 1H2WA 4WUVA 4B4KA 3MWJA 2WAAA 5L7WA 4WY2A 4XQ0A 4BVFA 2QN3A 5KVAA 3M70A 3D4PA 1H1TA 1KTVA 4GGPA 4ENVA 3IXMA 4G4SO 4INJA 3A1UA 1RXCA 3H0EA 4YCSA 3U4AA 3L1UA 3M83A 1Y8ZA 2PPLA 2VTVA 1E79A 4JK3A 4XWYA 1FB5A 1LJUA 5FPKA 1QTNA 1D7AA 2EFHB 4CKEA 5CPBA 1GUDA 3PKJA 4URUR 4BB9A 4GVLA 4UEWA 4ZCTA 9LDTA 3ZU5A 2XH8A 1N2CE 2BMWA 2NT4A 3KVNA 2YHAA 1OMOA 3PPXA 5TEWA 3SXPA 3M6IA 4FFVA 4R8KA 5EEGA 1XZ8A 3IAEA 5SZKB 1Q0RA 5LYJF 1GUFA 5FJJA 1YBFA 1MNAA 1T13A 1C41A 4B33A 1OLSA 1XVVA 3ZDAA 2CFSA 5EHXA 5FOWA 1UR5A 4PHGA 5KEIA 2X2EA 1JJVA 1QB8A 2C8VA 1AKRA 2H4JA 2P4EA 3LUJA 4HTFB 4L6CA 2NPFA 4ZGWA 2QUIA 3I39X 4CMHA 1O94C 1ZMBA 3E9QA 3KJHA 4RQBA 2CWDA 3VNQA 2J4FA 1X7ZB 3O2JA 4FOTA 4CIVA 5CW1A 2GB4A 1FFWA 3A9UA 4MRPA 2CFOA 1B8NA 3G2PA 3HYTA 4OU5A 4PRKA 5T6BA 2IEAA 1TIPA 1JP7A 1R6TA 2H7VA 1P8JA 2P7HA 4I2NA 1V7ZA 2ZUSA 1R2QA 4N7BA 2J3KA 3SFVA 1A1VA 4U7FA 1QF7A 3AHEA 4YRNA 4I1IA 1IZYA 1J21A 3K9BA 4HFRA 4LXHA 3I30X 5A3JA 3B7WA 1J2JA 1J1IA 2RAVA 3A4TA 4B3DA 2R1ZA 2CMDA 4NSNA 5K9ZA 3LPAA 1ORIA 2H1CA 2OBXA 1B3BA 1RDFA 4HPJB 4QAQA 4CIAA 2ADFA 3LX8A 3TVYA 3QLJA 5JOQA 1CZOA 1L4GA 2Q5HA 3KV1A 1CEEA 3IE1A 4RWEA 1BOFA 4BRSA 5ALOA 4M0DA 4BO9A 2ZVPX 4FOLA 1G63A 5SY6A 2XKAA 3NUGA 1CR6A 1NLZA 5DN9A 4RSHA 4J4BA 3CW9A 4M60A 5ABPA 2ZI5A 1XNJA 4QVKA 3EEIA 3L02A 2GN9A 4UNRA 1RYDA 3E8MA 4HDOB 3PNQA 5BYJA 4R2WA 1U7WA 1HUQA 3SR0A 1UBSB 1A4UA 2IS4A 4RKYA 4OBWA 1BN6A 2FFJA 2JA1A 2YV5A 421PA 3QXCA 4BGDA 2PBRA 5EIWA 4DUPA 5BN4A 2UZIR 3G3EA 2VPQA 3U61B 4N39A 4Q3CA 3ZWPA 3R4VA 3NORA 2NNLD 3RRZA 1M6WA 3L8DA 4AJPA 4XWAA 8AT1A 3GLSA 3MXTA 1E9AA 3T7JA 3QEKA 4JI8B 1S96A 1PV1A 1LQ2A 4OQ4A 1NNI1 1QQ7A 3Q2IA 4B0PA 2A6PA 2I6UA 4W9RA 4XOIA 5CB4A 2IVZA 5LDHA 2I2XB 3PVSA 4FZVA 3PRHA 3WMRA 2ZUEA 4KAAA 4P5EA 4FP9A 4MGIR 1IBSA 3RYFA 2IYPA 3WXBA 1N25A 4L8FA 2VHWA 4YYEA 4CKEB 3QELA 3SFZA 3IE0A 3D43A 1Y8RB 1FA9A 2V7VA 1GAWA 2YIDA 3QX9A 1DIGA 1E8DA 2PWBA 4CEIB 5BUZA 2JRCA 3LD9A 3SSOA 4KWIA 1YHYA 1ZWLA 1K2WA 4RE5A 4F4IA 5TGDA 5EIXA 4RABA 4CMIB 2QX8A 5TGZA 1GPYA 3FPLA 2LW7A 1N5LA 1W44A 2YN4A 3U7QA 3MAGA 4CBVA 1Z9BA 4UUNA 1EH5A 2IDMA 5TQVA 2Q6IA 1Z26A 4GDFA 1B6TA 4XRGA 1ODIA 2VDWA 3BGDA 1XKTA 3LL7A 5FYQA 4EAQA 4BLPA 3W8EA 2DFNA 4ENUA 1CUSA 1NQVA 1ST2A 2BISA 1GRNA 2X8WA 3A3KA 3R6LA 4LDJA 3VSAA 1NXQA 3O4RA 1OLUA 4IDNA 5TQ0A 4O8CA 3SGLA 3SWWA 2EQBA 3UG6A 1W30A 3B20A 4L5BA 4BWGA 2ATEA 2HMWA 2PQ6A 1YQUA 4JZYA 4MUYA 2E48A 3DEAA 1HSOA 4DRXA 2V6IA 3N70A 1YIOA 3G85A 2IXBA 2W2TA 3DDUA 3HCAA 1GHTA 1JZQA 2WUEA 3NBZC 4FMCF 5DW0A 1AK2A 1YRQA 4RYDA 5B2ZA 3OLCX 4RXUA 5FR2A 2V1XA 3WGLA 1NAIA 1F0YA 4G5SA 3N28A 3J7AC 3B1JA 3RO7A 4DV2B 5AK0A 5F5LA 3H04A 3N5CA 5DCYA 4B7AA 1OWNA 1Z33A 3G1WA 4KCGA 5CLIA 3WLFA 2UYGA 1JNYA 1JSCA 1QHIA 4TVSA 2IP4A 4DKXA 3I23A 4QDJA 1NLUA 4DSZA 1L4BA 5EINA 3ZGXA 3D6HA 3P20A 4B34A 1X1CA 4D02A 4BWVA 4DDHA 4NG5A 1WKCA 1GPLA 3N6XA 3Q6IA 1M8JA 1P7PA 3F8WA 2HSZA 5P21A 2ZLBA 4R0MA 2V7BA 1Z6AA 4R9RA 5TS2A 1A5TA 4UZEA 2AFRA 4AKSA 2Q9AA 4TTVA 3BWCA 2GAJA 1YR8A 1N2EA 3OSZA 1YRLA 2DBVO 1Y6ZA 1E6WA 4CDMA 4TZ0A 1TUGA 1Z2NX 5H3CA 4W99A 1L5FA 3HEMA 4CJXA 1QIHA 1KQOA 2ZB3A 3NTUA 5CP8A 4CXMA 1UWKA 2VAMA 3I8XA 1Y4AE 1JBEA 1XZKA 2GJ4A 1P29A 1RW4A 3P9NA 1EX9A 2HCBA 4HLUA 2ORIA 1KBZA 4K9PA 4Y2XA 1XN4A 5D3MB 3PL5A 3AKCA 1AKMA 4Q9NA 2HR1A 2OGZA 4HDKA 1JSRA 2BGWA 3PENA 2O8DA 3OJCA 3IP7A 2I8AA 2C9ZA 3NJ8A 4M0UA 1ZCAA 4YACA 1YBAA 2DQZA 3DZJA 3G0IA 4P35A 3IJPA 3UPDA 2X42A 3PQ4A 3GJXC 1BJKA 2PBLA 3LCMA 4FONA 3IJRA 3T12A 3VPBA 1XOIA 3ZJ5A 4RENA 2XW6A 3HKCB 4UFPA 2HMTA 3KPYA 1U8UA 5J2UA 3K9NA 3PJRA 3JRNA 3HCPA 4O29A 2WSIA 3ICCA 3KKEA 1PT7A 3LLSA 3C1TA 2J45A 2ZXUA 4LMAA 4X8LA 5EYPB 1RQ2A 1OXTA 2JLSA 5B58T 2XNJA 4PXYA 2A7XA 1ZGZA 4YJHB 4M1MA 4C6RA 4UBNA 5DB4A 4YP1A 3SHFA 5AVYA 4G9EA 3BH0A 3JD2A 1NRJB 4JKIA 2OOSA 2J59A 4TN5A 4HVTA 1D3AA 3RSHA 4BJ6A 5EIAA 1T1IA 4BMSA 2B3TA 3ILHA 2VHQA 5DNWA 3T7RA 5BYKA 1UMDB 3PGJA 1H9BA 3C14C 3O8OB 3VNBA 4P36A 3HXTA 4YRAA 2R00A 5B1EA 1MX1A 4LHVA 3KXPA 4MV6A 4TSRA 2Q2QA 1QAMA 5HQJA 2PKCA 4G0ZA 2W6JD 1AKUA 1V7CA 2ZJYA 3LA8A 2N42A 5JCJA 1Q0TA 1YO6A 3P45A 4YRSA 4D2IA 5L6MB 3GO4A 3FHLA 3JASA 1QE0A 5E9WA 5HTOA 1Q19A 1A8QA 3T3EA 2IYLD 2O2IA 3B3QA 4N9QA 1QM5A 3HN2A 5G41A 1PNVA 3QVUA 1U0LA 4HWOA 2V9CA 3CZMA 1YKFA 2BI7A 3UT6A 1FQWA 1M83A 1YA4A 5ITWA 1BDJA 3I0NA 4QOGA 3G5AA 3LLUA 1R7RA 1KY2A 1Z0JA 4MO2A 3RIYA 2HU7A 3C3EA 3RE1A 5JW6A 3QVGA 2PGAA 3L43A 3LH5A 3ZDQA 3FOFC 2NADA 4NS4A 1EG7A 2GI4A 1IWBB 2XGJA 4I9NA 2D3WA 4D0SA 4AUKA 4BTLA 4Q9AA 2IV3A 1W0JD 4JLWA 1YTLA 1OAAA 1XC7A 5TQ2B 1I3KA 1N1DA 5LOVA 3QKUA 1KMHB 1UKCA 4X7PA 2PD4A 1R4AA 1CIJA 4UQOA 3HV0A 4GPD1 4PXSA 3QA9A 4RMNA 4Y2QA 4HNQA 1MJ5A 4W5HA 1Z2DA 3D2BA 3WDKA 3LT2A 2EFDB 3VVLA 4B6OA 3BE5A 5JPDA 1B76A 1ZSVA 2AR7A 4YGXB 4EY3A 4L2IA 2CHEA 1CW2B 2QJOA 2OQVA 5BR4A 3F4LA 3OE5A 1T5SA 2HK7A 1G16A 2HJGA 4NAUA 3G6WA 3AEYA 1J0AA 4YMWA 2XXAB 1ZK2A 2O06A 3RRXA 3UAZA 1X1SA 3PD0A 4GI7A 2VK8A 2OORC 4KO1S 3S8EA 3S2ZA 5K6RA 1PJSA 1Y1PA 3QEJA 3KKLA 3ECAA 2GRAA 5ALZA 3WDSA 4EBBA 2VCEA 1LBEA 4AJ2A 3EA5A 4J1NA 4DEYA 2R25B 5ITZB 3PGMA 3QK7A 4UDXX 3TOSA 1JDZA 3FETA 4BLOA 4F91B 2X5OA 1JSXA 2D54A 3DHVA 5IUNC 4YIHA 5FKJA 3LUHA 1XXHA 2Y0DA 3W0LB 5CT9A 1NW3A 3SQMA 2GVZC 2BBWA 1Y4SA 1CZNA 1KVUA 2D0PB 1LBHA 3MUFA 1NLMA 3PHJA 4CQMD 4TSFD 3CWZA 2GZ2A 2GNPA 2FFAA 2CLKB 4OLJA 3I09A 1NVVQ 4Z0NA 1DTWB 3KR9A 4I14A 1SWWA 1YDMA 3ONEA 3ZTYA 2GZAA 4I81A 4XYEA 1R8SA 3NAMA 4YO8A 1E61A 5E8RA 1BGVA 3MUNA 2NV2B 1PJZA 5I7AA 3OBIA 2NYAA 4IIFA 2AWOA 1Z0KA 2VWQA 1RJWA 5EE0A 1I2DA 2FF7A 4L0DA 1TT5A 2PO7A 1JW9B 3RTEA 4N7RA 5K1ZA 2GQ0A 1A7AA 2Q5JA 2RGAA 3VNSA 1E2MA 1TLTA 1VHWA 3ZDRA 4B47A 2OGSA 5I9NA 2LRHA 1E99A 1Y34E 1DC3A 3ELUA 3JSXA 4TQGA 4BEJA 2JD0A 4ZPJA 3MINB 1VIVA 4F8YA 3TGPA 3CWCA 2P1RA 3DLAA 4U3JA 1HFJA 1GDDA 1SD2A 1QIMA 1D4FA 2NZJA 4UHCA 5D86A 1OAOA 2CJFA 1A7KA 1OIVA 4D9JA 9GPBA 5JMWA 5HKAA 1P39A 1YRAA 3FPGA 4FGSA 3L06A 2A67A 2XNDD 3T61A 2V0GA 4ARCA 2R4QA 2WOOA 3CMCO 3P7MA 3REOA 4D8YA 3CUVA 4JLPA 1TJ4A 1ACJA 1CRLA 2Q50A 2RG7A 4FKZA 5DNDA 1R8YA 1BVYF 4JJFA 4NJOA 2VYNA 4Y6OA 3VNRA 2ZSBA 3ZXXA 1GPAA 1PQYA 2IP1A 3I0MA 3IOYA 4R84A 2I4LA 3IQEA 4TPKA 3RVJA 3TFWA 2OBFA 2RGDA 3ESZA 1ZA2A 2HK8A 2QVXX 1PDWA 3IYLW 1O6CA 3WGMA 4ASUD 4CKXA 5BW5A 2AWNA 4JJZA 1W4AA 4GWLA 4QEDA 3EQ2A 4BQFA 1HG1A 4EYSA 2XZLA 4BN0A 2AE2A 1YB1A 1FDIA 3AFMA 2E89A 5K3BA 4BQSA 5KKCA 3KPVA 3DV2A 3GD7A 3G1UA 1C50A 2TECE 5LLDA 5JAUA 3PGLA 2QK4A 3WGUA 3PUWA 5KWSA 3UH1A 2CZQA 4PLZA 2G6BA 3KWLA 2C3PA 4A03A 4D9HA 2ZXEA 4YXFA 1V9LA 4FYXA 5IM4F 1GTMA 1R16A 3ZY5A 1P1CA 2RI0A 3I72A 1F4PA 1S02A 3DZFA 1RM5A 3LRXA 4M38A 2EBFX 2Q5LA 4I9GA 4LDRA 3TL6A 3VMMA 1U02A 1M67A 3PXAA 5U1PA 3H9EO 3RSZA 5K0EA 4KUEA 1KJZA 1N4AA 2VT6A 1QVAA 3AGQA 1GG5A 5F7XA 1TTTA 3VR4H 1Z7YA 2HF7A 2GYWA 4D6XA 4WXEA 2P6NA 1DAMA 2V7GA 5BV8A 1EZ1A 2CNWD 3NHRA 3DEKA 2QUHA 1U3DA 3MFQA 1QAOA 1BWQA 3NGLA 4BBZA 3K5IA 5JU6A 2VBFA 5BSHA 1PWZA 3JZDA 5CEEA 4B45A 1IM8A 1HDGO 1RT9A 3LI2A 3BGSA 1R66A 5B36A 1PT9A 2BYTA 3E48A 3HABA 2YHSA 2FOIA 3I73A 4MSUA 3AFNA 5CM9C 1Z8DA 4JI0B 4MPRA 1NQUA 3E4CA 3TD9A 4CYMA 3WSWA 3UHPA 1NVFA 2J9FB 1KR2A 3U3OA 4MLPA 2DECA 2V6JA 5ECGC 3EW9A 3MCWA 1CUVA 2IYUA 3G9TA 3S27A 5IW8A 3UJBA 3JYOA 2PH1A 4N3AA 1JLMA 3K6KA 4YECA 2QQGA 1WQ4A 2CCKA 4TZKA 1VI6A 4FEYA 1JG1A 1WX1A 2VJYA 4YNBA 2A14A 2AYZA 1CQPA 4EUNA 2C9DA 2O2YA 2C1ZA 5F98A 2YJ3A 4TQAA 1A9QA 3LY8A 5AKHA 1I24A 5IC4A 5TGTA 3T4PA 1F06A 3L0PA 3O26A 2FE4A 2J6IA 2IXFA 2DWOA 5FI0B 1YWGO 3EZ7A 4MWZA 3CPHA 3QNUA 1K0FA 2XMSA 4A5OA 5C1OA 3TNJA 3HYCA 1VJ0A 1QIEA 1YQWA 3C6QA 4K6GA 5TF0A 4LGMA 2YOFA 2NO5A 3RRFA 5B3LA 1FVOA 2H08A 4FYMA 3NDBB 2B36A 1MCZA 1OXVA 4G5GA 4RZ2A 3L93A 4WK0B 1V3TA 1AMOA 1P2DA 2D3TA 1U63A 1FP4A 3VHQA 4YMLA 5B37A 1EE1A 2FYTA 4XUDA 1FX1A 4P4SA 5SZIA 2F9MA 3QMWA 4TYPA 2FZGA 4R1OA 1GN9A 5CLLA 1X80B 3H4TA 3AKDA 3GFGA 3SDBA 1S4QA 5SY4A 1Z17A 3G2MA 3BGWA 4XAQA 2XWBF 3LBYA 4UUMA 1UC5B 2VYVD 1VC2A 5G0TA 3U37A 5I47A 1G59A 1FS6A 4HNHA 3FPAA 4TV8F 3OU7A 3WLTA 4ZIRA 3WGZA 3F5SA 3FAZA 4ZVMA 2JJYA 2OENG 2PK3A 4TXMA 5AOCA 3WJ7A 4TTQA 3I2KA 1F3LA 2I78A 2PVCA 3CEAA 3KSRA 4GVXA 2G9NA 4C04A 5L3VA 2H4ZA 2VSFA 3CEMA 3E5RA 5IMSA 3EUAA 1QP7A 3NBAA 2PS9A 4ERXA 3T7KA 1QWSA 1Z6PA 2GS9A 3PUHA 4JLVA 4X9XA 4C08A 1K8XB 4XASA 3MN1A 2BH9A 4HX2A 5H0IA 4QYIA 4HB3A 1AQ6A 2N3ZA 1AS2A 1FFHA 4FM9A 2YWXA 1WWKA 1B14A 4H77A 4GOJA 4PSVA 2R6R1 1TU4A 2H65A 2PXAA 3FDZB 1G291 2NZUG 2DMRA 3MBOA 5E9AA 3VO9A 3WLPA 4DUGD 2QIPA 2NUPA 2X1VA 4CZ2A 3IAM6 2XCLA 1OH6A 3WK9A 4GBJA 3FNBA 4GXTA 1C8VB 1Z37A 3TRFA 3L8FA 2HGSA 1E4EA 4U5QA 5CFNA 3DL4A 4I6JA 5CVCA 4TWAA 5F2OA 1ZRHA 1ORVA 2GLXA 3WIUA 3EXAA 4EYOA 1FP2A 1N92A 1PR9A 5E6UB 6ABPA 3IIJA 2H0QA 4ZVLA 2GCGA 3ZE7A 1JWAB 3JU3A 4CCYA 2H5JA 3EISA 5DRTA 5AWFC 4UTXA 5BV1A 4JXZA 2GD0A 3DWEX 3JAWA 1UANA 1XTVA 4JJ7A 4YMIA 3WL5A 4B4UA 1M73E 3HMKA 4QUEA 4KW7A 2MYTA 4S1TA 3N59A 4B9EA 5DX1A 3IR7A 1PFUA 4RTJA 5AJTA 3C70A 3LCUA 4YQFA 2XNCA 1BD3A 2PMCA 4FOPA 3A1SA 4M0FA 4HNUA 3DTNA 5EJ5A 4MROA 4JOBA 5AUPB 1NNEA 2QLJA 3CNNA 1UBGA 1Y8AA 4L15A 4HWGA 5CDTA 3T1YB 3D3EA 5LD2B 5DFAA 2C3YA 3NIFB 5CXQA 4AZ0A 3ROGA 5K0FA 2DB3A 3VJMA 2BV3A 5EPOA 3DFKA 2C9BA 2PT7A 2G5PA 4KH1A 3WZLA 2AC7A 3W04A 2NYVA 3TQHA 5REQB 1V1RA 1GZVA 2P2SA 4J0IA 5K3CA 4IVNA 1DRUA 3DNMA 1E5VA 1SVLA 2YS7A 3PDJA 5FNVF 1N6PA 4GL4A 3ED5A 4WLUA 4ALJA 4FZ5A 4G07A 3C6BA 3CCCA 1DKQA 1QYXA 1VKNA 4HXGA 4YLGA 1BFDA 1FRQA 5DEIA 5HMLA 3WYAA 1PJQA 2QN7A 4OXYA 1NJ1A 3HXKA 1XQVA 4KR6A 4V0QA 2PKQO 5TMDA 3KAKA 1PLJA 1ECJA 1MRSA 1YQQA 3CF4A 4GE0A 4M4SA 4YRMA 4H27A 3R1IA 4IWYA 1P17A 2JBAB 1WETA 1LBSA 1SEPA 1K98A 2DH5A 2UZ1B 4MYSA 4QOJA 1NP6A 5KJFA 2X9LA 3NOQA 4NE7A 4BVKA 1KTIA 5AM2A 3KSMA 4ER0A 1P9OA 4G01B 4OJNA 3EIXA 4IMRA 3SYMA 2KWIA 3HDJA 4U7WA 1T29A 1XZNA 1V4NA 1F9EA 4LJ9A 1KEVA 3KLBA 1TYZA 1KDPA 3VA7A 3NHAA 5CFPA 3T3NA 3PWTA 1EE9A 4NKRA 1W4RA 3IBCA 3DLHA 1P7YA 1XZDA 5WRFA 5IMBA 3KDPA 3RVSA 2XTAA 4RL6A 4XEUA 3WQHA 4DARA 3VC2A 4E4RA 4OI2A 5IJ9A 4XUGB 4B6QA 4MUHA 5E7IA 4B7XA 1KJNA 1R0ZA 5B5SA 1RAIA 2G63A 3E3NA 2J67A 1CVIA 3ESDA 1SPBS 2QZSA 2CEKA 2GPJA 3M82A 4U7GA 4KL8S 5DTRA 1KEPA 1JQ5A 2ARKA 1GGEA 3NEYA 3FNGA 3OTQA 4WE3A 4LRWA 3S2IA 3TZKA 3LCJA 5DHSA 2QSJA 4X5OA 3USCS 4ZDIA 1WUKS 1Z7WA 2BBOA 3BMNA 3IOMA 2QMYA 3LUFA 1FTSA 1V1MA 2GT1A 3PFGA 3QIAA 4Z9BA 1AMUA 4UM9B 1DU4A 3OHMA 4G0NA 2PQ0A 4QDXA 3GFPA 4MP6A 3U3XA 3ZBQA 3PG5A 3Q0TA 4BO6A 5C1DA 3PC2A 4BTEA 3GDOA 1E7MA 2BEUA 1M76A 2DWCA 3AKYA 3GEBA 4R98A 2KLHA 5T4EA 2VHTA 1P80A 4G2NA 1II8A 1M54A 4XWGA 4G3XA 1R5JA 1GGVA 3K9GA 5EKDA 1LF0A 2GBFA 1U9YA 1V6SA 1N7HA 2R6JA 4DC1A 1RZVA 1JFTA 4JL8A 3N87A 3CVOA 2WU3A 3CH4B 4I6GA 5CA0A 1JFFB 2I1QA 4NAVA 3IS3A 1XFDA 5CHEA 1RPNA 1CY7A 3JQGA 5JDCC 1VCMA 2ZYAA 3MOIA 3OOWA 1FZTA 4Y2TA 1B3RA 3BJRA 3EODA 2Q0SA 1MOZA 3TTVA 3V1TC 3DFIA 3KG2A 2FU5C 2AEFA 1ONSA 3AZQA 3GEPA 4QPPA 2MCFA 4Z4IA 1UJCA 5JJKA 3KYDA 3SS7X 5FTNA 1UOOA 5EGSA 1MG5A 1SUBA 5FBRB 3B70A 4OAOA 1EP9A 1RXWA 2CVHA 3AMVA 2GD2A 5J63A 1WPQA 4RZSA 5T6MA 4WJZA 3ENQA 4UHKA 3TXAA 4EG8A 1Y4ZA 2O1WA 3EF0A 4EGFA 2P0EA 3PGA1 4U2FA 4OI1A 2HDHA 1DAEA 5KYWA 2A0FA 2IXAA 3U40A 2Y0EA 2ZGVA 3I0ZA 3PUIA 4R31A 4CTJA 4YRZA 3Q11A 5CB6A 4LHWA 5HKKD 2Q3JA 4RBNA 2QJRA 5JECA 3O8DA 2HJSA 3DEYX 4KQ9A 3ZV7A 4O1IA 3PNSA 3L6CA 4C06A 1QZUA 5IAOA 1OV6A 1IK6A 1TFRA 3C16C 4S24A 1H8HA 4DADA 1N4DA 3R7NA 3EW7A 1U04A 1ES9A 4TUYA 4M98A 4IDBA 5TDHA 3AVUA 1L8OA 3PDCA 2CHUA 2E4UA 3R3ZA 3MNFA 2UAGA 4U7TB 4U00A 4IQ8A 2GNOA 3U39A 5IJAA 1TAQA 1B4DA 3NP9A 1X1AA 2DQ4A 3E27A 4TYYA 5DWVA 1DC4A 1X7YB 2EZ8A 4HF7A 4KXLA 4C6HA 5HCNA 1ND6A 3AB8A 5TB5A 4LF7B 1BHJA 2IYWA 5C8YF 2XX3A 2EZ4A 5E1OA 1TPZA 1PK7A 3A9SA 3GH1A 4KIWA 2HA5A 4CEIA 5BSGA 1ZC4A 3O31A 3H2HA 2PGJA 2WE8A 3PIIA 2FPSA 2L69A 3BWXA 4CM9D 4X62B 2NX2A 3GEMA 2B92A 3HJCA 3TQTA 3K1ZA 2EYQA 3A3OA 1BJRE 5KPJA 5DKFA 1E0AA 4IQGA 4NFYA 2OP1A 3E9EA 1XRPA 4FFNA 5TPWB 5DHUA 3AVWA 1J00A 1GUAA 3AY3A 2OWEA 1J2RA 2V8OA 3PR1A 5BQOA 4PYKA 5LYYA 1Y3CE 1T1RA 3HB7A 3JWGA 3QU9A 1X1EA 5CDGA 3OPYI 2A1TR 1EHCA 2J3LA 2XQGA 3MOGA 3QVVA 1ISGA 1I33A 2AFHB 1NX6A 2QY9A 4MEJA 4LY9A 4QULA 1KEEA 5B12A 4B2LA 5KJ6A 1FNMA 4O1HA 4I2VA 1O57A 3CRZA 3KBOA 5FBZA 3F5DA 1KS9A 5ALUA 3ONNA 3PCRB 4ZOCA 1UZLA 4DDUA 1LRKA 2C9OA 4WH0A 4EW3A 1KS2A 3TJZA 3S40A 3HVRA 2BEUB 3RNOA 2ABWA 2E21A 5CB4F 2DY1A 4IIUA 4MI1A 4DJDC 9MHTA 4I1UA 4LNUA 3UBMA 3OE7D 2AHOA 3VM6A 1T3LA 1FE8A 2YWFA 3PLRA 4ZCSA 4AP5A 2I4IA 1N5JA 4DBZA 1LD3A 1T8YA 5F51A 2PUDA 5AK4A 1U6KA 4BFYA 4M0EA 3KQVA 3WLEA 2V7PA 3ANNA 3EXHB 1X3SA 4LZWA 3O4VA 3ZE6A 5CT4A 2A57A 1DELA 2ZKLA 2ZSIA 4PNZA 2VSNA 4TS1A 4Q1EA 4CMAA 1XYGA 2QRUA 1YZKA 2JLBA 1KI8A 3AEZA 3O73A 4LMRA 5HMMA 1DTEA 4F1KA 1GA6A 2GJ9A 2V0CA 3ITDA 2ZZMA 3WS7A 4RLHA 3NGXA 4OMFG 2GN2A 3GLIA 2A9PA 3FE2A 3ISJA 3NBKA 1JH9A 1PO7A 2EFCB 2J5BA 3K31A 5JI2E 1J8MF 2ZIXB 3CLTD 1RKVA 1YI8A 4NLLA 4DJEC 2VDNB 3HGQA 3LM8A 1LNZA 2AMFA 4L78A 1GPNA 1WMEA 2QRNA 4QTXA 3B9RA 4C7KA 3OQOA 4Q6WA 1O7JA 2OESA 1KI1A 3JVEA 1N5OX 1EJ2A 3VPGA 2ZTVA 4YUYA 1IJEA 4PLTA 2IOFK 4IQ0A 3PYLA 1T9ZA 3C3DA 1GZHB 2IXDA 3E70C 3MCVA 1WVMA 4M9RA 4B4DA 4C0WA 3H1TA 4W5RA 3TINA 2CZCA 3CVUA 3P0JA 1M72A 3NDIA 1KI6B 2DGDA 2XF8A 4YO7A 2OO5C 3E3OA 4GZ3A 1C3JA 1POWA 5A04A 3AJ9A 3UATA 4XYBA 4AO8A 3FR7A 2PVPA 2A33A 3IKJA 2ZYSA 2BJHA 5F2KA 3CFYA 2GSWA 1AMNA 5I4CA 3OM8A 4DG8A 1OIXA 5HX7A 1R15A 4HY3A 1G8AA 3VSEA 3JR3A 2FP4A 4AZSA 3ZQJA 4YV2A 3B1VA 4QVGA 4D3FA 1BMDA 3KOYA 5LPNA 4R1TA 1GQ2A 3PDIA 1QOPB 1XDUA 4BKRA 5C37A 1P60A 1E1MA 2WWWA 3AILA 4BDSA 1UBCA 5FNVA 2QPTA 1YB4A 3EXIB 5KTNA 1PHRA 3DKKA 1NJGA 1TUBA 3EZ6A 3KJEA 5DX8A 2PR7A 1V45E 1T9KA 3IAUA 2XUZA 4BMNA 2V4MA 1HEIA 3KB8A 1CRPA 1EVYA 2IC5A 3OKFA 4DRYA 1JAXA 4MQ6A 1KJQA 1N0HA 2QRVB 1CY0A 2FJPA 4RY8A 1QKIA 2QW8A 1VPEA 3CEJA 4EPRA 3Q8KA 1GEGA 4MZXA 2WYIA 3D8BA 2AOUB 1D8TA 1P4SA 1RHMA 2I7VA 3LTEA 4W5JA 4YJGB 2A3NA 3EY9A 2YHBA 2E1PA 5J5CA 4IICA 2XT9A 3SEQA 1GTVA 1P1IA 2QV0A 3CN9A 3L8ZA 4TQ9A 4RTLA 1GWNA 3HPRA 4LJYA 5TY0A 4BO2A 3TSCA 4LTMA 3ZWNA 1NRIA 4MUIA 4YCJA 5JXGA 3EVBA 1BROA 1N0VC 2IOYA 3MWYW 3EGOA 1N2BA 5IYZB 3EJ6A 4PO9A 4BPRA 1H2ZA 1KEZA 2DTEA 2WHPB 5GY7A 2XYHA 2DTDA 3B3FA 1CQZA 1NR1A 1T3SA 4EJMA 1N1MA 2QF7A 4ZRDA 1IBRA 1ZOIA 4GD3Q 1HORA 3USES 1IZZA 1CQIA 4FJ0A 3MBIA 1O03A 4NYJR 4RMGA 1YF3A 3R9WA 2JK0A 2F4NA 2WRZA 3X1KA 1VGRA 4QSMA 1X38A 1I30A 5TSDA 4AG3A 5KDDA 4ZCMA 3PNKA 4P58A 4LYDA 1OILA 2C5BA 2FEMA 4FMBB 5B6JA 4GI5A 3OQ6A 4TV9B 2ZRGA 3AJRA 1P0IA 1RWQA 2A5DA 1T1SA 2IW3A 2CFCA 4CM4B 3VU9B 4KQ1A 5KCMA 3UCXA 4XPIB 3KLMX 5M5BA 1PR5A 4YAIA 3HVIA 2PEYA 5CT8A 3K0AA 1TA9A 3FIJA 4IVQA 5L45A 2XXAA 2V74B 4I55A 4TYWA 2P2ZA 1EAYA 2HAEA 2QMOA 2PGLA 3E81A 2NXJA 3HVHA 4HUJA 4YT5A 1FMTA 1RSZA 2B7CA 5T3UA 1S2LA 3FD8A 1M2HA 4M9UA 5JWHA 1RYZA 2WPDD 1Q2XA 3DMYA 1CK4A 4NPCA 4PZDA 3TSWA 3V8NA 1U9IA 3AUTA 4ZQFA 1ZI6A 2QT1A 3GP5A 4FGZA 5AH0A 1NN1A